Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001478-protein ID=TCONS_00001478-protein|Name=TCONS_00001478-protein|organism=Clytia hemisphaerica|type=polypeptide|length=549bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001478-protein vs. Swiss-Prot (Human)
Match: ICEF1 (Interactor protein for cytohesin exchange factors 1 OS=Homo sapiens GN=IPCEF1 PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.331e-16 Identity = 42/111 (37.84%), Postives = 60/111 (54.05%), Query Frame = 0 Query: 192 VSCRALGKADHEGWMFKKAGGHGIVPVSWKKFWVVIKLGKIYCYKTSFNMQADYLFMVTDYSVDNATEKKKNFAFVLKPNEEDKKGVIFACETEQECNDWMGTINKILSGV 302 +SC+ LG AD +GW++KK + WKKFWV++K +Y Y +AD + D++V+ A+E KK AF K + K FA E QE N W+ NK+ S V Sbjct: 34 ISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILKGSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAF--KISHPQIKTFYFAAENVQEMNVWL---NKLGSAV 139 The following BLAST results are available for this feature:
BLAST of TCONS_00001478-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|