Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073830 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073830
Unique NameTCONS_00073830
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3504

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073830 ID=TCONS_00073830|Name=TCONS_00073830|organism=Clytia hemisphaerica|type=transcript|length=3504bp
AAAGGATGCAAGAAGAGTTGGATTTGGACTAGTAATGAAGCAGGCTGCAT
TGTGGATGAGTTTGCCCACAATGCAGTCACGTTAAGAATTTGGAATGATA
ATTTGTATCAAGCAATATTATGTGATTATTGTCGTTATATTGTagcaaag
aaatgttttttgaagcAAACACTGAAAGTACCCACATTCATGTGTGTGTG
ACATATGTGAAAAATGCTGTTTTTAAGCGTATATGCAATAAGTTACGCTA
CATTTTGTGAGAGTCACTGAGTTTCGGATGAGAAATATTCAGACCTTTAT
GTCatgtttgaaagttttgaatGCAAATCTCATATCAAAATATCGCtctt
caaaattaataaaaacggGGAAGgataaaaaagggaaatactATATAAAT
AGTTATTTTGTGATAACGTATGCTTGGTCTTTTTATTAGGTTTTAGTGTC
AAGGCCAATACTATTCTAAGTTATTAGTTGTCTGTTCACGCAGAACATGT
GCTATCGCTACAGTTGTTTAAGGAAGAAAGTGTACAGTGACAGTATTTTT
ACTATCGTTCATCGCGCTTGCGCAGTATAAAACTAAAAGAGCGTGCCCGG
TACGGAGAAAGAAGAATTGGCagtaagaaaaacaaatttgaaaagcGTCA
AGTGAATTATTCACAAGGATAGTGTTGAAGAATTTATAAACAACACATTT
CTGCTAATACATGCGTAAATGGtttcattttcgcgaaaaatttGCTATAA
GAAGAATTGAGTTTGTGAAATTGAGTTCATATTGAACACGCTTTTGGTGA
GTGAACTGTTAAAAACATCGTGAAGATGTATCTATCTTTATTTCTTGGAT
TGCTGTTTGCAGTCACCACGCCTTGTTCAAGTCACCTTACAAAGCATTAC
ATGTCTCATAAAGAACTTGAAAATCATCTGCAGAGCTTGACATCAATGTT
TCCCGATATTTCCCGAGTATACAGTATCGGGGAGAGCGTAAAAGGAAGAA
GTTTACTTGTTATGGAAATTTCATCGAACCCTGGCGAACACGAGTTTCTG
GAACCAGAATTCAAATATGTTGGTAACATGCACGGAGATGAGACAGTGGG
TCGGCAAATTCTTTTGAACTTAATTGAACTGTTGTTGTGGAACTATACTT
CCAACCCTGCGATCAAACAACTGGTTGATACAACAAGGATACACATTCTC
TGCACCATGAATCCTGATGGTTTCAACAAAGCACAAAAAACACAAAACGA
TTATTTACCAGATGGCCGGAACAATGCAAATAATGTCGATTTGAACAGAA
ACTTCCCAGACCCTTTTGTGCCATCATATTTCAGTAAGGTTCGAATGCAA
AAAGAAACAAAGGCAGTTATAGACTGGCTGCATTCACTCCCATTCGTTCT
CTCCGCTAACTTGCACGGTGGAGCAGTCGTGGTAAACTATCCTTATGATA
ACTTCAAAGAGTTTCAGCGTTATTTATTTTTCGGTCGTTCGATTTATGCC
GGGACTCCAGATGATGACGTTTTCAAATCGATTTCGAAGACGTATTCAAA
GAGTCATCATAACATGAGTAAAGGGAAACATTGCGGAGAAGACAAGTTTG
TTGATGGAATCACTAATGGTGCAGAATGGTACACAGTGAGTGGAGGGATG
CAAGATTACAATTATCGATACACCAACTGTTTTGAAATCCTGATCGAGCT
AAGCTGTACAAAATTGGTCCCTGAAAAAGACCTTCTTATGTATTGGGAAC
ACAATCGAAAAGCACTGTTGAGTTATCTCGCTCGTATTCACATGGGAGTC
AAAggGGTTGTTCTGACACATGACCATGAACCAATCGAAGGTGCAAAGAT
TCTAATCCACGATcgaacaaaagaaatcaaaacatggAGAACTGGGGAAT
ATTGGCGATTATTGTTGCCTGGAAACTATCAGCTCGAAGTTTCGGCTGAC
GGTTATTTTACTCAATGGAAAAATATCACTGTTACAGAAGGAGAAGTGAC
GAGAATggattttaatttatttgagaGTGCATCGTTGAGAATTTCACCTG
CAACGAGCATTCTTTTTGTACATATGATTATTGCATTCCTGCTAGCTTGA
CCTctatattcaactttttatacCTCAATGTAAATAGCTATCAAATCTCT
TAATTTTATCATAAATAATTTATTTCGTTTTTAATATACCGACGCAATAC
ACCgaacttaaaaaaaaagctttctCGTTTGCTGtaacataaaattttaa
acattgacGTCATTGCGTTTAAAACGTTTGTTTCGTttgtttgtgacgtc
ataactagTAGCATGCTGTTGGAAACgaaacaaaaacaatgaaaaagaaa
tacttctaaCTTTTAAGATTTAAACTTGTTAACTTcctgttgataaaata
