Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058466-protein ID=TCONS_00058466-protein|Name=TCONS_00058466-protein|organism=Clytia hemisphaerica|type=polypeptide|length=405bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058466-protein vs. Swiss-Prot (Human)
Match: DMTA2 (Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens GN=DMRTA2 PE=2 SV=2) HSP 1 Score: 90.8929 bits (224), Expect = 9.117e-20 Identity = 34/56 (60.71%), Postives = 47/56 (83.93%), Query Frame = 0 Query: 59 RAPKCARCRNHGIVNSLKGHKHFCQWKNCTCARCQVVVERQRITASRVASLRQQRK 114 R PKCARCRNHG+V++LKGHK +C+WK+C CA+C ++ ERQR+ A++VA RQQ + Sbjct: 66 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQ 121 The following BLAST results are available for this feature:
BLAST of TCONS_00058466-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|