Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073717 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073717
Unique NameTCONS_00073717
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1951

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073717 ID=TCONS_00073717|Name=TCONS_00073717|organism=Clytia hemisphaerica|type=transcript|length=1951bp
CTGCAAAATGTACACGTGGGTTCCGCTTATGACATCGGTAAAATTTGGTC
CAAGGTCCAGGAGGTCAGCCAGACTGCAGACAGAGGCAGACGCCAAATCT
ATCAAATCTATACAGACATTATCCACCACTCTCACACCCACAACTTTCTG
CAGATATGGCACCACAACAAGCACAGGCAGCACCAGAAACACCTAAAGGA
ATCAATGGAATCCTTCTTGGTCCACCAGGAGCAGGAAAAGGTACCCAGTC
TCAACggttgattgaaaaatattgcatCTGTCATTTGGCTACTGGAGATT
TATTACGAGCTGTCATTGCATCAGGATCAGATcttggaaagaaaataaag
ggtGTAATTGATGCTGGACAGCTTGTATCCGACGATCTGGTGGTTGAATT
GATTGATTCAAATCTGAAGAAACCAGAATGTAAGAATGGATTTCTTTTGG
ACGGTTTCCCAAGAACTGTACCACAAGCTGAAAAGTTGGATGATTTATTA
GAAGAGCGAGGCACACCACTTGACCGGGTCATTGAGATGAAAATTGACGA
AGAAAAACTTGTGTCAAGAATCGTTGGGAGATTATTCCACATCAAAAGCG
GTAGATCGTATCACGAAGTTTTCAATCCACCCAAAAAAACAATGACTGAT
GACATCACCGGTGAGCCATTAACAAGACGATCAGACGATAATGAAGAAGC
TCTCCGCAAACGTTTAGCATCCTTCCACAAATCTACATCACCTTTAGTCA
ACTTCTATCAAAAACGTGGAATTCATAGCGCCGTCAATGCCGACCGATCC
ATGGACGCTGTTTTCGCttctatatccgccatctttgatgaAGCACGCGA
CAAAAGATCATAATAAAGCAACGTCGCCATAACGACGATCTCATTTGTTT
GGTCTTAGGATCTGTTTTCAGCCAAACTTGTTGTTTTGATGTGTACCCCA
CAAATATTGAGTGGCCAGCGTGTAACAATTTCACTGAATTGGCGCTCTAT
CTGAAGTCCATGTCCAATCCAATGTACAGTGTGTCCCTAAAACgaggaca
aatttttatatgaagtgaaatcctcaaaactcatcATATCTGGCCTGGAA
TAATTGAATTGAAAGAATTCTCTTTCaaatcaatagatattcaattctCA
AGATAATTGAATAGGTTTTGGAgattaaaattaaataaataagtcTTAAA
ATTTCGCACAAGTTAtaaggattttactttatataaaaagttGTCCGCTT
TTTTGGGCACGCTATATACCAGAAAAAGACTGTTAACACGTTACTTGTTC
AGTTGAATTGtaaaaaaactacttttttaATTCGTTGATTGGTTGCCATT
AGTTGTCCATATTGTTCtcctttttcaaaatctttataaTTATTTCAATG
TAAGGACCAGCTTTCATAGAAACCGCCGTAAACTTTAAAGCTTTAAATCA
TTAATAGTGTACAAAATAAGATccaattttcgtgattttgctTAAGCTTA
TGCCTTTTTAAACTACATtaacatacacgctttttcttataagaacaatt
ttataagagcactagtcttaaaaattttctaagaacaattttagcctcag
atttcagaaatgatTAAGAAAGcactgattttaacagatttttaatccat
tttcagttttcaaagtaaagaaactaagcatATAAACATTGTATAAACAT
TCAAgcctgaaaatttccaaaaattaagcCCAGCTTCAGCCAAAAttcac
tggttcttataaaaactttattttgttgttttttttcctcTATCCATGGG
