Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073720 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073720
Unique NameTCONS_00073720
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2852

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073720 ID=TCONS_00073720|Name=TCONS_00073720|organism=Clytia hemisphaerica|type=transcript|length=2852bp
ATTGGAAAGAGCGCAGAGGAGAAATCGCTATAAAAACACATGAATTGACA
CtattttaaatcattttcattttttccagcATTGAATACACATCAACTGC
TACTACTAAAATTCGAATATTTTGTTTTACTTGgttaaaaaaatcgaata
ttGTATCAATACTGCTGGTAAGATTTTTTACACATGCGCATGATTCGATT
TATTGTAACCACAAGTGAATATTAAACGCAACAGAGTATATATATTTTGG
GAAGTACGTACTGTTTAACGGAAGATATATCATGAAGTTTGAGCTTGCGT
TTCTGGTTTTGGCACAACTTGTTCTGCTCTACGGgcAACAACGCGAGAAG
AAGATCAAAAAGAAAGGAGGCCTGaacTTGAAGAAACTCTCTAAACTGGA
AAACGATGCAGTGTTACACGGATATGCAGAATCGTATGAATTTTGTCAAC
AAAACTTCAAATATGAACCATggaattgtcctaaacctcaaGCAGTTAAG
AATGCTAAGCACCCTATCTCATTTACTGATATATATGAACATGCTACCAA
AGAAGCTTCGTATATCTACTCCATTGTAGCTGCTGGAGTTACCCATTACG
TCATCCGAGCATGTCAACAAGGCAAAGACCGGAACTGTCAATGTAAGAGC
AAGAAGCCAAAGAATGGCCTCGGTGCGCCAGTTGTGATGTGTCAAAGTAT
TATTGATCACGGTACAAAACGTGCCAGACGGATTCTAAAGCAAATGGATT
TCAAGAAAGTTTCAGATCCTGTTCGTAAAGCGTTCAACTGGAAAAATGCT
GCAAGCGGACTTCAGGTCTATCGACAATTAATGCCAAGGGAATGTCGATG
CAGCGGAGTATCTGGTCACTGTACTGCAACCGTATGTTGGGAAGCTACTC
CACCATCTTTAAAAGTACCAGCACAACAATTAAAACAACTCTACAATAAA
GCTGTTAAAATCAAACcaactgaaattgaaaaaccATTTTTCCCAACTAA
AAATCCAAACCGTAGCAGACCTGCACGTAACCTTGTCAATGATACAAAAC
TAATCTATATTACTGACTCTCCGAGTTATTGTAAACCTAATCCGTTATTA
GGGTTACCTGGTACTTTAAACCGGGAATGTGACCACACACAAGACAATAG
TTGTAATAAATTATGCAGTAAATGTGGATATAGAAAACATTCGGTAGTGA
AGAAACATATCAATACGAAATGTAATTGTAAATTCCATTGGTGCTGCAAG
GTCACGTGTGATACTTGTATTGAACGTCGATTGGTCACCAAGTGTTATTT
ACCGTCATCCTGAAGAGAAGGGATTTCATTGGTTGAAAGATAAAAGGATG
AGGAGTAGAAAAGGAGATCCGCAGTTCTGGTAACCCTGgaagacttttga
aaaaaatctgaatcgaCTGTTCTACTCTGCGTAAGTCAGAGCCTTATAGc
ttgcacacaacgttatttcaacgttcatttaacgttatatggacgccatg
aacattagataaacgttgcaACAACGctgtgtaccagctgggttaTAGCT
TTCCTAAGCTGCAGTTGACACACCTTCTAATTCGGTTTTTAAGAGGATTA
TGTACTTTTATTGAATAAGGGAGgacatcgaatagtagagcgtcgtttac
gaGAGTTTCTTGTTAACGGTGACTTTCAAAATTATCGAACAATAAAGAAT
ATCGAATAGTAGGCTGTCGAATTAGAAAACGTCAACTGTATCTAAGCTTG
GCATAGTATCGGGTAACAGGCTATCGCAATCCGTATTAAAATACAATGTT
ATGACAGCATTAGAATGTAATACAGACACCATTATGAATCGTTGGTGGTT
ATAAAATTCacaattcaaaagaaaattttggatcaagctgattggttcaa
aaaatcgatgacgtcattctcAAGACAGACTTGTAAACAAGGGGAATACA
GCAAACACACACTTTTGAAATGGATTATAAAAACGAATTAATTTTTCCTG
GAAATAGCCATTGAATATTACAACTATCTTAGATTTTAAAGGTTTCTTAC
GGACATTGTTTGGCAACTTTGATCAGCCATTTTTaaatacccctgtgtca
cagaccagACCCACCCACTAaaatattgactttaatttcatcTCCATTTA
AGAATCagtgaaaaaaatcacactctAAAACTATGGGAGCTGGGGATGAT
ATAATTTCTACTCCCATTGAGATTTTCGACGGTAATTTTCATCCCTACAG
TAGGAAAGAGTTTCATTGGGGCTGTGAGCTGTGAGGCAGGGATGTTTTTA
AGATTGATTTAATAGGGCTAGTCACCAGCGACTGGGGAAATTGTTCATTG
TGATTAAAATGATAGTGACCATCATCATTCAagatatgaaatatttttta
tagttttaaaCAGATTTATTAAAATATTGTAGAAGAGAAAAACTCAAGGT
ATTAGAATTAATTtataaaacaaaacttttattattaaaataaaGGCATA
cagaaattttaatttatatggtatattttcttttgttttttttgttggtg
aatatacacgtttttttctataGGAACaggctttataagaacataaccca
gctggcacacaacgttgtttcaacgttcatctaacgttatatggacgttg
tgaaacaacgttgtgtgccagctgggaaggtttcgatggctaaaatatta
ggcacaagttaagaacattttaagactttatgGACtttaaaacactcaat
ttcttagggaattcaaatatacttttaaattttggatatttttataaaaa
tctttaaGATCTTTAAGATCTTAAACtaagttgaattttttctgaaatta
aa
Run BLAST on NCBI

protein sequence of TCONS_00073720-protein

>TCONS_00073720-protein ID=TCONS_00073720-protein|Name=TCONS_00073720-protein|organism=Clytia hemisphaerica|type=polypeptide|length=343bp
MKFELAFLVLAQLVLLYGQQREKKIKKKGGLNLKKLSKLENDAVLHGYAE
