Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00073227-protein ID=TCONS_00073227-protein|Name=TCONS_00073227-protein|organism=Clytia hemisphaerica|type=polypeptide|length=125bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00073227-protein vs. Swiss-Prot (Human)
Match: TPC (Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.318e-20 Identity = 45/133 (33.83%), Postives = 76/133 (57.14%), Query Frame = 0 Query: 1 MIPNLAYVFPYCGLNFLFYGLLNR--TWNLLQF--RESSVKSLTCGTISGIFAKALLLPIDNVKKRLQVQGSKDFQSS------YKGMVNCLQTVIREQGIHALYRGIVPSVLKTGLATGISFFVYEETCKLL 123 + P L +FPY GL F Y L W + + ++++L CG+ +G+ +K L P+D KKRLQV G + +++ YKG+++C + V++++G ++G+ PS+LK L+TG FF YE C + Sbjct: 178 LAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVF 310 The following BLAST results are available for this feature:
BLAST of TCONS_00073227-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|