TTTCATTACCTTTTTTAAAGACCAACTACATTTACCATTTTCTTAGTTTA
TCAAATTTAGGGTACGATTTTTTATAGTCCGTGTTTTATATTTGTGATGA
TTAAAACGATAAAATTAGAATAGCAaataaaaaacttgaaattaaaaaat
c
Run BLAST on NCBI

protein sequence of TCONS_00073717-protein

>TCONS_00073717-protein ID=TCONS_00073717-protein|Name=TCONS_00073717-protein|organism=Clytia hemisphaerica|type=polypeptide|length=235bp
MAPQQAQAAPETPKGINGILLGPPGAGKGTQSQRLIEKYCICHLATGDLL
RAVIASGSDLGKKIKGVIDAGQLVSDDLVVELIDSNLKKPECKNGFLLDG
FPRTVPQAEKLDDLLEERGTPLDRVIEMKIDEEKLVSRIVGRLFHIKSGR
SYHEVFNPPKKTMTDDITGEPLTRRSDDNEEALRKRLASFHKSTSPLVNF
YQKRGIHSAVNADRSMDAVFASISAIFDEARDKRS
Run BLAST on NCBI

transcript from alignment at scaffold_97:385251..393597-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073717 ID=TCONS_00073717|Name=TCONS_00073717|organism=Clytia hemisphaerica|type=transcript|length=8347bp|location=Sequence derived from alignment at scaffold_97:385251..393597- (Clytia hemisphaerica)
CTGCAAAATGTACACGTGGGTTCCGCTTATGACATCGGTAAAATTTGGTC CAAGGTCCAGGAGGTCAGCCAGACTGCAGACAGAGGCAGACGCCAAATCT ATCAAATCTATACAGACATTATCCACCACTCTCACACCCACAACTTTCTG CAGATATGGCACCACAACAAGCACAGGCAGCACCAGAAACACCTAAAGGA ATCAATGGAATCCTTCTTGGTCCACCAGGAGCAGGAAAAGGTACCCAGGT AAAAAGATTTGTTTTTCAATATTTGATTGGCTGTGTGTTTTCAACCGTCA TTAGGATCTCGAAAATTCAAACTCTCAACCCAAATTCTATTCATTTTGTC ATTAGTATATAGAAGAAGAAATCTCAGCTTGAATCTTCAGGCTATGATGG CAAGCAAAGGTAAAAATTTTGAAACAAAGCTCAGAAAAGCTCAGTGTTCA AGAGTGGTTCAAATCTAAAAACTTTGCTAACTTCTAAGAACAAAAGCCGA CTACCACCTAACAGTCACCCTGGTGTGTATATGATAGAATGCGAATGTGG TAAAAGATATGTTGGCGAGACCGGGTTAAAGATATCCACATGTGTCAGCC AACACAAAAAGAACGTTGAAGATGAAAAATGGGACATTTCGGGTATAACT AACCATGCTAAAGACTGTACCCAAGGACTTAATTGGAACGAAGCTAGGCT TTTAAAGACTGAAGAGAACAAATTTGATAGAAAAGTGCGTTATTTATAAG ATGCTTTGTTGTCTTTTTAATCTTTGTGTAAACTTGCATATGTTTTGCAT ACTTTCCAACTAAATCCAACCACGGCATTTTAGTTCCTGTATTTTTGCAT ACAATTCAAGATGGCGGATGGAAAGGCGAAAAGGTCTATTGCAATAAAGA GTTACCTTATGACTTTGAATAGACGCCCGGCAGTTACATCAATATGTCAA AAACATTTTGTTCAACCACCTTCACTTCAAGATAGGGTACCATAGAATGA ACTTCCTTTTATAGGATGAACCATATTCATGTGGCTTTCAGCCTTGCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAG CACTGTTATGAAATTTAGTCTGCATGAAAGGAAGTTCTTTATTTTCACTA AAAAGTGGTATATATTTGCCAGACTTAATTTTTCTTTACTGTTTCCCATC CCTTTTTACCATAAAAAATTTAGCCCGAAATCCTTGGGGGATAGGTATTT