SYEFCQQNFKYEPWNCPKPQAVKNAKHPISFTDIYEHATKEASYIYSIVA
AGVTHYVIRACQQGKDRNCQCKSKKPKNGLGAPVVMCQSIIDHGTKRARR
ILKQMDFKKVSDPVRKAFNWKNAASGLQVYRQLMPRECRCSGVSGHCTAT
VCWEATPPSLKVPAQQLKQLYNKAVKIKPTEIEKPFFPTKNPNRSRPARN
LVNDTKLIYITDSPSYCKPNPLLGLPGTLNRECDHTQDNSCNKLCSKCGY
RKHSVVKKHINTKCNCKFHWCCKVTCDTCIERRLVTKCYLPSS
Run BLAST on NCBI

transcript from alignment at scaffold_97:524104..537934-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073720 ID=TCONS_00073720|Name=TCONS_00073720|organism=Clytia hemisphaerica|type=transcript|length=13831bp|location=Sequence derived from alignment at scaffold_97:524104..537934- (Clytia hemisphaerica)
ATTGGAAAGAGCGCAGAGGAGAAATCGCTATAAAAACACATGAATTGACA CTATTTTAAATCATTTTCATTTTTTCCAGCATTGAATACACATCAACTGC TACTACTAAAATTCGAATATTTTGTTTTACTTGGTTAAAAAAATCGAATA TTGTATCAATACTGCTGGTAAGATTTTTTACACATGCGCATGATTCGATT TATTGTAACCACAAGTGAATATTAAACGCAACAGAGTATATATATTTTGG GAAGTACGTACTGTTTAACGGAAGATATATCATGAAGTTTGAGCTTGCGT TTCTGGTTTTGGCACAACTTGTTCTGCTCTACGGGTAAGTAAATTTCTTC TCCAGAGCGAGCTGGTACACAACGCTGCTTCAACGTTCATCTAACGCCAT TTGGATGTTCTGAACATTAGATGAACAACAACGTTGTGTACCAGCTGGGA GTCATTGCAGAATCAATAGTGTCAATATTTTTTGATAACTACAAATTTTA GTTTTCCCGAAGTTGCAATGATTCTCATTTTTTGCGATTTCTTGTAAGTT TATCCCGGTAAATACCTGGGAATTTGAGGTACTTTCTGGTCATTGTTATT TGCCCGCGTTATGACAAAGTCAATAAGATCATAAAAAAGTGACATGGGAA AAGAAAATTTGTAGTTTTAGTAAATATTTATTTTGTTTAAGAGGTATTAG GGTCTATCAATGTATTTGTTTTGCATTTGATTATGTCAAGGCTCAAAAAC CATTAGATTATAGCCTAATAAGAGTTTGTCAATATTTACTGTCGAGTGGT AACTAAAAAGCAAAAAAATGTTAATGAGTCTTTGCGAAGGAGACTTGAAT TGGCTTAATTTTGTACAATAAGGTTATATTTTGTGTTCCACCGTGCTTGT TTCTTAAATATCGACATTCCTGAAATAGCGACAAGGAGACCTTTTTAAGG GGTTAGTTATTAGGCTTTTCGTGACTTACATTTTTACTGAATCAAATAGA ATAGTAAAAGTGCCGTAAGCAGTAAAAAAGATTTTCAACACGGGAAAATA TAATGTCCGACATAGGGTTAGCTCATTCCTTTTTTTTCAAAAGGTGTAAA TGGGCTTCACACTTCCCAATGTGTTAAACGTTATTCTCTTTGTCGGTACT CTCTTTGATGTTCGGGGCTATTAAGAAAACAAAAGAGCATAAGTGTTAAT TATCCTCCCCCTCTTTCCTCCAAAAAGAATCCACCGTAAACTAAATCCAT GATATTTCAAGAAAAACACTGGACATTGGCCACTAGTTACCGTACTTACC CATAACAATCCAAAAGTCCCCCTAGCAATCAAAAGCATCTAAATCGCGAA AACTTGGATATTGCTGCGGTATAACCACTTTTTTGCGATTTTGGCGCTTT TGATTCTTAAAGGAGCGTTTGGATTGTTTACGGTATGTTTCTCGGAGTTG AGCTTTGTGTAAAAGTCCCGGTCCTTTTCAGATGTCTGTATTATAGGTTA TCAGTCAAAATGGTAGGAATTCTTCTTTAATATTTCTTTTGTACAAAAAG ACGAAATTAACGTCATTCATTAAAACGCATTGAAAATGTAATAAAATGTA ATTACCAAGAACAATCAATACACGCCCTGTTTCAGTTTGATGAAACATAC ACGTTTTTTTATAAGAACAAACTACATAAGAACATAATGCTTTGACGGCC AAAATATTAAGAAAACTAAGTCTTTATTGACTTAAAACACCCAATTTCTT ATCAAATTGCACGAAAATGCTCACAAAATAGTGAAATTATGAACAGTTTC AGGCTTATGATTAAAAAAACTTAAGAACATCCAAAAGCTTCCAAAAATTT GGATGTTCTTATAAAAAAGTCGTGTAATTGATCAAATGTTGTTTTCTCAT GAGACTCATAAAGCGGCAAGCTTTGATCTTTTTTTCAAGTATGATTGGCG ATAACTGTTTTAAACGGCCGTCAATTTAACTGGTCAAAATTCATAGCGTT CTTTGCTAATCAGTGAAAAGATAAGGATGATTTTGTTGTTACTTTTTTCG CGAAATTTAAGATATTGATCTTGTCTACGTTTTTTTTTGCGGTTTTCTTG TTTGTACTATATATTGTAATGGCGGCTTGTCTTTTTTTTAATCCGTATAT TATTATTCCAATATTTTGACCGATGAAGCCCATATCACTATTATTTAGAA GCTAATTACACGTTTTTTTATATGAACATCCAAAATTTTTGAAGCATTCT TAAAATGTTCTTAATTTCACTATTTTGTAGGCATTTTTGTGTAATTTCTT AAGAAATTGACATTTTAAAGAGCCCATAAAGCCTTGAAGTGTTCTTAACT TGTTCTTTAACATTTTTGCCATCGAAGCCTTATGTTCTAATATAGTTTGT TCTTATAAAAAACGCGTATCGCATCATAGGGTTTTAAAAGATATTTAATA ATTTGTTAATTTTGTCGGTATTTTTTTTGAGGAATCTTGGTATTCAATTT GCCTCTTCAATCCTTTCGGCGACAAGTTATATTCTTGTCTATATCAAGAA AAGATCGATAATCTATCATCGTAAAACAAAGCCCTTTGAAAAGAATTTTT AGCGTAAAAGAGCGCATCTGTTGTTTTTAATATGGACAATTTTGCGGTCA TTTAATAATTTATTTGCATCAATTTTTTTTCTTAGCTTGAATTCTTTTGC CGTAACTCGCGCACCACAACAACAAAAAGCCAGCGTAATTCTTCAAAGGC TTTCAAAGAGCGGTGTTCGCTCTGTAGCTTGAATTTGATTAAGTTTAATT TAACAGAGTCGTCGTCGACATAAAGTAATTACCTTGCCACTTCTGAAAAG