tatttgtTCCTTTTGCCCTATTTACTCAAAAGCGAgcaaaaaatacttta
aaatttacaatttataaATACCTTcgtgttttggaaaaagttatttttgt
tttctttctgcAAATAGTTTACAGACGATCACGTTGTTTATCAACATTCG
ATTAGGGATCAATAGAACGCCCCTCCCCTTACCCCTCATTCTGAATAATG
GCCAATTATCAGGTTGTCTCTGCTAAGATAGATAGTTACGGTTGAGCCAA
AGGCGAAAAAAATTTGTTACCTTTCACAAGGCAaatatattgaataaaaa
tcGAGATTTACAATATATTTAGTGAAGTATTTATAGCATAATCCGTAAAA
AATTGAcctattttattcaaaaaacaatatATAATTGATTACATTATAGG
ATTGTTTAAAACAGCATTCTGGTCAGCATATTATACGTGATTTCTTGACA
CCCATACAATTTAGTTTGCAATAAGCAGAAGACATGCAATGAAAAGGCAG
GTGTTGGTAATGAGTCTCTCTTCATTTGAAATCAAGGTTTCCATAGCCTC
CTCTTTTCGTTGAAAGTGAAACACTTTCGAGGACTGTCACACTACGACAC
TATCACCAAGCATCGGTTTTGAACCAACATCATAACACCAAATCGagaga
gaaaagtttttttcaccaAACTTTGACCCAAGGATTTCGGTTACTGTTTG
CATGGAGGCATTGATGGTCTCCTGGATGACGGTGCCTAGAATCaagaaac
aataacaaacatgAAATTCATATTGAACTAATGCAGAATATTCACACAAA
ATACAAcatttataaaagaaatattcCTGTTAATTAGTTTTAAAACGGTC
TTCAAACATCTATCTATAACTTTTTATATTGCCATGGAATACCTTTTATC
TATTATCAATCTATTGTCCTTTTAGAAAATCAACTCGTACCTGACACAAA
CGCTTTGATAGCAACGTTCACAATTAAATGGGATCAAATTGATTTGTCGA
CAGTTGGGTGAAGAACACTTATTCTTCTTtcgttttttgaaaacattatc
CTTGCATCCACTTTGTATATGTCGTTCAACCTGAAGGGaatgataggaat
ggaa
Run BLAST on NCBI

protein sequence of TCONS_00073830-protein

>TCONS_00073830-protein ID=TCONS_00073830-protein|Name=TCONS_00073830-protein|organism=Clytia hemisphaerica|type=polypeptide|length=424bp
MYLSLFLGLLFAVTTPCSSHLTKHYMSHKELENHLQSLTSMFPDISRVYS
IGESVKGRSLLVMEISSNPGEHEFLEPEFKYVGNMHGDETVGRQILLNLI
ELLLWNYTSNPAIKQLVDTTRIHILCTMNPDGFNKAQKTQNDYLPDGRNN
ANNVDLNRNFPDPFVPSYFSKVRMQKETKAVIDWLHSLPFVLSANLHGGA
VVVNYPYDNFKEFQRYLFFGRSIYAGTPDDDVFKSISKTYSKSHHNMSKG
KHCGEDKFVDGITNGAEWYTVSGGMQDYNYRYTNCFEILIELSCTKLVPE
KDLLMYWEHNRKALLSYLARIHMGVKGVVLTHDHEPIEGAKILIHDRTKE
IKTWRTGEYWRLLLPGNYQLEVSADGYFTQWKNITVTEGEVTRMDFNLFE
SASLRISPATSILFVHMIIAFLLA
Run BLAST on NCBI

transcript from alignment at scaffold_98:222093..227512-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073830 ID=TCONS_00073830|Name=TCONS_00073830|organism=Clytia hemisphaerica|type=transcript|length=5420bp|location=Sequence derived from alignment at scaffold_98:222093..227512- (Clytia hemisphaerica)
AAAGGATGCAAGAAGAGTTGGATTTGGACTAGTAATGAAGCAGGCTGCAT TGTGGATGAGTTTGCCCACAATGCAGTCACGTTAAGAATTTGGAATGATA ATTTGTATCAAGCAATATTATGTGATTATTGTCGTTATATTGTAGCAAAG AAATGTTTTTTGAAGCAAACACTGAAAGTACCCACATTCATGTGTGTGTG ACATATGTGAAAAATGCTGTTTTTAAGCGTATATGCAATAAGTTACGCTA CATTTTGTGAGAGTCACTGAGTTTCGGATGAGAAATATTCAGACCTTTAT GTCATGTTTGAAAGTTTTGAATGCAAATCTCATATCAAAATATCGCTCTT CAAAATTAATAAAAACGGGGAAGGATAAAAAAGGGAAATACTATATAAAT AGTTATTTTGTGATAACGTATGCTTGGTCTTTTTATTAGGTTTTAGTGTC AAGGCCAATACTATTCTAAGTTATTAGTTGTCTGTTCACGCAGAACATGT GCTATCGCTACAGTTGTTTAAGGAAGAAAGTGTACAGTGACAGTATTTTT ACTATCGTTCATCGCGCTTGCGCAGTATAAAACTAAAAGAGCGTGCCCGG TACGGAGAAAGAAGAATTGGCAGTAAGAAAAACAAATTTGAAAAGCGTCA AGTGAATTATTCACAAGGATAGTGTTGAAGAATTTATAAACAACACATTT