Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073832 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073832
Unique NameTCONS_00073832
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1960

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073832 ID=TCONS_00073832|Name=TCONS_00073832|organism=Clytia hemisphaerica|type=transcript|length=1960bp
ATCGAcaatcaaagaaatattttgagtgGATCAGataATCTTCATTATGC
AGATGTGGACAGTGATTACGCTCATCCAACTATATGTCTCTGGCTCATTC
TGTCGACAATTTCTCAACAACATAGACGACGAAGACAGTTGGTATCCAAT
AGATTATTCGAGCGAATCTTCTGCTGAACACTCTATTGAGGATGAAACAT
ACAACAAATCACCATTTGTTTCAGAAAGAAGACAATATGCTGACCCTTTC
CAAGAAAACGATATGGAGCCAAACTTTTATGAAGAAATTGACGAAAATAA
GATGGTGAGAATCACAGGCTACGAAAATATACCAGCAGTTCGTCCAACAC
AAAAACAAGATACAACAGAAACAGCCACTACAACTGCTGCCCCAACTACA
CCTCATTCCCATAAACCATCTCGCACTAACTCTACTGACCAAACAAAACC
TGGAAATCTCGCtagaaaattgcaaaatgaagaagaagaccCGCTCTGGT
TCAAAATACACACACGAAGACGTAATCATAACAAGAATATCAATATTAAT
CATAACTCGAATGTTAATATTAACTCGAACCATAATTCCAATTCGAATCA
CAACTCTAACACAAATGTCAATATCAACCGTAACTCAAACGTGAATAGCA
ACTCGaaccataactcgaacacaaaCATCAACGTTAATCAAAACACTTTC
AGACCTTTCTACATTGGCAACTTCCCAAAACACTGGCATATGTGTGGTGG
ATACATCATCGACAACTTTTCGCAATTGTGTTGTCAAGGAAATCCAGTGA
ACAAACAACCATTTTCCATGTGCTGCGGCTCTGGGCTTTACAACTTGATC
ACGGAAGATTGTGTTTCTGGTTCACCCGTTGCCAAGAAGCTCCCAGAATG
TGGTTCATCTAAAACAACGTATGATGCTTTCAAACAGTTTTGTTACCATG
GCGATGTCTATGCTCACGAAAAATATGTGGAATGCGACGGTGCTTTGTAT
TATGTCTAAATTCTGTTAaatttttataatatatttaataattggagttt
ttttggaaaaatttaaaaatacaaaagtgTTCAAATCTCAGAATCGAATA
GGCCAATTGCAGGCACGATATTGTTCTTAAATGTTCTTAGTTTCAacatt
ctgagccttattgttcccttttaaaaatgtttcaataaagCCCACCGGAT
TCATGTAGtcgtgtttttatttgaaaatatagtattaAAGTGTTGTTAAA
GTactgtttttcctttttcaatcTCAATTACATTTTAAGGagctttttaa
gattttaatcaatcaattttttcattctttcaaaatatgtCAGCTTTTCA
GGCGCTCTCAGTCTACTTCACTTCACGGGCGcttaatgaaaattatcaaa
aaacacccctgtctcgcagatCCGGAAGAACCTCTCAATGGgagtgaaaa
tttctatcaaaatcccaatAGGCCCCAATAGGGATAGTTTAAAAAGTCCA
GTGAGAATAGTTTTGGGGtgtagtgtttttttcattgtatttcaaatggg
gataaaaaGTCAACCTTTCAGTGCGGTAGAAATTGCAGGGGACGTCGGGA
CAAAATTgtagtgaaaaaatttcaagtggtTAGTGGTCTCCGGGTTTGTG
ACATAGGGTTGACAAAAGCTAATATCAATCAGGAGTTGATTCTTGTATAA
TTGATATACAGCATTCTTTTATAAATTAAATGTCAGtaaaataacaaata
aaaacCTTCAATTTAATCTGAACATCTGAACTATACATCTACATCGAGTA
CCAAATCAACGGATGCACGGCATTTTAGGTAGAGCGAATAAGGAGAATGA
ATGTACCATGTATAAATCGGGGATCAATGGGGATTTGATTCTCTGTCAGA
ATTTTTCTGCCATGTGTCACGAGTGTTGAACCGCCCATCATCCGCCCATC
TGTGGGTGCG
Run BLAST on NCBI

protein sequence of TCONS_00073832-protein