TCAAAGGTGTTTTCAACAAAATTTATTGATTAAATTGATATTTAAAAGTT TATTCAAAGGAAGGATAAGTTATTTCAGTATTTGCAATTAATTTTATTTA AGATTCACGGAGGCGTAAAATCATTTGTTGTTTTGTAACCAATTTTACCT TTACTTACAACAAACGATTTTAAACACATCTAAATCATGCAAAGTCAACA TATAAAAACAACGTCTTTAGATTCTTTATTTTGTCGAAACTTTCAGAAAT TTGTACTCTTGAATTTCAAACAAAACAACTAATTTAGGCAATATACAATG CAAAGAAACTACAATAAAGTTCTAAAAGATATATTAATGAAACTATCGAC TTAAAAGGATTGATGTCTCAGTTTTATGGGCGGAAATATATGAATGTTGA TATGTTTAAACTAACACCCATTACTACTTCAGTCTAATAAAGTGCTAATT GGCTAGTTCCTAACTACATCCGATTACTATAAATATTATTTTGTGTCAAA TTTGATGACGCAAAGAATCACTATATATATTGTTGATTTCAATAATTTCA AAAAAGCTTTCTTCATCAGTTGTACCCACATAAAAAAAACTAAAAAAGGG TGTAGCTATATCAGACAATAGACCACGTCATCATCACTCAAACTGTCTGA ATTTCTTTTTGACATTGTTTTTGTTAAGGTCACCTTAATCTACTAACGTG GAGGTACGTATTGTTCTAACTTCTCGAGGAAGTTAAGGAAGTTCTAAAGA GGTAGTGTTTGACACCCTATATTTCATTGGTTTAGCAAGAAGAGATTTTT ACAAATTTGAGTCAGCATGTTAATAAGTAAAGGCTAATGTGTAAGTTTTC TTCGAAAAATCTTTTATAAGAACACTGAAAAAGTATCCATTCCACACTCC TAGTACTGTACAAATCTATCGCTACTTTTTTGTCTAAATCAGGTTTCAGG TCATAGACTCAAAATAATGATTTTACATACTCTTATAGTATACCGACCTC TGAAAATTGTATCTTTTTGTAATTTGGGCGAATTTGAAAGAAAGCTTATA CGGTAGCATGCTTAAAATTAGAAATATTGTAAATCAAACAAAATGACATT ATTTTTCACACATAGATCAGCGAGTAGATGTTAATAAGGGATAAGGGAAG CTTATGGTTTTATCATCCAAATTTATTATTTTTCTCTTTCACTTCAATAC TGTATGTCACTCATTCATATAAAACCTCTGATCGTCATTTATGATATATT GTGTACCGTAGTCTGTGATAAGCGGGCGCACCTCAAAGTAGCGGAAAAGT AACTCTTTTCTAGACTAGCAGTAGCGTAGACAAGGGGGGGGGGAATTTGT GTAGGAAAGCAGAATTTTATGACACAGTAATTAGCTTTTTATATTATGAA TAGATAATTACAGTGTCATAAAAATCACAAATTTGCGCCCCTCCTGTCTA GGCTACTGGACTAGGATCTTACTGCATCTCCCAAGTTGAAAAGAGTGATT TGTTGACTCGTGTGTAATTGCAGGACCTTATACTTAAGGAAACCAGCACT TGGAGGGTATATCATAATCCATTGAAAAAAGACCACTTGTTATTAATAAG GTCCCAAAAACCTCTTATTCGAAGTGTTATCAAGAGAGTTACTACTCTAA GTGTACAGTATTTGCTAAAGAAAAAAATTGAAGTAGCGTTAGACACACAT CAAACAGCGACCGAACTGAAATCATTGAAGTGCCTTATACACTCTATAGT AATACTATTTCAAAACAGATTATCTTTAGCCCTTGTATATAATTCAACCG TGGTATCAGAAAGTGAAGTAATACAGGCTAAAATGTCTTTGATAAGGATT TTCAAGAAAGTTTACGTTTGTTTTTATGAGATTATGAGACAGATTAGTAT CTTGTTTGAATTCTACCGACAATTTGGAGTTACGGTTAATTTGAAGGTTA TCTTTCCCCTGAAATTTAGTCACTATAAAATTTATTTTTCAAATTAGGTA TTACAAAAAAGAATTACCACGTTTTTCTAGTTGAACTCGCAGTGAAAAGT TGCAATCTATTGAGAAACTTCAGCTTTTCTCGGTGAAGTATTAATAGAAT GCAGATCGCCGAGACTCCATCGAAACTGGCCTTAAAATGTTCGTAACTTG TTCTTAACACTTTTGTCATGGAAGCCTTATGTTCTTATATAGTTTTTTCT TATAAAAAAAGTGTATTGCCTTCCATTTTGATTTGTTTGTAGCCAGTACT TGACTTTGTTGTTGCACTGCATATTAAGGAAAGTGATATGTACAGGCTAA TAAAGCAGCAGCAAGCTATCCAGCTGAAATAATAACTTAATCAAATTTAA CTGAATTAGTAGACCTTCAAAGAACATAAAGATCAAGGGTAAATGAGCCG GCACAGAACGTCAAAACAACGTCCATGTGACATTCATAACGTCCAATTAA CGTTATTTGAACGTTAAAACAACGTTGTGTGCCAGCTGGTAAGATTTCAA TGTTGAAAATCCTAAGAAGACGGTTGATTTTTGATGTTTTTATTATGATG CTCTTGAGCTGTCTTTTTTATAGCATTTCGGCATTTTTCCTCTAATTATA TCCTTCTTATCTATGTTTGATAGGTAGGGTTTGTTTTTATCACTACATGA AGACAGCTTCCGTGTTGGCATCATCTTTTAAACGTTTTTCTAACGTTACG ATTTTGTACTAGTTTAAAAAAGCGGTTCAAATCAAGGGACTAATTTAGGG TCATAATATGCATAAAATCCCTTTATTGACAACCCCCGGGTTGCTTGAGA TCTAACACTTTTTTAGGTATAATAAACCAAAAATGTCACTTTATTTTATC GCTCTAGTTTTTTCTAAGGGCTATAACACCGCTCAACCTCAAAACCTTAT TTTTAAAAATTGTTCAATTAATTAATTCGTCTTTGCAACGGATGATAGAC ATCTTTATCAGGTCAAAAACTTTTAATTATTGGTTTACTAGCTTTCTGAA CAGTTACCGTTTTATTAAGATCAATGTCGGTACGCCTCCTCTGTATTAAG GCTAATTGACCAGTATTGATCCGCTATCAACATTTTTGAGCAAAAAAAGG TATTTCCTTAAAACTTCGATAGAAAAAAGTAAACTTTGCTGACAAGTGAG AAGTTACCGCTTATAGTCAGCGGCTTTTTAAAAAACAATTTTGATGACAA AACATTAAATAGAAACTCAATTATTATTACAGAAAAATGAGTTGATTTTG GGTAGACTATTTTTAAGCTTCTATACGTGTGTTTGGCGGTATATTATAAA AGTTTTATAATGGTCAAACAATTGATGTCGTCATATTGCTGCGCGGTCTC CCGTTTGATTTTTTTCCAGGCGGTTAAACGCCTGGTAACGGCGTCAAATG TCGAAACGTTTTGAGGATTTTAATCTCTTTTAAATGTTCGGTTATTATAT