CTGCTAATACATGCGTAAATGGTTTCATTTTCGCGAAAAATTTGCTATAA GAAGAATTGAGTTTGTGAAATTGAGTTCATATTGAACACGCTTTTGGTGA GTGAACTGTTAAAAACATCGTGAAGATGTATCTATCTTTATTTCTTGGAT TGCTGTTTGCAGTCACCACGCCTTGTTCAAGTCACCTTACAAAGCATTAC ATGTCTCATAAAGAACTTGAAAATCATCTGCAGAGCTTGACATCAATGTT TCCCGATATTTCCCGAGTATACAGTATCGGGGAGAGCGTAAAAGGAAGAA GTTTACTTGTTATGGAAATTTCATCGAACCCTGGCGAACACGAGTTTCTG GAACCAGAATTCAAATATGTTGGTAACATGCACGGAGATGAGACAGTGGG TCGGCAAATTCTTTTGAACTTAATTGAACTGTTGTTGTGGAACTATACTT CCAACCCTGCGATCAAACAACTGGTTGATACAACAAGGATACACATTCTC TGCACCATGAATCCTGATGGTTTCAACAAAGCACAAAAAACACAAAACGA TTATTTACCAGATGGCCGGAACAATGCAAATAATGTCGATTTGAACAGAA ACTTCCCAGACCCTTTTGTGCCATCATATTTCAGTAAGGTTCGAATGCAA AAAGAAACAAAGGCAGTTATAGACTGGCTGCATTCACTCCCATTCGTTCT CTCCGCTAACTTGCACGGTGGAGCAGTCGTGGTAAACTATCCTTATGATA ACTTCAAAGAGTTTCAGCGTTATTTATTTTTCGGTCGTTCGATTTATGCC GGGACTCCAGATGATGACGTTTTCAAGTAAGTTTGAATCTCTTATCCCAC GAAATTTTTAAAAGAAAAATGATGTTTTATTGTCTATGTATGAAACACTA CCCCTCGCACCACACAATGTTGCAAAATGGCTACAATGGAACTGACTGTA AATTTCTTTGTTTCTCCTGCTTCTTTGAGCTTTAAGAATATAGAATCTTT TAAGTTTTAAAGTCTCACTTGCTAAAAACATTTAGACCAAATTTATCTCA GTGAAAAGGGTTCAGGGACGCTTACTTTCAAATTTGACATTTCTTTATCC AACAGACCTCTTATTTTTTCACGATAGATCGATTTCGAAGACGTATTCAA AGAGTCATCATAACATGAGTAAAGGGAAACATTGCGGAGAAGACAAGTTT GTTGATGGAATCACTAATGGTGCAGAATGGTAAGTCTTTGGTATTTTGAA TGATCTTTCTTTGAGCGAGACGTGGCAGTGAACTACAAATTCCATTCTCG TTTTTGAAAAAAAAAACGAAATGGTCATTTCAATTTTTTTTGTCATCTAA GTCTTAGACCGAGTAGACTTCTGTTTTACATTGAAAATTTTTATGAGCCA CCTCTAGTGGAGTCCCTGATCACTTAACTGAGTTTACTTATCTTTCATTT CAATCAGATAGATAAAGAAAAGAAGTGTAAAAATTATTTGCTTTGCCTTC ATTATAGGTACACAGTGAGTGGAGGGATGCAAGATTACAATTATCGATAC ACCAACTGTTTTGAAATCCTGATCGAGCTAAGCTGTACAAAATTGGTCCC TGAAAAAGACCTTCTTATGTATTGGGAACACAATCGAAAAGCACTGTTGA GTTATCTCGCTCGTATTCACATGGGAGTCAAAGGTATGCAAAAAAAATTT CGAACTGCTATTTCGATTTTCAGCAGATCTGTATTATGTATGCAATAGGC ATTTCCAAAATTTGGAAATATTTTGAAAATATGATATTTCAGATTTGGAA ATATCATGAAATATGATATTTCNGTTTCGAACTGCTATTTCTATTTTCAG CAGATCTGTATTATGTATGCAATAGGCATTTCCAAAATTTGGAAATATTT TGAAAATATGATATTTCAGATTTGGAAATATTAATACAATAATGACCGGT TAGTGAGGGCTGTACTGAGAAATATTGCCCGAGGTCAAGTAACGACCGAG CTTGCGAGGTTGTTGCGTTGACCGANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNATGTCAACGCATTGTTCATTTTCCTTTGAAAAAGTGACGTCACAAT GAATTTTCCTAACGACGGGCAACTCTGGACAATGTAGGCCCGTCGTCATG CGAAATGGACCAATTGCAGTGCGCAAAAAGCCATGTAGCCCGCTTCGAAA AAGTAACCGGTTAACAACATGAAATATGACATTTCCTCAACTTTGGAAAT ATAGAAAAGTTATACTTCGATATTTACACATGTATATGGAAATATCATAT TTTCAAGATATTTCCAGGATTGGAAATCTTTTATTTCGCCTAGTGTTATT TTGAGTGCGATGAATGCCTTGTTTTGCTGGAACCATTACCAATGTTACTA AATCCCTTGGGTCATATTAATAGTGTAAACTTCTTATGAACCCTTGGGAA TCAATCACCATAGCAATATTTTGAAAACGAGGTAAGTGATTCTCGTGAGG CAATTTATAAAAAGGTCCTATTATTTGTGATTTTTTGACTTCTTTGTGAG CTTAAAGTATTATATAGAGAAAATAAAACCTATTCCCGGTTCCTTCCTTC ACCTTTTGTGATAGCGCTCATAAATATGGTAATACTAAATTAATACGAGC AGCTCTTTTCGAGTTTGGAAGGAAATCATTATTGAGGATAAAATCATTTC