>TCONS_00073832-protein ID=TCONS_00073832-protein|Name=TCONS_00073832-protein|organism=Clytia hemisphaerica|type=polypeptide|length=320bp
MQMWTVITLIQLYVSGSFCRQFLNNIDDEDSWYPIDYSSESSAEHSIEDE
TYNKSPFVSERRQYADPFQENDMEPNFYEEIDENKMVRITGYENIPAVRP
TQKQDTTETATTTAAPTTPHSHKPSRTNSTDQTKPGNLARKLQNEEEDPL
WFKIHTRRRNHNKNININHNSNVNINSNHNSNSNHNSNTNVNINRNSNVN
SNSNHNSNTNINVNQNTFRPFYIGNFPKHWHMCGGYIIDNFSQLCCQGNP
VNKQPFSMCCGSGLYNLITEDCVSGSPVAKKLPECGSSKTTYDAFKQFCY
HGDVYAHEKYVECDGALYYV
Run BLAST on NCBI

transcript from alignment at scaffold_98:227577..231228-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073832 ID=TCONS_00073832|Name=TCONS_00073832|organism=Clytia hemisphaerica|type=transcript|length=3652bp|location=Sequence derived from alignment at scaffold_98:227577..231228- (Clytia hemisphaerica)
ATCGACAATCAAAGAAATATTTTGAGTGGATCAGGTAGGGTAATTTATCA TATATGATAAAAGTTTGTTCATCATTAAATTTTTCAAATTCAGAAGTAAA GGGCTGCCATTCGCTTTAGAATGCTAAAAATATTTTCTTTCCTGTGGATT AGAGTTTTACTCCATGGCCATACAGGAGGTTCTCTCAGCGGACCGTCAAC TCACGCAATCACGCATATTTTTTTTCCCAATTCACCCATTATCTGTTCAC ACAAAGTCTTTCTATTCACACTCACGCGTAATTTTGTTAAACTTTCACGC ATTCACGCAGGTGAAAAAACCCTTTCACGCATTCACACAAACCGCTGGGA GGGTCCAATACAATGAGGAGCTTTCGCTAATTTGGACTTCTATTTTAATC TTTTTACAAATTGAACTCTTTCTCAGCTCCTCTCAAGGGGCAACCTGCTT TAGATGCTCCCTATAAGTAGGAAATGTGGCTCCCCTTTGAGTTCGAAACT GTACTTTTGTTTTAATTTTCAGATAATCTTCATTATGCAGATGTGGACAG TGATTACGCTCATCCAACTATATGTCTCTGGCTCATTCTGTCGACAATTT CTCAACAACATAGACGACGAAGACAGTTGGTATCCAATAGATTATTCGAG CGAATCTTCTGCTGAACACTCTATTGAGGATGAAACATACAACAAATCAC CATTTGTTTCAGAAAGAAGACAATATGCTGACCCTTTCCAAGAAAACGAT ATGGAGCCAAACTTTTATGAAGAAATTGACGAAAATAAGATGGTGAGAAT CACAGGCTACGAAAATATACCAGCAGTTCGTCCAACACAAAAACAAGATA CAACAGAAACAGCCACTACAACTGCTGCCCCAACTACACCTCATTCCCAT AAACCATCTCGCACTAACTCTACTGACCAAACAAAACCTGGAAATCTCGC TAGAAAATTGCAAAATGAAGAAGAAGACCCGCTCTGGTTCAAAATACACA CACGAAGACGTAATCATAACAAGAATATCAATATTAATCATAACTCGAAT GTTAATATTAACTCGAACCATAATTCCAATTCGAATCACAACTCTAACAC AAATGTCAATATCAACCGTAACTCAAACGTGAATAGCAACTCGAACCATA ACTCGAACACAAACATCAACGTTAATCAAAACACTTTCAGACCTTTCTAC ATTGGCAACTTCCCAAAACACTGGCATATGTGTGAGTTCTAGATATTTCT GACATTTTCTCTTTTAGCTCTAATACGCACTCCGCAGAAATAATTCGAAA CAGGGTTTTCATAGTGAGATTGTTACAGTGGGCGAAGTAAGGCAACAATC TTGGAAATATCTTGAAAATATGATATTTCCATTATACATTTGTAAATATG AAACTATGACTTTTCTATATTTCCAAAGTTTAGGAAATATGATATTTCCA AAAGTTGGAAATATTTTGAAAATATGTTATTTCAATGAATTTCAGGTTTG GAAATATCATGAAATAAAAAAAAGTCATATTTTCATATTTACTAAAGTCT GTCTCAAAATAATTTGCAGCTGATACAAAAATGGGTTGTAACTTTTGATA GAATTCGAATTAAGTTATGACTTTGTGCTCATTGAAAAGATATTTGTGAT TGGAATATTATCAAGCAAATGGTAAATAATTTTTTTTGCTTGATAGTATT CCACTCACAAAAATCTTTTCAACAAGCACAAAATCGCAACTTCATTCAAA