CTAAAGAAGTCAAAAATAGGTTTTTATAACTTTCTTGTTGTGTCTTTTTG ATATAGCAATGAAGACAGCATTTTTTCAAATGAAAAAATTTTGATAAAGT GTAAAAATGGTGTTAAGAAAGAAACACTTGAGAATCAAATGGGTGTCCGC CTCCGTTCTCTATTAGCCAATCACCAATTATGCATGATGAGCTGTTTTTT CAAGAGCATAGTCTACAGTATGTGTTCATTCTAAGGCTATCTATACTGAA ATACCTATCTATATCCCTGCGCTCAAATGGCCTTTGGAAGATTGCCTTTA CAGGCTTGTACCTATAATCAGCACTTAAAATAATAGTGATATAGTTATGC ACTATCCAAAGAGCTTATGATGCGTGGACGATTATTGAAATCTTATTATA TACGTCTGCGTGTATATTCATACTGCCCGCGCGAAGATTCATTCCCGCCA GTTTCCGTTTTTCGTTTGTTTGGCGCAGTTCTCTAAAATGTTTTTCTTTC ATCTTTTCGTATCAAGAACTCGTGTAGAGGCTAAAGCGCTTATTACTGCA GGTCGTCTTTCTTTTCAGCCTTTTGAAGTCATCGCTATCTTATACACGTT TTTTTATAAGAACTTCCAAAATATTTGAAGCCTTTCGGATGTTCTTAACT TTTTGGGTTTTAAGCCTAAAAATGTTCTAAACATGTTCTTAATTCTACCG TGATCATTTTTACCTATTTTCCTAAGAAATTGGCTGTTTTAGAGTCCGCA AAGCCTTAAAGTATTCTTCACTTGTTCTTAACATTTTGGTCATCAAAGCT TTATGTTCTTATATAGTTTGTTCTTATAAAGAAATGTGTACATTATGTTT TCTTTCGCCTGTCGCTTCTTTATAGTGTACAGAAGATCAGGTATCGCAAG CTTCCGCCTGCTTTTAATAAATACAAAAAATGGGGTATTTTATTTAATTA CCTATATATAAAAAGGGTAATTAAAAACATATAATACCTTTTTATAATGT ATTATATTATTGTATATTTAAAAGATGATGTAAAACGAATTATAGATGTG ACCGCTAGAATTTCTTTTACGCGTTTTTTTATAAGAGCAAACAAGAACAT AAGGCTTCAATGGCAAAAATATTAAGAACAGGCTAAGAACATTTTAAGGC TTTGCAGACTCTAAAACACCCCATTTCTTAGGAAAATGGACAAAAAGTAC TAACAAAATGGGGAAAATAAGAACATTTTTTAGACTTGAACATCCGAAGG TTCCAAAAATTTTGGATGTTCTTATAAAAAATAGTGTAAAAAAGCTTTGC GGAATGTAAAAAACCGGTCGGTCGGTAACACAAAAAAAAAGTCGTAGAGA ACACCACATGCTGATTATAATAGTTCCTTATCCCAGCTTTAAAGGTGAGA GAATCGCTAGAAATTGGATGCTTAAACTGAGTACTAAAGGAAGTCACCGT GATGTTATAATCTATTGACGAATGACGGCTTTTAGAAGTTCGGTTTTTTT TTTTCGTTCTACCTTGATGCTTTTTTTTGATAGTAACGTTTAATGATTGT TCAGTCCATTTAGATAATACAACTCCTTGGTTAGTGAATTATAAGTAAAT TAATGATACAGTTATTCGACTGTATCCGCCAATTGCCACGCGGGCAATTT TTTTTCCGTTTTACCATTTTAAAACCGTCCCAGTCTTTTTTTCGCACTTA AAGACAATATAAAAAGTGTAAAAAAAGGATTGGATCGAGTTTAGGGTGGT AGATTAAATAATAAAGTGGAACGCGCCTGACCGCCCGACTACGATCGAAA AGGTGTATTTAGACCTAAATTGTTCCGAACATATGTTTAACATACCGCCC TTTTGATAAAAACACGTTTCGCTGAACCACTCTTTAAACTGAATTCGTAA ATAAGGCCAAGGTATCTCAACCTCGTTACCTGTGTATTATGGGTGATTTG ATGTTTACTGAAAACGCCAGATAATGCCCTTAGATGGTGAACTCACACTA AACTACACTAGAGTATTCTTTAGCGTCCATCAGTAACGTAAAATATAGCC TCGAATACACGGGAAGAAGTTGAAGATACCTTAAACTTTAGTTTGAAACC TAGAAAGAAAATAAGCGACGTAATTTTCCTTTTTTTAAATGCCGCGATAT TTCAACATGACTTTCACATATTTATCTATATTTTTTAGGATTATGGATTT AGTAATATACACAAAACGTACTAAAAACAGTAATGTTTTATGCACATCTT TAAAACTATTTTCCTCAATCATTAAGGATAATATGTGATAATCATGTTCA AGTATTGCGACATAAAAGGACAATTTTTATTTCATTTTTTGGCACCCCGT GATCGAAAGCTAAGTGTGACGTCAAAAGAGTAATAGGTGCCGCTCATATC TGATTCGAAAATAGAATTATGAATTTATGACGTCATGACTATGAATAATT CCAAAAAGTTAGTTTCATCTTTGGTTATACATGATTTTTTGACACGGAAT CGAACTCTAGCCGACGCACGCAAAGCGCTAAAACAAACATCTATCTAACG TTCATTCTTTATGTTAGTCGAACGTTGAAACAACGTTGTGCATCAGCTTG GATATACGTTTTTTTATAAGAACAAACTATATAAGAACATAAGGCTTCGA TGGCCAAAATGTTAAGAACAAGTTAAGAATATTCCAAGGCTTTTGGGACT CTAAAACACCCAATGTCTTAGGAAAATGGACAAATATACTCACAAAATAG GGAAAATAAGAACATGTTAAGAACATTTTTAGGCTCAAAACTCAAAAATT TCAGATATTCTTATAAAAAAACGTATATGAATCGGTCTGTTTTTTATTTC AGAAAAAAATGCAGAAAACCTAATATAGAAATTTACATAAAGAAATCAAT AGCTTACCCTTAATGACCCTTAATGGCATATTTTACAGGATTAAGAGGGA AACCAAGAAAACACCTATCGAGCGGGAAGCCGCGGGAAGCCATTAAATTC GCATTTAATTAGCGATTATGATTTCTAATTTTTGCGGACTCATTCATTTT GAAACGTGTACATATTGAAATGGTGGATTGTTTTGGTTTTTATTTCAATT CCAATTCCAAAACATTTTAATGATACTTTAATATCTTCCGTTGATATTTT GATTGACAACAATCGCACCTTTGTTTGTTTTGCAATGGATATATATTATC TGATTTTTTGGAATTTTCTATCAAAGTTACCTTTGTTTTTACTAAATTTG CTTAAAACTGCCTTCTTCAAATTGATTTTCCTCTAATTCGACGTTCCTCT ATGCAAACTACATTATTCAATAATATTGAAAGTCACTCTTAACAAGAAAC TGTTGTTAACGACGCTCTACTAATCAATACGCTATCTTATTTGATGAAGG TACACGATCCCTCTCGGGAAAATTGAATCAACGTCAATTGTTAACGTAGC TGCCTAAAAAATTGTCTCACACCCGGGAGGGGGGATACTTAGGCAAGAAT