CTCGTGAATTTCAACATCCGACTCTATTTTGATGAATTATTCGTAGAATA TTTGATAGAGAATTTCATTTCCGTTTCTCACTTTCATGTTTATCAAATTA ATTTTTAATTATTTTTCAAGGGGTTGTTCTGACACATGACCATGAACCAA TCGAAGGTGCAAAGATTCTAATCCACGATCGAACAAAAGAAATCAAAACA TGGAGAACTGGGGAATATTGGCGATTATTGTTGCCTGGAAACTATCAGCT CGAAGTTTCGGCTGACGGTTATTTTACTCAATGGAAAAATATCACTGTTA CAGAAGGAGAAGTGACGAGAATGGATTTTAATTTATTTGAGAGTGCATCG TTGAGAATTTCACCTGCAACGAGCATTCTTTTTGTACATATGATTATTGC ATTCCTGCTAGCTTGACCTCTATATTCAACTTTTTATACCTCAATGTAAA TAGCTATCAAATCTCTTAATTTTATCATAAATAATTTATTTCGTTTTTAA TATACCGACGCAATACACCGAACTTAAAAAAAAAGCTTTCTCGTTTGCTG TAACATAAAATTTTAAACATTGACGTCATTGCGTTTAAAACGTTTGTTTC GTTTGTTTGTGACGTCATAACTAGTAGCATGCTGTTGGAAACGAAACAAA AACAATGAAAAAGAAATACTTCTAACTTTTAAGATTTAAACTTGTTAACT TCCTGTTGATAAAATATATTTGTTCCTTTTGCCCTATTTACTCAAAAGCG AGCAAAAAATACTTTAAAATTTACAATTTATAAATACCTTCGTGTTTTGG AAAAAGTTATTTTTGTTTTCTTTCTGCAAATAGTTTACAGACGATCACGT TGTTTATCAACATTCGATTAGGGATCAATAGAACGCCCCTCCCCTTACCC CTCATTCTGAATAATGGCCAATTATCAGGTTGTCTCTGCTAAGATAGATA GTTACGGTTGAGCCAAAGGCGAAAAAAATTTGTTACCTTTCACAAGGCAA ATATATTGAATAAAAATCGAGATTTACAATATATTTAGTGAAGTATTTAT AGCATAATCCGTAAAAAATTGACCTATTTTATTCAAAAAACAATATATAA TTGATTACATTATAGGATTGTTTAAAACAGCATTCTGGTCAGCATATTAT ACGTGATTTCTTGACACCCATACAATTTAGTTTGCAATAAGCAGAAGACA TGCAATGAAAAGGCAGGTGTTGGTAATGAGTCTCTCTTCATTTGAAATCA AGGTTTCCATAGCCTCCTCTTTTCGTTGAAAGTGAAACACTTTCGAGGAC TGTCACACTACGACACTATCACCAAGCATCGGTTTTGAACCAACATCATA ACACCAAATCGAGAGAGAAAAGTTTTTTTCACCAAACTTTGACCCAAGGA TTTCGGTTACTGTTTGCATGGAGGCATTGATGGTCTCCTGGATGACGGTG CCTAGAATCAAGAAACAATAACAAACATGAAATTCATATTGAACTAATGC AGAATATTCACACAAAATACAACATTTATAAAAGAAATATTCCTGTTAAT TAGTTTTAAAACGGTCTTCAAACATCTATCTATAACTTTTTATATTGCCA TGGAATACCTTTTATCTATTATCAATCTATTGTCCTTTTAGAAAATCAAC TCGTACCTGACACAAACGCTTTGATAGCAACGTTCACAATTAAATGGGAT CAAATTGATTTGTCGACAGTTGGGTGAAGAACACTTATTCTTCTTTCGTT TTTTGAAAACATTATCCTTGCATCCACTTTGTATATGTCGTTCAACCTGA AGGGAATGATAGGAATGGAA

Coding sequence (CDS) from alignment at scaffold_98:222093..227512-

>TCONS_00073830 ID=TCONS_00073830|Name=TCONS_00073830|organism=Clytia hemisphaerica|type=CDS|length=5100bp|location=Sequence derived from alignment at scaffold_98:222093..227512- (Clytia hemisphaerica)
GGGTTGTTCTGACACATGACCATGAACCAATCGAAGGTGCAAAGATTCTA
ATCCACGATCGAACAAAAGAAATCAAAACATGGAGAACTGGGGAATATTG
GCGATTATTGTTGCCTGGAAACTATCAGCTCGAAGTTTCGGCTGACGGTT
ATTTTACTCAATGGAAAAATATCACTGTTACAGAAGGAGAAGTGACGAGA
ATGGATTTTAATTTATTTGAGAGTGCATCGTTGAGAATTTCACCTGCAAC
GAGCATTCTTTTTGTACATATGATTATTGCATTCCTGCTAGCTTGAGTAC
ACAGTGAGTGGAGGGATGCAAGATTACAATTATCGATACACCAACTGTTT
TGAAATCCTGATCGAGCTAAGCTGTACAAAATTGGTCCCTGAAAAAGACC
TTCTTATGTATTGGGAACACAATCGAAAAGCACTGTTGAGTTATCTCGCT
CGTATTCACATGGGAGTCAAAGATCGATTTCGAAGACGTATTCAAAGAGT
CATCATAACATGAGTAAAGGGAAACATTGCGGAGAAGACAAGTTTGTTGA
TGGAATCACTAATGGTGCAGAATGATGTATCTATCTTTATTTCTTGGATT
GCTGTTTGCAGTCACCACGCCTTGTTCAAGTCACCTTACAAAGCATTACA