TTCTATCAAAAGCTACAGCTAATTTTTGTCTCAGCTGCAAATTATTTTGA GACAGACCTTAATGTATAATGCATGGATATCACATTTTCAAATTATTTCC AAGATTGGAAATCTCTTAATTCGCCCAGTTTTAGTTTTATGGATTGAATA AAACTAAATCGTGTATCTCGTAATACTTATTTATAGGAATTAGAAAGATC TCCTGTGATCACTCTGAATACATTTGACATTGTTTTTATCAGGTGGTGGA TACATCATCGACAACTTTTCGCAATTGTGTTGTCAAGGAAATCCAGTGAA CAAACAACCATTTTCCATGTGCTGCGGGTAAGTTAATCTTTTTCAGAAGA CAAGATTTATTTGAACTGAGAGTCCGTTATGTATTCCAAAACACCTTTTT GACCATAGCCGCTAATTGCCGCGCGGACATTTTTTGTCCGTTTCATCCCA CTAAAACCGTCCCAGTCGTTTTTTTTTTGCACCTTTATAGATAATAGAAA AATGTGTCAAAAAAAGGATTGGATCGAGTTTAGTGGGATAATTAGATAAT TAAATGACACGCACCTGACCGCGCGACTACGGTCGAAAAGGTGTATACGC CCTTGTAATGATCAAAGCTCAGTGTCGATTTTGATTGGCGTTATGAAAAT AATGCTGTGTACTTTTTGAATCTTCCTTTCTTGGCTGGACTAAAAGCCTT TAACGGATCAATAAAACAGGGTTATTGTATTTTTGAAGCTATTCTTTTTT CAAACTGAATTTACTTTCAGCTCTGGGCTTTACAACTTGATCACGGAAGA TTGTGTTTCTGGTTCACCCGTTGCCAAGAAGCTCCCAGAATGTGGTTCAT CTAAAACAACGTATGATGCTTTCAAACAGTTTTGTTACCATGGCGATGTC TATGCTCACGAAAAATATGTGGAATGCGACGGTGCTTTGTATTATGTCTA AATTCTGTTAAATTTTTATAATATATTTAATAATTGGAGTTTTTTTGGAA AAATTTAAAAATACAAAAGTGTTCAAATCTCAGAATCGAATAGGCCAATT GCAGGCACGATATTGTTCTTAAATGTTCTTAGTTTCAACATTCTGAGCCT TATTGTTCCCTTTTAAAAATGTTTCAATAAAGCCCACCGGATTCATGTAG TCGTGTTTTTATTTGAAAATATAGTATTAAAGTGTTGTTAAAGTACTGTT TTTCCTTTTTCAATCTCAATTACATTTTAAGGAGCTTTTTAAGATTTTAA TCAATCAATTTTTTCATTCTTTCAAAATATGTCAGCTTTTCAGGCGCTCT CAGTCTACTTCACTTCACGGGCGCTTAATGAAAATTATCAAAAAACACCC CTGTCTCGCAGATCCGGAAGAACCTCTCAATGGGAGTGAAAATTTCTATC AAAATCCCAATAGGCCCCAATAGGGATAGTTTAAAAAGTCCAGTGAGAAT AGTTTTGGGGTGTAGTGTTTTTTTCATTGTATTTCAAATGGGGATAAAAA GTCAACCTTTCAGTGCGGTAGAAATTGCAGGGGACGTCGGGACAAAATTG TAGTGAAAAAATTTCAAGTGGTTAGTGGTCTCCGGGTTTGTGACATAGGG TTGACAAAAGCTAATATCAATCAGGAGTTGATTCTTGTATAATTGATATA CAGCATTCTTTTATAAATTAAATGTCAGTAAAATAACAAATAAAAACCTT CAATTTAATCTGAACATCTGAACTATACATCTACATCGAGTACCAAATCA ACGGATGCACGGCATTTTAGGTAGAGCGAATAAGGAGAATGAATGTACCA TGTATAAATCGGGGATCAATGGGGATTTGATTCTCTGTCAGAATTTTTCT GCCATGTGTCACGAGTGTTGAACCGCCCATCATCCGCCCATCTGTGGGTG CG

Coding sequence (CDS) from alignment at scaffold_98:227577..231228-

>TCONS_00073832 ID=TCONS_00073832|Name=TCONS_00073832|organism=Clytia hemisphaerica|type=CDS|length=2889bp|location=Sequence derived from alignment at scaffold_98:227577..231228- (Clytia hemisphaerica)
CTCTGGGCTTTACAACTTGATCACGGAAGATTGTGTTTCTGGTTCACCCG
TTGCCAAGAAGCTCCCAGAATGTGGTTCATCTAAAACAACGTATGATGCT
TTCAAACAGTTTTGTTACCATGGCGATGTCTATGCTCACGAAAAATATGT
GGAATGCGACGGTGCTTTGTATTATGTCTAAGTGGTGGATACATCATCGA
CAACTTTTCGCAATTGTGTTGTCAAGGAAATCCAGTGAACAAACAACCAT