GGGTGCTGGGTGTGTGTGCGGAGGTAAGGGTCGGTTTTTACCCTTCAAAG TCTCTCTTAGGTCCCGCCCGCACATACCCCTCATCCNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCC CCCCCCCCCGGGTCTCACACAAAACATGCCATGGAATTCCCAGTAGCAAA TGTAGAAACTTTTGTATAGTAATCAAATTATCAATTTTTAATTTTTTAAG GCAACAACGCGAGAAGAAGATCAAAAAGAAAGGAGGCCTGGTAAGTAGTA TTACACATGACGTCATTCATTCATTACATCATTTTGAACCAATCATTTGA TGATTTCTAATCATCAATATCTTTCTTGAAACAGTTGTTCCTATAATAAC TTTGTCGACCAATATTGAGATGGTTTAAGTCGTCTGCAACACCGAAAAAA ATTATAATTGTTTCCTCCAATACCGTATTACCGGATAGAAGAAAAGGCAA TGCCATGTCACCGAAAGCCTTGAATTCCTTTCTTCTTTAGGTTGACAATT TTGCAAACGCGTACTAAAAACGCCCTAAATAATAATAAACAATAGTGCCC TAAAACTCAACAATGGGAACACTAAAAGGCCTTCTTGAAGTCTCACCGTT TCAACATATGTTCTTAATTCTTCAATTTTTCTTTTCCAGAACTTGAAGAA ACTCTCTAAACTGGAAAACGATGCAGTGTTACACGGATATGCAGAATCGT ATGAATTTTGTCAACAAAACTTCAAATATGAACCATGGAATTGTCCTAAA CCTCAAGCAGTTAAGAATGCTAAGCACCCTATCTCATTTACTGATATATA TGAACATGGTAAGTTAATAGTCTAACATAACTAAATTTGACAAAAAAACT TCTTCATACCAAATATGTGATCAACCTTTTAGCCGGCACACGACGTTGTT TCAACGTCTATCTCACATTCACAACGTCCATATAACGTTGAATGAACGTT GAAACAATGTTGTATGACAACTGAGTCACTTCACCCGGTCAAATGTCTCA TGCTTAAAAACACTCAGAAAAATTCATAAAGAGATTTTCAAAAAGCAGCA ATCGATATGTGGCGAATTTGAAAATGTGTTTAACTACAGACTTTAAAGGG GACGTCAGCTTTGGAATATCATTTTTACCAATAATAAGGATTGCAATCAG GAGGATTGATGATTTAGAATTATTTTTCAATCAAACTCATTCAATCAAAC TCATACCCAGGGCTACTTTCTTACTTACTGATGGACATGATACAATTGTG ACCGCTACCAAAATGATAAGAAAAGTGCTAAGGGACTATATATGAGTTTG TTCTTCATTTTTTTTGTTTCTACTTTCAGCTACCAAAGAAGCTTCGTATA TCTACTCCATTGTAGCTGCTGGAGTTACCCATTACGTCATCCGAGCATGT CAACAAGGCAAAGACCGGAACTGTCAATGTAAGAGCAAGAAGCCAAAGAA TGGCCTCGGTGCGCCAGTTGTGATGTGTCAAAGTATTATTGATCACGGTA CAAAACGTGCCAGACGGATTCTAAAGCAAATGGATTTCAAGAAAGTTTCA GATCCTGTTCGTAAAGCGTTCAACTGGAAAAATGCTGCAAGCGGACTTCA GGTAAGCTGATATTTTTTTCAGTAAAAAATGACTGAGAACTGATGGGTGG GTTGTCAATTGCAATAAATGTAGAAATTTGATTTTTCAGAGAGTCAATCA TGTGTTTTTCCAATTACTATTTAAATTTGTGTGACGAAATGAAAATTTAT GTCCAACTGTAAATTCACTCAGGAGATTAGGGTGGCAGTTTAAATGTGTC TATGCTTGCAGACTCGGGCCTCACTGATGAGCCCCGGGAAGAAAGAAAAA CTTGTCTATATGTAACTAAATTTCATTTTCTTCTATCTTTCTAGGTCTAT CGACAATTAATGCCAAGGGAATGTCGATGCAGCGGAGTATCTGGTCACTG TACTGCAACCGTATGTTGGGAAGCTACTCCACCATCTTTAAAAGTACCAG CACAACAATTAAAACAACTCTACAATAAAGCTGTTAAAATCAAACCAACT GAAATTGAAAAACCATTTTTCCCAACTAAAAATCCAAACCGTAGCAGACC TGCACGTAACCTTGTCAATGATACAAAACTAATCTATATTACTGACTCTC CGAGTTATTGTAAACCTAATCCGTTATTAGGGTTACCTGGTACTTTAAAC CGGGAATGTGACCACACACAAGACAATAGTTGTAATAAATTATGCAGTAA ATGTGGATATAGAAAACATTCGGTAGTGAAGAAACATATCAATACGAAAT GTAATTGTAAATTCCATTGGTGCTGCAAGGTCACGTGTGATACTTGTATT GAACGTCGATTGGTCACCAAGTGTTATTTACCGTCATCCTGAAGAGAAGG GATTTCATTGGTTGAAAGATAAAAGGATGAGGAGTAGAAAAGGAGATCCG CAGTTCTGGTAACCCTGGAAGACTTTTGAAAAAAATCTGAATCGACTGTT CTACTCTGCGTAAGTCAGAGCCTTATAGCTTGCACACAACGTTATTTCAA CGTTCATTTAACGTTATATGGACGCCATGAACATTAGATAAACGTTGCAA CAACGCTGTGTACCAGCTGGGTTATAGCTTTCCTAAGCTGCAGTTGACAC ACCTTCTAATTCGGTTTTTAAGAGGATTATGTACTTTTATTGAATAAGGG AGGACATCGAATAGTAGAGCGTCGTTTACGAGAGTTTCTTGTTAACGGTG ACTTTCAAAATTATCGAACAATAAAGAATATCGAATAGTAGGCTGTCGAA TTAGAAAACGTCAACTGTATCTAAGCTTGGCATAGTATCGGGTAACAGGC TATCGCAATCCGTATTAAAATACAATGTTATGACAGCATTAGAATGTAAT ACAGACACCATTATGAATCGTTGGTGGTTATAAAATTCACAATTCAAAAG AAAATTTTGGATCAAGCTGATTGGTTCAAAAAATCGATGACGTCATTCTC AAGACAGACTTGTAAACAAGGGGAATACAGCAAACACACACTTTTGAAAT GGATTATAAAAACGAATTAATTTTTCCTGGAAATAGCCATTGAATATTAC AACTATCTTAGATTTTAAAGGTTTCTTACGGACATTGTTTGGCAACTTTG ATCAGCCATTTTTAAATACCCCTGTGTCACAGACCAGACCCACCCACTAA AATATTGACTTTAATTTCATCTCCATTTAAGAATCAGTGAAAAAAATCAC ACTCTAAAACTATGGGAGCTGGGGATGATATAATTTCTACTCCCATTGAG ATTTTCGACGGTAATTTTCATCCCTACAGTAGGAAAGAGTTTCATTGGGG CTGTGAGCTGTGAGGCAGGGATGTTTTTAAGATTGATTTAATAGGGCTAG