TGTCTCATAAAGAACTTGAAAATCATCTGCAGAGCTTGACATCAATGTTT
CCCGATATTTCCCGAGTATACAGTATCGGGGAGAGCGTAAAAGGAAGAAG
TTTACTTGTTATGGAAATTTCATCGAACCCTGGCGAACACGAGTTTCTGG
AACCAGAATTCAAATATGTTGGTAACATGCACGGAGATGAGACAGTGGGT
CGGCAAATTCTTTTGAACTTAATTGAACTGTTGTTGTGGAACTATACTTC
CAACCCTGCGATCAAACAACTGGTTGATACAACAAGGATACACATTCTCT
GCACCATGAATCCTGATGGTTTCAACAAAGCACAAAAAACACAAAACGAT
TATTTACCAGATGGCCGGAACAATGCAAATAATGTCGATTTGAACAGAAA
CTTCCCAGACCCTTTTGTGCCATCATATTTCAGTAAGGTTCGAATGCAAA
AAGAAACAAAGGCAGTTATAGACTGGCTGCATTCACTCCCATTCGTTCTC
TCCGCTAACTTGCACGGTGGAGCAGTCGTGGTAAACTATCCTTATGATAA
CTTCAAAGAGTTTCAGCGTTATTTATTTTTCGGTCGTTCGATTTATGCCG
GGACTCCAGATGATGACGTTTTCAAGGGTTGTTCTGACACATGACCATGA
ACCAATCGAAGGTGCAAAGATTCTAATCCACGATCGAACAAAAGAAATCA
AAACATGGAGAACTGGGGAATATTGGCGATTATTGTTGCCTGGAAACTAT
CAGCTCGAAGTTTCGGCTGACGGTTATTTTACTCAATGGAAAAATATCAC
TGTTACAGAAGGAGAAGTGACGAGAATGGATTTTAATTTATTTGAGAGTG
CATCGTTGAGAATTTCACCTGCAACGAGCATTCTTTTTGTACATATGATT
ATTGCATTCCTGCTAGCTTGAGTACACAGTGAGTGGAGGGATGCAAGATT
ACAATTATCGATACACCAACTGTTTTGAAATCCTGATCGAGCTAAGCTGT
ACAAAATTGGTCCCTGAAAAAGACCTTCTTATGTATTGGGAACACAATCG
AAAAGCACTGTTGAGTTATCTCGCTCGTATTCACATGGGAGTCAAAGATC
GATTTCGAAGACGTATTCAAAGAGTCATCATAACATGAGTAAAGGGAAAC
ATTGCGGAGAAGACAAGTTTGTTGATGGAATCACTAATGGTGCAGAATGA
TGTATCTATCTTTATTTCTTGGATTGCTGTTTGCAGTCACCACGCCTTGT
TCAAGTCACCTTACAAAGCATTACATGTCTCATAAAGAACTTGAAAATCA
TCTGCAGAGCTTGACATCAATGTTTCCCGATATTTCCCGAGTATACAGTA
TCGGGGAGAGCGTAAAAGGAAGAAGTTTACTTGTTATGGAAATTTCATCG
AACCCTGGCGAACACGAGTTTCTGGAACCAGAATTCAAATATGTTGGTAA
CATGCACGGAGATGAGACAGTGGGTCGGCAAATTCTTTTGAACTTAATTG
AACTGTTGTTGTGGAACTATACTTCCAACCCTGCGATCAAACAACTGGTT
GATACAACAAGGATACACATTCTCTGCACCATGAATCCTGATGGTTTCAA
CAAAGCACAAAAAACACAAAACGATTATTTACCAGATGGCCGGAACAATG
CAAATAATGTCGATTTGAACAGAAACTTCCCAGACCCTTTTGTGCCATCA
TATTTCAGTAAGGTTCGAATGCAAAAAGAAACAAAGGCAGTTATAGACTG
GCTGCATTCACTCCCATTCGTTCTCTCCGCTAACTTGCACGGTGGAGCAG
TCGTGGTAAACTATCCTTATGATAACTTCAAAGAGTTTCAGCGTTATTTA
TTTTTCGGTCGTTCGATTTATGCCGGGACTCCAGATGATGACGTTTTCAA
GGGTTGTTCTGACACATGACCATGAACCAATCGAAGGTGCAAAGATTCTA
ATCCACGATCGAACAAAAGAAATCAAAACATGGAGAACTGGGGAATATTG
GCGATTATTGTTGCCTGGAAACTATCAGCTCGAAGTTTCGGCTGACGGTT
ATTTTACTCAATGGAAAAATATCACTGTTACAGAAGGAGAAGTGACGAGA
ATGGATTTTAATTTATTTGAGAGTGCATCGTTGAGAATTTCACCTGCAAC
GAGCATTCTTTTTGTACATATGATTATTGCATTCCTGCTAGCTTGAGTAC
ACAGTGAGTGGAGGGATGCAAGATTACAATTATCGATACACCAACTGTTT
TGAAATCCTGATCGAGCTAAGCTGTACAAAATTGGTCCCTGAAAAAGACC
TTCTTATGTATTGGGAACACAATCGAAAAGCACTGTTGAGTTATCTCGCT
CGTATTCACATGGGAGTCAAAGATCGATTTCGAAGACGTATTCAAAGAGT
CATCATAACATGAGTAAAGGGAAACATTGCGGAGAAGACAAGTTTGTTGA
TGGAATCACTAATGGTGCAGAATGATGTATCTATCTTTATTTCTTGGATT
GCTGTTTGCAGTCACCACGCCTTGTTCAAGTCACCTTACAAAGCATTACA
TGTCTCATAAAGAACTTGAAAATCATCTGCAGAGCTTGACATCAATGTTT
CCCGATATTTCCCGAGTATACAGTATCGGGGAGAGCGTAAAAGGAAGAAG
TTTACTTGTTATGGAAATTTCATCGAACCCTGGCGAACACGAGTTTCTGG
AACCAGAATTCAAATATGTTGGTAACATGCACGGAGATGAGACAGTGGGT