TTAAAGGTTGGGGGGATGCCAAGAAGGGGGGGATCGTTTAAGAAGGGGGG ATCATACCCCTTTCCGCACTATGTGTAAGCAAAATGATGAAAGGTGTAAA AAAGGATGAGATATTCCAAAAATATTGATAAAAAACGGGTTGTCCGAAAG AATGTTTTAAAAACTAATGGATATTATTTTGAGGATGAAAATTACATGAG TGTATAGTAAAAAGTGTATCTTTCAGAAAATAACAAAATATTCACTGAAA GAGTGACATAGGATGAAATATTCCACTTTTTATGTCACCCAAAACCGAAA ATTGTGGAATTCTTCATCCTTTTCTACTCCTTGAATTTAAATTTGAAAAT TTATGGTATCATCAATAGATTTCCAAAGAGTTTAGATGGTAAAGCCGTTT TAAAAAATTGCTATAGTAAAAATCAGAAAATTTTGATTTTCTAGAATATT TTATCCCAAATATCTTTGAAACCTATATCATTGGAATCCTCGTGGAAAAA TACGTCATTTCTAAAAATAAGGTCCAAAAATTCCTAACATCAAAGTAGAT ATTGCGAAAAAGATGATTTTAAAGATCACTGAAAAGTCCATCAGGTACAT TCTAAAAAAACACCGACATAAACAAAATTTAACATCTTTACAAAAGTTGT CTTTTTGATTTTTCAAACATTTGTTTTGTGCGTTCCCTACCACAATCCCG TGAAGTCCGGTAACTTGCATCAGCGTAGGCAAACATGCATAGCCATCAAA TGACTGACCAATCAAAGCAAAATTTCAAAACAAATGAACTACGCAGCTCC GCTTGCAGCTCTACTCTACCATCTTTGTTTTGATTTGAGTTTGTATTTTA ATGACCAGACAGATCATTCATTTGAGGGCTATGCATGTTTGCCTCCACTG ATGCAAGTTACCCGACTTCACGGTAACTTATGTAATCGCACTTTCGGTAA GTTGGGTTAGTCATAATCCAAGATAAGAAATTAGAGGAGACTAAAAGACG GGGGAGTTAATGTACCGTGAGTTAATGTACCGTGAGTGGTCCTAAATCCA ACAGCCCTGCCTAAATCCGACCCCCCCCCCAAATAACTGCTATAAAAAAA ATTCTATATTTGTTCAAACATTCCCTCTCCAAGTTGAACAATAAATTATA TTGCAAGGACTCTCGAAACAAAATATCTATAAACAAGATGACTAAAACCA GTCAATAAATGTGATCAAAAAAGTTTGAGTTGTAAAAACAATTACCTCTT TTATTCTGAATCTGTTGCTCGTGTTTAAAAAACGTTAACAATTTTGCAGA ATTTTGTAATAAAAAATTATGTTTTGTATAAGAAGCAATTATTGTTATTT GGTTCAATTGGTTCAGTGTATCAAATCTCTCAGTTTAGTTGACACTTTGG TATCTTCATTGCGTCACAGCGAAAGGTTTGTTTCTATTTTAGTTTGAAAT TTTTTTATCTTTGAAATACCCCATCAGATTTAGACAGGGCTGTCGGATTT AGGACCACTCACGGTATGTAATATTAATTCATAATTTCTTTATCTTTATT TTTCACGAATTCTCAACTTCAGTTGAGCTAGAATCTGAGAATGTCTGTGT GTCTGTCTGTGTGTCTGTCTGTGTGTCACCAAAACTTTGGGGCAGGCTGG AGACTTCAAAATTGGTCTGATTGGGCTGAAATTTTGCACACTTGATCCAT GGGCAAATCCCTGGGGGTATTTTTTTCATTTTTTCAAAATTTTAATTTTT GAGGCCTGGGGACGAGTTTTTCGCCAAAACGAGGCTAAAACTTTGGGGCA GGCTGGAGACTTCAAAAATGGTCCGATTTGGCTGAAATTTTGCACACTTG ATCCTTGGGCAAATCCCTGGGGGTGTTTTTTTTTCATTTTTTCAAAATTT TAATTTTTGGGGTCTGGGGACAAGTTTTTCGCCAAAACGAGGCTAAAACC CAAAATACAATAATTTTTCTTAAGCCATGAAGTTTACAATTAGGTCTACG AATGATTTCAAAGATACTGAAGTTGAGCCAGTGCGGTTAGTCATAATATT GTGCATGCAATTCAAATATTTCAATTGGTTAGTTGTCATTCGAACTTCTA TTAAGTGACAAAAATTAAAGGGAACTTTGAAAAAATCTGCGAACACAATA ATTACGAAGGAGGAGTGGCTGAATTTTAGTTTATCCATGATAATTAACAA