TCACCAGCGACTGGGGAAATTGTTCATTGTGATTAAAATGATAGTGACCA TCATCATTCAAGATATGAAATATTTTTTATAGTTTTAAACAGATTTATTA AAATATTGTAGAAGAGAAAAACTCAAGGTATTAGAATTAATTTATAAAAC AAAACTTTTATTATTAAAATAAAGGCATACAGAAATTTTAATTTATATGG TATATTTTCTTTTGTTTTTTTTGTTGGTGAATATACACGTTTTTTTCTAT AGGAACAGGCTTTATAAGAACATAACCCAGCTGGCACACAACGTTGTTTC AACGTTCATCTAACGTTATATGGACGTTGTGAAACAACGTTGTGTGCCAG CTGGGAAGGTTTCGATGGCTAAAATATTAGGCACAAGTTAAGAACATTTT AAGACTTTATGGACTTTAAAACACTCAATTTCTTAGGGAATTCAAATATA CTTTTAAATTTTGGATATTTTTATAAAAATCTTTAAGATCTTTAAGATCT TAAACTAAGTTGAATTTTTTCTGAAATTAAA

Coding sequence (CDS) from alignment at scaffold_97:524104..537934-

>TCONS_00073720 ID=TCONS_00073720|Name=TCONS_00073720|organism=Clytia hemisphaerica|type=CDS|length=5160bp|location=Sequence derived from alignment at scaffold_97:524104..537934- (Clytia hemisphaerica)
GTCTATCGACAATTAATGCCAAGGGAATGTCGATGCAGCGGAGTATCTGG
TCACTGTACTGCAACCGTATGTTGGGAAGCTACTCCACCATCTTTAAAAG
TACCAGCACAACAATTAAAACAACTCTACAATAAAGCTGTTAAAATCAAA
CCAACTGAAATTGAAAAACCATTTTTCCCAACTAAAAATCCAAACCGTAG
CAGACCTGCACGTAACCTTGTCAATGATACAAAACTAATCTATATTACTG
ACTCTCCGAGTTATTGTAAACCTAATCCGTTATTAGGGTTACCTGGTACT
TTAAACCGGGAATGTGACCACACACAAGACAATAGTTGTAATAAATTATG
CAGTAAATGTGGATATAGAAAACATTCGGTAGTGAAGAAACATATCAATA
CGAAATGTAATTGTAAATTCCATTGGTGCTGCAAGGTCACGTGTGATACT
TGTATTGAACGTCGATTGGTCACCAAGTGTTATTTACCGTCATCCTGACT
ACCAAAGAAGCTTCGTATATCTACTCCATTGTAGCTGCTGGAGTTACCCA
TTACGTCATCCGAGCATGTCAACAAGGCAAAGACCGGAACTGTCAATGTA
AGAGCAAGAAGCCAAAGAATGGCCTCGGTGCGCCAGTTGTGATGTGTCAA
AGTATTATTGATCACGGTACAAAACGTGCCAGACGGATTCTAAAGCAAAT
GGATTTCAAGAAAGTTTCAGATCCTGTTCGTAAAGCGTTCAACTGGAAAA
ATGCTGCAAGCGGACTTCAGAACTTGAAGAAACTCTCTAAACTGGAAAAC
GATGCAGTGTTACACGGATATGCAGAATCGTATGAATTTTGTCAACAAAA
CTTCAAATATGAACCATGGAATTGTCCTAAACCTCAAGCAGTTAAGAATG
CTAAGCACCCTATCTCATTTACTGATATATATGAACATGGCAACAACGCG
AGAAGAAGATCAAAAAGAAAGGAGGCCTGATGAAGTTTGAGCTTGCGTTT
CTGGTTTTGGCACAACTTGTTCTGCTCTACGGGTCTATCGACAATTAATG
CCAAGGGAATGTCGATGCAGCGGAGTATCTGGTCACTGTACTGCAACCGT
ATGTTGGGAAGCTACTCCACCATCTTTAAAAGTACCAGCACAACAATTAA
AACAACTCTACAATAAAGCTGTTAAAATCAAACCAACTGAAATTGAAAAA
CCATTTTTCCCAACTAAAAATCCAAACCGTAGCAGACCTGCACGTAACCT
TGTCAATGATACAAAACTAATCTATATTACTGACTCTCCGAGTTATTGTA
AACCTAATCCGTTATTAGGGTTACCTGGTACTTTAAACCGGGAATGTGAC
CACACACAAGACAATAGTTGTAATAAATTATGCAGTAAATGTGGATATAG
AAAACATTCGGTAGTGAAGAAACATATCAATACGAAATGTAATTGTAAAT
TCCATTGGTGCTGCAAGGTCACGTGTGATACTTGTATTGAACGTCGATTG
GTCACCAAGTGTTATTTACCGTCATCCTGACTACCAAAGAAGCTTCGTAT
ATCTACTCCATTGTAGCTGCTGGAGTTACCCATTACGTCATCCGAGCATG
TCAACAAGGCAAAGACCGGAACTGTCAATGTAAGAGCAAGAAGCCAAAGA
ATGGCCTCGGTGCGCCAGTTGTGATGTGTCAAAGTATTATTGATCACGGT
ACAAAACGTGCCAGACGGATTCTAAAGCAAATGGATTTCAAGAAAGTTTC
AGATCCTGTTCGTAAAGCGTTCAACTGGAAAAATGCTGCAAGCGGACTTC
AGAACTTGAAGAAACTCTCTAAACTGGAAAACGATGCAGTGTTACACGGA
TATGCAGAATCGTATGAATTTTGTCAACAAAACTTCAAATATGAACCATG
GAATTGTCCTAAACCTCAAGCAGTTAAGAATGCTAAGCACCCTATCTCAT
TTACTGATATATATGAACATGGCAACAACGCGAGAAGAAGATCAAAAAGA
AAGGAGGCCTGATGAAGTTTGAGCTTGCGTTTCTGGTTTTGGCACAACTT
GTTCTGCTCTACGGGTCTATCGACAATTAATGCCAAGGGAATGTCGATGC
AGCGGAGTATCTGGTCACTGTACTGCAACCGTATGTTGGGAAGCTACTCC
ACCATCTTTAAAAGTACCAGCACAACAATTAAAACAACTCTACAATAAAG
CTGTTAAAATCAAACCAACTGAAATTGAAAAACCATTTTTCCCAACTAAA
AATCCAAACCGTAGCAGACCTGCACGTAACCTTGTCAATGATACAAAACT
AATCTATATTACTGACTCTCCGAGTTATTGTAAACCTAATCCGTTATTAG
GGTTACCTGGTACTTTAAACCGGGAATGTGACCACACACAAGACAATAGT
TGTAATAAATTATGCAGTAAATGTGGATATAGAAAACATTCGGTAGTGAA
GAAACATATCAATACGAAATGTAATTGTAAATTCCATTGGTGCTGCAAGG
TCACGTGTGATACTTGTATTGAACGTCGATTGGTCACCAAGTGTTATTTA
CCGTCATCCTGACTACCAAAGAAGCTTCGTATATCTACTCCATTGTAGCT
GCTGGAGTTACCCATTACGTCATCCGAGCATGTCAACAAGGCAAAGACCG