CGGCAAATTCTTTTGAACTTAATTGAACTGTTGTTGTGGAACTATACTTC
CAACCCTGCGATCAAACAACTGGTTGATACAACAAGGATACACATTCTCT
GCACCATGAATCCTGATGGTTTCAACAAAGCACAAAAAACACAAAACGAT
TATTTACCAGATGGCCGGAACAATGCAAATAATGTCGATTTGAACAGAAA
CTTCCCAGACCCTTTTGTGCCATCATATTTCAGTAAGGTTCGAATGCAAA
AAGAAACAAAGGCAGTTATAGACTGGCTGCATTCACTCCCATTCGTTCTC
TCCGCTAACTTGCACGGTGGAGCAGTCGTGGTAAACTATCCTTATGATAA
CTTCAAAGAGTTTCAGCGTTATTTATTTTTCGGTCGTTCGATTTATGCCG
GGACTCCAGATGATGACGTTTTCAAGGGTTGTTCTGACACATGACCATGA
ACCAATCGAAGGTGCAAAGATTCTAATCCACGATCGAACAAAAGAAATCA
AAACATGGAGAACTGGGGAATATTGGCGATTATTGTTGCCTGGAAACTAT
CAGCTCGAAGTTTCGGCTGACGGTTATTTTACTCAATGGAAAAATATCAC
TGTTACAGAAGGAGAAGTGACGAGAATGGATTTTAATTTATTTGAGAGTG
CATCGTTGAGAATTTCACCTGCAACGAGCATTCTTTTTGTACATATGATT
ATTGCATTCCTGCTAGCTTGAGTACACAGTGAGTGGAGGGATGCAAGATT
ACAATTATCGATACACCAACTGTTTTGAAATCCTGATCGAGCTAAGCTGT
ACAAAATTGGTCCCTGAAAAAGACCTTCTTATGTATTGGGAACACAATCG
AAAAGCACTGTTGAGTTATCTCGCTCGTATTCACATGGGAGTCAAAGATC
GATTTCGAAGACGTATTCAAAGAGTCATCATAACATGAGTAAAGGGAAAC
ATTGCGGAGAAGACAAGTTTGTTGATGGAATCACTAATGGTGCAGAATGA
TGTATCTATCTTTATTTCTTGGATTGCTGTTTGCAGTCACCACGCCTTGT
TCAAGTCACCTTACAAAGCATTACATGTCTCATAAAGAACTTGAAAATCA
TCTGCAGAGCTTGACATCAATGTTTCCCGATATTTCCCGAGTATACAGTA
TCGGGGAGAGCGTAAAAGGAAGAAGTTTACTTGTTATGGAAATTTCATCG
AACCCTGGCGAACACGAGTTTCTGGAACCAGAATTCAAATATGTTGGTAA
CATGCACGGAGATGAGACAGTGGGTCGGCAAATTCTTTTGAACTTAATTG
AACTGTTGTTGTGGAACTATACTTCCAACCCTGCGATCAAACAACTGGTT
GATACAACAAGGATACACATTCTCTGCACCATGAATCCTGATGGTTTCAA
CAAAGCACAAAAAACACAAAACGATTATTTACCAGATGGCCGGAACAATG
CAAATAATGTCGATTTGAACAGAAACTTCCCAGACCCTTTTGTGCCATCA
TATTTCAGTAAGGTTCGAATGCAAAAAGAAACAAAGGCAGTTATAGACTG
GCTGCATTCACTCCCATTCGTTCTCTCCGCTAACTTGCACGGTGGAGCAG
TCGTGGTAAACTATCCTTATGATAACTTCAAAGAGTTTCAGCGTTATTTA
TTTTTCGGTCGTTCGATTTATGCCGGGACTCCAGATGATGACGTTTTCAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045849XLOC_045849Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073830-exon-scaffold_98-1575043694:225987..227512TCONS_00073830-exon-scaffold_98-1575043694:225987..227512Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1575043694:225584..225685TCONS_00073830-exon-scaffold_98-1575043694:225584..225685Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1575043694:225130..225305TCONS_00073830-exon-scaffold_98-1575043694:225130..225305Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1575043694:222093..223792TCONS_00073830-exon-scaffold_98-1575043694:222093..223792Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1510915933:225987..227512TCONS_00073830-exon-scaffold_98-1510915933:225987..227512Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1510915933:225584..225685TCONS_00073830-exon-scaffold_98-1510915933:225584..225685Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1510915933:225130..225305TCONS_00073830-exon-scaffold_98-1510915933:225130..225305Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1510915933:222093..223792TCONS_00073830-exon-scaffold_98-1510915933:222093..223792Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1491911889:225987..227512TCONS_00073830-exon-scaffold_98-1491911889:225987..227512Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1491911889:225584..225685TCONS_00073830-exon-scaffold_98-1491911889:225584..225685Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1491911889:225130..225305TCONS_00073830-exon-scaffold_98-1491911889:225130..225305Clytia hemisphaericaexon
TCONS_00073830-exon-scaffold_98-1491911889:222093..223792TCONS_00073830-exon-scaffold_98-1491911889:222093..223792Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073830-proteinTCONS_00073830-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:222093..227512 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.37088 1.26292 0.292047 0.265789 0.192249 0.158139 1.58285 1.46109 1.21834 1.72055 2.49566 1.65783 0.653706 0.44737 0.648079 0.371431 0.192442 0.550687 0.299208 0.345012 0.280389 0.642766 0.186121 0.358139 0.234474 0.314004 0.0387072 0.515457 0.127354 0.0319659
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000834Peptidase_M14
IPR008969CarboxyPept-like_regulatory
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004181 metallocarboxypeptidase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00073830 vs. Swiss-Prot (Human)
Match: CBPD (Carboxypeptidase D OS=Homo sapiens GN=CPD PE=1 SV=2)

HSP 1 Score: 317.39 bits (812), Expect = 9.719e-90
Identity = 181/385 (47.01%), Postives = 255/385 (66.23%), Query Frame = 1
Query:  895 HYMSHKELENHLQSLTSMFPDISRVYSIGESVKGRSLLVMEISSNPGEHEFLEPEFKYVGNMHGDETVGRQXXXXXXXXXXWNYTSNPAIKQLVDTTRIHILCTMNPDGFNKAQKTQNDYLPDGRXXXXXXXXXXXFPDPFVPSYFSKVRMQKETKAVIDWLHSLPFVLSANLHGGAVVVNYPYDNFKEFQRYLFFGRSIYAGTPDDDVFKSISKTYSKSHHNMSKGKHCG----EDKFVDGITNGAEWYTVSGGMQDYNYRYTNCFEILIELSCTKLVPEKDLLMYWEHNRKALLSYLARIHMGVKGVVL-THDHEPIEGAKILIHDRTKEIKTWRTGEYWRLLLPGNYQLEVSADGYFTQWKNITVTEGEVTRMDFNLFESAS 2034
            H+    ++E  L+   + +P+I+R+YS+G+SV+ R L VMEIS NPG HE  EPEFKY+GNMHG+E VGR++LLNLIE L  N+ ++P +  LV  TRIH++ +MNPDG+ K+Q+  +  +  GRNN+NN DLNRNFPD FV         Q ET AV+ W+ S PFVLSANLHGG++VVNYP+D+ ++       G + Y+ +PDD VF+ I+ +YSK +  M +G+ C      + F  GITNGA WY V GGMQD+NY  TNCFE+ IEL C K   EK+L  +WE NR++L+ ++ ++H GV+G VL   D   I  A I + +    + T++TG+YWRLL+PG Y++  SA GY    KN+TV      +++F L  S++
Sbjct:  502 HHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRIHLMPSMNPDGYEKSQEGDSISV-IGRNNSNNFDLNRNFPDQFVQITDP---TQPETIAVMSWMKSYPFVLSANLHGGSLVVNYPFDDDEQ-------GLATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQNRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNPVTKNVTVKSEGAIQVNFTLVRSST 875          

HSP 2 Score: 249.98 bits (637), Expect = 1.216e-67
