Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00045431-protein ID=TCONS_00045431-protein|Name=TCONS_00045431-protein|organism=Clytia hemisphaerica|type=polypeptide|length=147bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00045431-protein vs. Swiss-Prot (Human)
Match: DRAM2 (DNA damage-regulated autophagy modulator protein 2 OS=Homo sapiens GN=DRAM2 PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 4.603e-16 Identity = 41/116 (35.34%), Postives = 64/116 (55.17%), Query Frame = 0 Query: 9 FSVGLGIFPILFCVVSALTFLTTYMIAVSNNHLYPWLPTISDTGGDKPEANIFSLFLSISSFLCLIVTYIRYRQFNFISDGIRGVTYATRFTCCNKASFVTGIVASVGAGIVASFQ 124 F GL P + ++ F+ +Y+ AV+ +H+ P LP ISDTG PE +F L+I++ LC+ Y+RY+Q + +S + NKA V GI++ +G IVA+FQ Sbjct: 4 FQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAMLNIAAVLCIATIYVRYKQVHALSPEENVIIK------LNKAGLVLGILSCLGLSIVANFQ 113 The following BLAST results are available for this feature:
BLAST of TCONS_00045431-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|