GAACTGTCAATGTAAGAGCAAGAAGCCAAAGAATGGCCTCGGTGCGCCAG
TTGTGATGTGTCAAAGTATTATTGATCACGGTACAAAACGTGCCAGACGG
ATTCTAAAGCAAATGGATTTCAAGAAAGTTTCAGATCCTGTTCGTAAAGC
GTTCAACTGGAAAAATGCTGCAAGCGGACTTCAGAACTTGAAGAAACTCT
CTAAACTGGAAAACGATGCAGTGTTACACGGATATGCAGAATCGTATGAA
TTTTGTCAACAAAACTTCAAATATGAACCATGGAATTGTCCTAAACCTCA
AGCAGTTAAGAATGCTAAGCACCCTATCTCATTTACTGATATATATGAAC
ATGGCAACAACGCGAGAAGAAGATCAAAAAGAAAGGAGGCCTGATGAAGT
TTGAGCTTGCGTTTCTGGTTTTGGCACAACTTGTTCTGCTCTACGGGTCT
ATCGACAATTAATGCCAAGGGAATGTCGATGCAGCGGAGTATCTGGTCAC
TGTACTGCAACCGTATGTTGGGAAGCTACTCCACCATCTTTAAAAGTACC
AGCACAACAATTAAAACAACTCTACAATAAAGCTGTTAAAATCAAACCAA
CTGAAATTGAAAAACCATTTTTCCCAACTAAAAATCCAAACCGTAGCAGA
CCTGCACGTAACCTTGTCAATGATACAAAACTAATCTATATTACTGACTC
TCCGAGTTATTGTAAACCTAATCCGTTATTAGGGTTACCTGGTACTTTAA
ACCGGGAATGTGACCACACACAAGACAATAGTTGTAATAAATTATGCAGT
AAATGTGGATATAGAAAACATTCGGTAGTGAAGAAACATATCAATACGAA
ATGTAATTGTAAATTCCATTGGTGCTGCAAGGTCACGTGTGATACTTGTA
TTGAACGTCGATTGGTCACCAAGTGTTATTTACCGTCATCCTGACTACCA
AAGAAGCTTCGTATATCTACTCCATTGTAGCTGCTGGAGTTACCCATTAC
GTCATCCGAGCATGTCAACAAGGCAAAGACCGGAACTGTCAATGTAAGAG
CAAGAAGCCAAAGAATGGCCTCGGTGCGCCAGTTGTGATGTGTCAAAGTA
TTATTGATCACGGTACAAAACGTGCCAGACGGATTCTAAAGCAAATGGAT
TTCAAGAAAGTTTCAGATCCTGTTCGTAAAGCGTTCAACTGGAAAAATGC
TGCAAGCGGACTTCAGAACTTGAAGAAACTCTCTAAACTGGAAAACGATG
CAGTGTTACACGGATATGCAGAATCGTATGAATTTTGTCAACAAAACTTC
AAATATGAACCATGGAATTGTCCTAAACCTCAAGCAGTTAAGAATGCTAA
GCACCCTATCTCATTTACTGATATATATGAACATGGCAACAACGCGAGAA
GAAGATCAAAAAGAAAGGAGGCCTGATGAAGTTTGAGCTTGCGTTTCTGG
TTTTGGCACAACTTGTTCTGCTCTACGGGTCTATCGACAATTAATGCCAA
GGGAATGTCGATGCAGCGGAGTATCTGGTCACTGTACTGCAACCGTATGT
TGGGAAGCTACTCCACCATCTTTAAAAGTACCAGCACAACAATTAAAACA
ACTCTACAATAAAGCTGTTAAAATCAAACCAACTGAAATTGAAAAACCAT
TTTTCCCAACTAAAAATCCAAACCGTAGCAGACCTGCACGTAACCTTGTC
AATGATACAAAACTAATCTATATTACTGACTCTCCGAGTTATTGTAAACC
TAATCCGTTATTAGGGTTACCTGGTACTTTAAACCGGGAATGTGACCACA
CACAAGACAATAGTTGTAATAAATTATGCAGTAAATGTGGATATAGAAAA
CATTCGGTAGTGAAGAAACATATCAATACGAAATGTAATTGTAAATTCCA
TTGGTGCTGCAAGGTCACGTGTGATACTTGTATTGAACGTCGATTGGTCA
CCAAGTGTTATTTACCGTCATCCTGACTACCAAAGAAGCTTCGTATATCT
ACTCCATTGTAGCTGCTGGAGTTACCCATTACGTCATCCGAGCATGTCAA
CAAGGCAAAGACCGGAACTGTCAATGTAAGAGCAAGAAGCCAAAGAATGG
CCTCGGTGCGCCAGTTGTGATGTGTCAAAGTATTATTGATCACGGTACAA
AACGTGCCAGACGGATTCTAAAGCAAATGGATTTCAAGAAAGTTTCAGAT
CCTGTTCGTAAAGCGTTCAACTGGAAAAATGCTGCAAGCGGACTTCAGAA
CTTGAAGAAACTCTCTAAACTGGAAAACGATGCAGTGTTACACGGATATG
CAGAATCGTATGAATTTTGTCAACAAAACTTCAAATATGAACCATGGAAT
TGTCCTAAACCTCAAGCAGTTAAGAATGCTAAGCACCCTATCTCATTTAC
TGATATATATGAACATGGCAACAACGCGAGAAGAAGATCAAAAAGAAAGG
AGGCCTGATGAAGTTTGAGCTTGCGTTTCTGGTTTTGGCACAACTTGTTC
TGCTCTACGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045775XLOC_045775Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073720-exon-scaffold_97-1575043694:537601..537934TCONS_00073720-exon-scaffold_97-1575043694:537601..537934Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1575043694:527795..527834TCONS_00073720-exon-scaffold_97-1575043694:527795..527834Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1575043694:527227..527395TCONS_00073720-exon-scaffold_97-1575043694:527227..527395Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1575043694:526434..526705TCONS_00073720-exon-scaffold_97-1575043694:526434..526705Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1575043694:524104..526140TCONS_00073720-exon-scaffold_97-1575043694:524104..526140Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1510915933:537601..537934TCONS_00073720-exon-scaffold_97-1510915933:537601..537934Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1510915933:527795..527834TCONS_00073