GTAATAACATGGTCGTTTGGGTAACTTTGGGAATAATAGCCTCTTGTTTC ATTGAAAACATTTCAAATAGCCCTCGCATACGTTTTTGGGGGCTAAGCTT TCTAGGGGGTGGGCTGAGTTTATGATTTAAGTTTTCAATAAAAACTTTCA GATCATTTCAAAAAAATGCCTGTTACATATATGTTAATATTATAATGCCT GTTATATAATTCATCACTGAATTACTGAAAAAAATAAGTTGCCTTCTAAG TGTCTTATTAAACTCAACTAAAGTGCTCTACCCAATGAGCTACATCTCTT TGGCAAAATAGAAACTGAAATGACAGGAATAGAACCGGCTACCTCTTCAG CTATTATTCAACACTTAGAAGATAGAAGTGTATATTAATATATCGACATT TTGTTGTTATATGCTAAAATTTTGTTAAATTTTTGTTAGCTTGTCCTTAT TGTGACATAATGTTGATCTTTGTTAATTTAAGAAAAACTTATTTAGATGA CCTTCTTTATTTTGTCTAAAAACTCTCAAGCACAATTTTCTTTTTGAGTT TTCCTTTCATGAAGGTGGGGGCGCTACATCTGGCTACATTCTTAGAATTT AGCTGGAGGCTATTTTCGTTAGCCCCCCCCCTGAAAAATACTGGGGACTG GACCCCTTTGCATACTATGCAGATTGTAAACAAAAAATCCTCTCAACTGC AAAATTAAATTCTGTGAAACTTCTGAATTTTGAGCTGTAAACCGCAAAAT TCAATTCTGTGAAAATTCCTTCCCTTAAGGTAGTATTATTCTTTGGCAGG GAAATGATTATGAGACAAGGACAAATAATAAATATATTCTGGTCACACTT GAAATCCTTCTTATCCATTTGACTTTAAAAATGGTGAAGTGAGGGAGAGT CATAGTTTTGGGCAAAAAAATTTTTGCCTAACTTTGATGAGCGACAAAAA CATTTTTCTACTTTTTACACATTTTCAACCATGAAAGGGGGAGTGTCTTT GAATTGGATTATATAATAGTCTTTGAAATATATAATACAGAAATTATTGT TTCTTTTTAGTCTCAACGGTTGATTGAAAAATATTGCATCTGTCATTTGG CTACTGGAGATTTATTACGAGCTGTCATTGCATCAGGATCAGATCTTGGA AAGAAAATAAAGGGTGTAATTGATGCTGGACAGGTATGAATTTCATTTGA TTTGTTTCGTTATATTCTCTTGACTGGGGCATTACATTCCTGTATATTTA TAAAGAGAATTTAGAAGTCAAACAAATTTCATTTTTATCCTTAGATGTGA TTCAAAGTTTCAATCAAGTAGAAAAGTTCAAAAAGTTTTATTGAAATACC AAAAAATAAATAATTCGCTTAGAACTCAACTGCTATCATCGTTTCATCAC AGATTCTATTTCTTTCAAGACTGATATCCACAATGCAACTTGTCTGGAGA TTGCGCCAACGTAAAACACAATGTAGCTATTGATTGTAGATTCGTTCTTT ATTTTCTCCGTATTACTAGCTCTTTATGCTTGTAACATTATTTGTAGCTT GTATCCGACGATCTGGTGGTTGAATTGATTGATTCAAATCTGAAGAAACC AGAATGTAAGAATGGATTTCTTTTGGACGGTTTCCCAAGAACTGTACCAC AAGCTGAAAAGGTAATGTGCTATTTTGTTTTATGTTGTAGTAGTCAATTA CTGATTACTGCTTCTGTGTATTCTTCTTTAGTTTTAAACAGAGTGTCCCA GCACTTTCTACCTTAGACAGATTGAATTTCTTTTGACCAATACCTGTAGG AAAATGAAAGAAATTAGGTGAAAATAAGGCTAATTCGCAAATTTTATTCC ACGCGAAAATAAATCCAAGTTTAGGGTATTATTTGGAAGAAAAATATGAT TTCACTCCCTCAGACTAGGATATCTTTCTTTAGGGACCATTTTTTTCGGA TAGTTTACCCATTTGTTAATATGTGTTCTCTAATGTTTTGATTTTGTGAT TTGTGTCTTTCAGTTGGATGATTTATTAGAAGAGCGAGGCACACCACTTG ACCGGGTCATTGAGATGAAAATTGACGAAGAAAAACTTGTGTCAAGAATC GTTGGGAGGTAAAGTTCAGTTGTTATTCCTTTTAACAGGGTTGTTAGGTT