Identity = 165/430 (38.37%), Postives = 241/430 (56.05%), Query Frame = 1
Query:  898 YMSHKELENHL-QSLTSMFPDISRVYSIGESVKGRSLLVMEISSNPGE-----------------HEFL--EPEFKYVGNMHGDETVGRQXXXXXXXXXXWNYT-SNPAIKQLVDTTRIHILCTMNPDGFNKAQKTQ---NDYLPDG---RXXXXXXXXXXXFPDPFVPSYFSKVRMQKETKAVIDWLHSLPFVLSANLHGGAVVVNYPYDNFKEFQRYLFFGRSIYAGTPDDDVFKSISKTYSKSHHNMSKGK-HCGEDK---FVDGITNGAEWYTVSGGMQDYNYRYTNCFEILIELSCTKLVPEKDLLMYWEHNRKALLSYLARIHMGVKGVVL-THDHEPIEGAKILIHDRTKEIKTWRTGEYWRLLLPGNYQLEVSADGYFT-QWKNITVTEGEVTRMDFNLFESASLRISPATSILFVHMIIAF 2088
            Y   +ELE+ L ++  +  P ++R++SIG SV+GR L V+ +++  G                     L   P+ K VGNMHGDETV RQ+L+ L   L   Y   +P + +L++TT +++L ++NPDGF +A++      D  P G   R+N+   DLNR+FPD F       +    E +A+I+W+    FVLS NLHGG+VV +YP+D+  E +        IY+ T DD+VFK ++K Y+ +H  M  G+ HC  D+   F DGITNGA WY V GGMQDYNY + NCFEI +ELSC K  P   L   WE+NR++L++ + ++H+GVKG V  +     +E A I +      I T R G+++RLL+PG Y L V   GY      N+ V EG  T +DF+L  + +  I   T  +     +A 
Sbjct:   58 YYHEEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPDAAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLPSLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRALIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHK-----ATGIYSKTSDDEVFKYLAKAYASNHPIMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTVAI 482          

HSP 3 Score: 167.162 bits (422), Expect = 1.040e-41
Identity = 120/367 (32.70%), Postives = 187/367 (50.95%), Query Frame = 1
Query:  898 YMSHKELENHLQSLTSMFPDISRVYSIGESVKGRSLLVMEISSNPGEHEFLEPEFKYVGNMHGDETVGRQXXXXXXXXXXWNYTSNPAIKQLVDTTRIHILCTMNPDGFNKAQKTQNDYLPDGRXXXXXXXXXXXFPDPFVPSYFSKVRMQKETKAVIDWL-HSLPFVLSANLHGGAVVVNYPYDNFKEFQRYLFFGRSIYAGTPDDDVFKSISKTYSKSHHNMSKGK-HC---GEDKFVDGITNGAEWYTVSGGMQDYNYRYTNCFEILIELSCTKLVPEKDLLMYWEHNRKALLSYLARIHMGVKGVVLTHDHEPIEGAKILIHDRTKEIKTWRTGEYWRLLLPGNYQLEVSADGYFTQWKNITV 1983
            Y S+K+L   L+ L   +P I+ + ++G+S + R +  +EIS+ P   E  EP+ ++V  +HG+  VG ++LL L E L  NY  NPA+ QLVD TRI I+ ++NPDG  +AQ+       D  +     +      D    + F+    Q ETKA+I+ L     F LS  L GG+++V YPYD  K  Q              + +  K ++  Y+ +H +M  G+  C    ++    G+  GAEW++  G M+DY+  Y +C EI +  SC        L   W  N+++LLS L  +H GV G V     +PI  A I++++  K ++T   G +  LL PG + +   ADGY  Q   + V
Sbjct:  933 YHSYKDLSEFLRGLVMNYPHITNLTNLGQSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPSLNPDGRERAQEK------DCTSKIGQTNARGKDLD----TDFTNNASQPETKAIIENLIQKQDFSLSVALDGGSMLVTYPYD--KPVQT-----------VENKETLKHLASLYANNHPSMHMGQPSCPNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADNKRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIK-VQTKEGGYFHVLLAPGVHNIIAIADGYQQQHSQVFV 1275          
The following BLAST results are available for this feature:
BLAST of TCONS_00073830 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CBPD9.719e-9047.01Carboxypeptidase D OS=Homo sapiens GN=CPD PE=1 SV=... [more]
back to top