Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000914-protein ID=TCONS_00000914-protein|Name=achaete-scute like|organism=Clytia hemisphaerica|type=polypeptide|length=179bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of achaete-scute like vs. Swiss-Prot (Human)
Match: ASCL4 (Achaete-scute homolog 4 OS=Homo sapiens GN=ASCL4 PE=1 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 1.268e-26 Identity = 54/85 (63.53%), Postives = 59/85 (69.41%), Query Frame = 0 Query: 88 EPGFIRKRNERERMRVRNVNEGYARLRDHLPLEPTEKRLSKVETLRGAIRYIKLLQSVLGEPKQAMTPSATTT-QRRTSDRSDGE 171 EP F+RKRNERER RVR VNEGYARLRDHLP E +KRLSKVETLR AI YIK LQ +L + +A QRR SDGE Sbjct: 70 EPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGE 154 The following BLAST results are available for this feature:
BLAST of achaete-scute like vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|