TTATTAAAAATCTTCATCCTTGAATCTCCTTAAAAAATTGTAAATTTGGA AAATAATTATTATTACCTCATATCTCCTGAAATTCGATTTTCAAGGGATT TTCATCCCACTAAAGTATCAATACCCTATTGTTTCATGTAACCCATCAAA GGGGGTGATGTAAAATTTTATTTTCTACCAGAACCAAATCATTCCAAAAT ATTTCTTCTTTAATTTCAGATTATTCCACATCAAAAGCGGTAGATCGTAT CACGAAGTTTTCAATCCACCCAAAAAAACAATGACTGATGACGTGGGTTG ATTTGTTTGTGATTGTCTCTTTCTGAGTGTGCTAAATTAAGTGCGTATCG TGGCTTCGCGGCTTCGTGGGTTCGTGGGTCTGCGAGTCCGCGAATCCGCG CGAGGAATTTTCAACCCACGGACCCACAAGCAATTTTGGCCCACGAATCC GCAAACATTAATCACCCACGCACTCACGTGACTTTTTTTTTACCCATGAA CCTGCGGACCCACAAAATTTGGGGACAAGCTGGAGTTTTTACAAGCTCTT ATTTGATTTGGTTGGTCGTTAAGATGTAATAAAAGAATCTCATTACTTTT TCTAAAGAACGCGTCATCTCTATCACTTTAAATGACCAATTATTGAAGTA TCTTGTAAAAACTCCAGCTCATCCCAAAATTTGACCCTCGAACCCTCGAG TAATTTAAACCCTCTCTCATCTATGTTGTTTGCCAATTGAATTATTTCGT TCAGTGTCTTGTTTGATGACCTTATTGAGTGATTTCTGCAGTCGACCTCT TTTCCTCGTCAAGTGGACAGGGTCCCAAAGAATCAATTTCGTAGCGGGTT CATTCCCTCTGATGCTTTGACACCACCCTTTTAGTACACTACTGACGTTC TCCGCGACCGGATATTTAATATCACCCTTTTAGTACACTGTACTGACTTT TCTCCATGACTGAATTTTTATTACCATTCTATCTTGAATTATCTTACAGA TCACCGGTGAGCCATTAACAAGACGATCAGACGATAATGAAGAAGCTCTC CGCAAACGTTTAGCATCCTTCCACAAATCTACATCACCTTTAGTCAACTT CTATCAAAAACGTGGAATTCATAGCGCCGTCAATGCCGACCGATCCATGG ACGCTGTTTTCGCTTCTATATCCGCCATCTTTGATGAAGCACGCGACAAA AGATCATAATAAAGCAACGTCGCCATAACGACGATCTCATTTGTTTGGTC TTAGGATCTGTTTTCAGCCAAACTTGTTGTTTTGATGTGTACCCCACAAA TATTGAGTGGCCAGCGTGTAACAATTTCACTGAATTGGCGCTCTATCTGA AGTCCATGTCCAATCCAATGTACAGTGTGTCCCTAAAACGAGGACAAATT TTTATATGAAGTGAAATCCTCAAAACTCATCATATCTGGCCTGGAATAAT TGAATTGAAAGAATTCTCTTTCAAATCAATAGATATTCAATTCTCAAGAT AATTGAATAGGTTTTGGAGATTAAAATTAAATAAATAAGTCTTAAAATTT CGCACAAGTTATAAGGATTTTACTTTATATAAAAAGTTGTCCGCTTTTTT GGGCACGCTATATACCAGAAAAAGACTGTTAACACGTTACTTGTTCAGTT GAATTGTAAAAAAACTACTTTTTTAATTCGTTGATTGGTTGCCATTAGTT GTCCATATTGTTCTCCTTTTTCAAAATCTTTATAATTATTTCAATGTAAG GACCAGCTTTCATAGAAACCGCCGTAAACTTTAAAGCTTTAAATCATTAA TAGTGTACAAAATAAGATCCAATTTTCGTGATTTTGCTTAAGCTTATGCC TTTTTAAACTACATTAACATACACGCTTTTTCTTATAAGAACAATTTTAT AAGAGCACTAGTCTTAAAAATTTTCTAAGAACAATTTTAGCCTCAGATTT CAGAAATGATTAAGAAAGCACTGATTTTAACAGATTTTTAATCCATTTTC AGTTTTCAAAGTAAAGAAACTAAGCATATAAACATTGTATAAACATTCAA GCCTGAAAATTTCCAAAAATTAAGCCCAGCTTCAGCCAAAATTCACTGGT TCTTATAAAAACTTTATTTTGTTGTTTTTTTTCCTCTATCCATGGGTTTC ATTACCTTTTTTAAAGACCAACTACATTTACCATTTTCTTAGTTTATCAA ATTTAGGGTACGATTTTTTATAGTCCGTGTTTTATATTTGTGATGATTAA AACGATAAAATTAGAATAGCAAATAAAAAACTTGAAATTAAAAAATC