TTTCCATGTGCTGCGGATGCAGATGTGGACAGTGATTACGCTCATCCAAC
TATATGTCTCTGGCTCATTCTGTCGACAATTTCTCAACAACATAGACGAC
GAAGACAGTTGGTATCCAATAGATTATTCGAGCGAATCTTCTGCTGAACA
CTCTATTGAGGATGAAACATACAACAAATCACCATTTGTTTCAGAAAGAA
GACAATATGCTGACCCTTTCCAAGAAAACGATATGGAGCCAAACTTTTAT
GAAGAAATTGACGAAAATAAGATGGTGAGAATCACAGGCTACGAAAATAT
ACCAGCAGTTCGTCCAACACAAAAACAAGATACAACAGAAACAGCCACTA
CAACTGCTGCCCCAACTACACCTCATTCCCATAAACCATCTCGCACTAAC
TCTACTGACCAAACAAAACCTGGAAATCTCGCTAGAAAATTGCAAAATGA
AGAAGAAGACCCGCTCTGGTTCAAAATACACACACGAAGACGTAATCATA
ACAAGAATATCAATATTAATCATAACTCGAATGTTAATATTAACTCGAAC
CATAATTCCAATTCGAATCACAACTCTAACACAAATGTCAATATCAACCG
TAACTCAAACGTGAATAGCAACTCGAACCATAACTCGAACACAAACATCA
ACGTTAATCAAAACACTTTCAGACCTTTCTACATTGGCAACTTCCCAAAA
CACTGGCATATGTCTCTGGGCTTTACAACTTGATCACGGAAGATTGTGTT
TCTGGTTCACCCGTTGCCAAGAAGCTCCCAGAATGTGGTTCATCTAAAAC
AACGTATGATGCTTTCAAACAGTTTTGTTACCATGGCGATGTCTATGCTC
ACGAAAAATATGTGGAATGCGACGGTGCTTTGTATTATGTCTAAGTGGTG
GATACATCATCGACAACTTTTCGCAATTGTGTTGTCAAGGAAATCCAGTG
AACAAACAACCATTTTCCATGTGCTGCGGATGCAGATGTGGACAGTGATT
ACGCTCATCCAACTATATGTCTCTGGCTCATTCTGTCGACAATTTCTCAA
CAACATAGACGACGAAGACAGTTGGTATCCAATAGATTATTCGAGCGAAT
CTTCTGCTGAACACTCTATTGAGGATGAAACATACAACAAATCACCATTT
GTTTCAGAAAGAAGACAATATGCTGACCCTTTCCAAGAAAACGATATGGA
GCCAAACTTTTATGAAGAAATTGACGAAAATAAGATGGTGAGAATCACAG
GCTACGAAAATATACCAGCAGTTCGTCCAACACAAAAACAAGATACAACA
GAAACAGCCACTACAACTGCTGCCCCAACTACACCTCATTCCCATAAACC
ATCTCGCACTAACTCTACTGACCAAACAAAACCTGGAAATCTCGCTAGAA
AATTGCAAAATGAAGAAGAAGACCCGCTCTGGTTCAAAATACACACACGA
AGACGTAATCATAACAAGAATATCAATATTAATCATAACTCGAATGTTAA
TATTAACTCGAACCATAATTCCAATTCGAATCACAACTCTAACACAAATG
TCAATATCAACCGTAACTCAAACGTGAATAGCAACTCGAACCATAACTCG
AACACAAACATCAACGTTAATCAAAACACTTTCAGACCTTTCTACATTGG
CAACTTCCCAAAACACTGGCATATGTCTCTGGGCTTTACAACTTGATCAC
GGAAGATTGTGTTTCTGGTTCACCCGTTGCCAAGAAGCTCCCAGAATGTG
GTTCATCTAAAACAACGTATGATGCTTTCAAACAGTTTTGTTACCATGGC
GATGTCTATGCTCACGAAAAATATGTGGAATGCGACGGTGCTTTGTATTA
TGTCTAAGTGGTGGATACATCATCGACAACTTTTCGCAATTGTGTTGTCA
AGGAAATCCAGTGAACAAACAACCATTTTCCATGTGCTGCGGATGCAGAT
GTGGACAGTGATTACGCTCATCCAACTATATGTCTCTGGCTCATTCTGTC
GACAATTTCTCAACAACATAGACGACGAAGACAGTTGGTATCCAATAGAT
TATTCGAGCGAATCTTCTGCTGAACACTCTATTGAGGATGAAACATACAA
CAAATCACCATTTGTTTCAGAAAGAAGACAATATGCTGACCCTTTCCAAG
AAAACGATATGGAGCCAAACTTTTATGAAGAAATTGACGAAAATAAGATG
GTGAGAATCACAGGCTACGAAAATATACCAGCAGTTCGTCCAACACAAAA
ACAAGATACAACAGAAACAGCCACTACAACTGCTGCCCCAACTACACCTC
ATTCCCATAAACCATCTCGCACTAACTCTACTGACCAAACAAAACCTGGA
AATCTCGCTAGAAAATTGCAAAATGAAGAAGAAGACCCGCTCTGGTTCAA
AATACACACACGAAGACGTAATCATAACAAGAATATCAATATTAATCATA
