Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00000723-protein ID=TCONS_00000723-protein|Name=Hand bHLH transcription factor|organism=Clytia hemisphaerica|type=polypeptide|length=265bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Hand bHLH transcription factor vs. Swiss-Prot (Human)
Match: HAND2 (Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens GN=HAND2 PE=1 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 4.644e-19 Identity = 50/124 (40.32%), Postives = 68/124 (54.84%), Query Frame = 0 Query: 141 KNTRRSETINIAFAAVRGCIPNVSEDTKLSKIQTLRLAISYMRFLMSCLGDYRFMMLMNDKERELYKEFFEEDKKVKQSEDHDKEDNKDLECLNDEPSSDKVDDKDRLKGRSRWPQVLWQTTLK 264 K RR+++IN AFA +R CIPNV DTKLSKI+TLRLA SY+ +LM +L D + + F E KK E+ K++ LN+ S + + KGR+ WPQ +W LK Sbjct: 107 KERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMD--------LLAKDDQNGEAEAFKAEIKKTDVKEEKRKKE------LNEILKSTVSSNDKKTKGRTGWPQHVWALELK 216 The following BLAST results are available for this feature:
BLAST of Hand bHLH transcription factor vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|