720-exon-scaffold_97-1510915933:527795..527834Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1510915933:527227..527395TCONS_00073720-exon-scaffold_97-1510915933:527227..527395Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1510915933:526434..526705TCONS_00073720-exon-scaffold_97-1510915933:526434..526705Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1510915933:524104..526140TCONS_00073720-exon-scaffold_97-1510915933:524104..526140Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1491911889:537601..537934TCONS_00073720-exon-scaffold_97-1491911889:537601..537934Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1491911889:527795..527834TCONS_00073720-exon-scaffold_97-1491911889:527795..527834Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1491911889:527227..527395TCONS_00073720-exon-scaffold_97-1491911889:527227..527395Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1491911889:526434..526705TCONS_00073720-exon-scaffold_97-1491911889:526434..526705Clytia hemisphaericaexon
TCONS_00073720-exon-scaffold_97-1491911889:524104..526140TCONS_00073720-exon-scaffold_97-1491911889:524104..526140Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073720-proteinTCONS_00073720-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_97supercontigscaffold_97:524104..537934 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.268745 0.183576 0.107997 0.0912452 25.044 19.251 11.1878 12.4972 5.16565 5.30464 2.87507 3.39548 6.06732 4.60321 3.23216 3.57924 4.16968 3.34004 4.82421 3.88636 3.06283 3.01726 2.96433 3.34103 3.87305 5.02518 58.0365 66.8423 1.37724 1.16035
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005817Wnt
Vocabulary: Molecular Function
TermDefinition
GO:0005102receptor binding
Vocabulary: Biological Process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: Cellular Component
TermDefinition
GO:0005576extracellular region
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007275 multicellular organism development
biological_process GO:0016055 Wnt signaling pathway
cellular_component GO:0005576 extracellular region
molecular_function GO:0005102 receptor binding
Blast
BLAST of TCONS_00073720 vs. Swiss-Prot (Human)
Match: WNT7B (Protein Wnt-7b OS=Homo sapiens GN=WNT7B PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 4.346e-38
Identity = 98/294 (33.33%), Postives = 138/294 (46.94%), Query Frame = 3
Query:  444 CQQNFKYEPWNCPKPQAVKNAKHPISFTDIYEHATKEASYIYSIVAAGVTHYVIRACQQGKDRNCQCKSKKP---KNGLGAPVVMCQSIIDHGTKRARRILKQMDFKKVSDPVRKAFNWKNAASGLQVYRQLMPRECRCSGVSGHCTATVCWEATPPSLKVPAQQLKQLYNKAVKI---KPTEIEKPFFPTKNPNRS--RPARNLVNDTKLIYITDSPSYCKXXXXXXXXXXXXRECDHTQ--DNSCNKLCSKCGYRKHSVVKKHINTKCNCKFHWCCKVTCDTCIERRLVTKC 1295
            CQ  F++  WNC              F       ++EA++ Y+I AAGV H V  AC QG   NC C  +K        G     C + + +G   +RR +   D +++    R+  N  N  +G +V    M  EC+C GVSG CT   CW  T P  +     LK+ YN AV++   + + + +P F      RS  +P      +T L+YI  SP+YC+ +   G  GT  R C+ T    + C+ +C   GY  H   K     +CNCKFHWCC V C+TC ER  V  C
Sbjct:   73 CQYQFRFGRWNCSA------LGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFV---DAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCW-TTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM-----ETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVW---QCNCKFHWCCFVKCNTCSERTEVFTC 348          
The following BLAST results are available for this feature:
BLAST of TCONS_00073720 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WNT7B4.346e-3833.33Protein Wnt-7b OS=Homo sapiens GN=WNT7B PE=2 SV=2[more]
back to top