ACTCGAATGTTAATATTAACTCGAACCATAATTCCAATTCGAATCACAAC
TCTAACACAAATGTCAATATCAACCGTAACTCAAACGTGAATAGCAACTC
GAACCATAACTCGAACACAAACATCAACGTTAATCAAAACACTTTCAGAC
CTTTCTACATTGGCAACTTCCCAAAACACTGGCATATGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045850XLOC_045850Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073832-proteinTCONS_00073832-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073832-exon-scaffold_98-1575043694:231195..231228TCONS_00073832-exon-scaffold_98-1575043694:231195..231228Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1575043694:229998..230706TCONS_00073832-exon-scaffold_98-1575043694:229998..230706Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1575043694:229152..229236TCONS_00073832-exon-scaffold_98-1575043694:229152..229236Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1575043694:227577..228708TCONS_00073832-exon-scaffold_98-1575043694:227577..228708Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1510915933:231195..231228TCONS_00073832-exon-scaffold_98-1510915933:231195..231228Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1510915933:229998..230706TCONS_00073832-exon-scaffold_98-1510915933:229998..230706Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1510915933:229152..229236TCONS_00073832-exon-scaffold_98-1510915933:229152..229236Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1510915933:227577..228708TCONS_00073832-exon-scaffold_98-1510915933:227577..228708Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1491911889:231195..231228TCONS_00073832-exon-scaffold_98-1491911889:231195..231228Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1491911889:229998..230706TCONS_00073832-exon-scaffold_98-1491911889:229998..230706Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1491911889:229152..229236TCONS_00073832-exon-scaffold_98-1491911889:229152..229236Clytia hemisphaericaexon
TCONS_00073832-exon-scaffold_98-1491911889:227577..228708TCONS_00073832-exon-scaffold_98-1491911889:227577..228708Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:227577..231228 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
365.054 380.817 145.108 110.748 4.9706 3.41714 1.23324 1.764 0.518769 2.00335 0.513188 0.463957 0.188653 0.139942 0.0115051 0.0370402 0 0.0623597 0.0861533 0.27046 0.792219 0.404694 157.878 131.152 0.195784 0.155318 8.06985 9.70482 82.3062 95.0718
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073832 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top