Coding sequence (CDS) from alignment at scaffold_97:385251..393597-

>TCONS_00073717 ID=TCONS_00073717|Name=TCONS_00073717|organism=Clytia hemisphaerica|type=CDS|length=4248bp|location=Sequence derived from alignment at scaffold_97:385251..393597- (Clytia hemisphaerica)
ATCACCGGTGAGCCATTAACAAGACGATCAGACGATAATGAAGAAGCTCT
CCGCAAACGTTTAGCATCCTTCCACAAATCTACATCACCTTTAGTCAACT
TCTATCAAAAACGTGGAATTCATAGCGCCGTCAATGCCGACCGATCCATG
GACGCTGTTTTCGCTTCTATATCCGCCATCTTTGATGAAGCACGCGACAA
AAGATCATAAATTATTCCACATCAAAAGCGGTAGATCGTATCACGAAGTT
TTCAATCCACCCAAAAAAACAATGACTGATGACTTGGATGATTTATTAGA
AGAGCGAGGCACACCACTTGACCGGGTCATTGAGATGAAAATTGACGAAG
AAAAACTTGTGTCAAGAATCGTTGGGAGCTTGTATCCGACGATCTGGTGG
TTGAATTGATTGATTCAAATCTGAAGAAACCAGAATGTAAGAATGGATTT
CTTTTGGACGGTTTCCCAAGAACTGTACCACAAGCTGAAAAGTCTCAACG
GTTGATTGAAAAATATTGCATCTGTCATTTGGCTACTGGAGATTTATTAC
GAGCTGTCATTGCATCAGGATCAGATCTTGGAAAGAAAATAAAGGGTGTA
ATTGATGCTGGACAGATGGCACCACAACAAGCACAGGCAGCACCAGAAAC
ACCTAAAGGAATCAATGGAATCCTTCTTGGTCCACCAGGAGCAGGAAAAG
GTACCCAGATCACCGGTGAGCCATTAACAAGACGATCAGACGATAATGAA
GAAGCTCTCCGCAAACGTTTAGCATCCTTCCACAAATCTACATCACCTTT
AGTCAACTTCTATCAAAAACGTGGAATTCATAGCGCCGTCAATGCCGACC
GATCCATGGACGCTGTTTTCGCTTCTATATCCGCCATCTTTGATGAAGCA
CGCGACAAAAGATCATAAATTATTCCACATCAAAAGCGGTAGATCGTATC
ACGAAGTTTTCAATCCACCCAAAAAAACAATGACTGATGACTTGGATGAT
TTATTAGAAGAGCGAGGCACACCACTTGACCGGGTCATTGAGATGAAAAT
TGACGAAGAAAAACTTGTGTCAAGAATCGTTGGGAGCTTGTATCCGACGA
TCTGGTGGTTGAATTGATTGATTCAAATCTGAAGAAACCAGAATGTAAGA
ATGGATTTCTTTTGGACGGTTTCCCAAGAACTGTACCACAAGCTGAAAAG
TCTCAACGGTTGATTGAAAAATATTGCATCTGTCATTTGGCTACTGGAGA
TTTATTACGAGCTGTCATTGCATCAGGATCAGATCTTGGAAAGAAAATAA
AGGGTGTAATTGATGCTGGACAGATGGCACCACAACAAGCACAGGCAGCA
CCAGAAACACCTAAAGGAATCAATGGAATCCTTCTTGGTCCACCAGGAGC
AGGAAAAGGTACCCAGATCACCGGTGAGCCATTAACAAGACGATCAGACG
ATAATGAAGAAGCTCTCCGCAAACGTTTAGCATCCTTCCACAAATCTACA
TCACCTTTAGTCAACTTCTATCAAAAACGTGGAATTCATAGCGCCGTCAA
TGCCGACCGATCCATGGACGCTGTTTTCGCTTCTATATCCGCCATCTTTG
ATGAAGCACGCGACAAAAGATCATAAATTATTCCACATCAAAAGCGGTAG
ATCGTATCACGAAGTTTTCAATCCACCCAAAAAAACAATGACTGATGACT
TGGATGATTTATTAGAAGAGCGAGGCACACCACTTGACCGGGTCATTGAG
ATGAAAATTGACGAAGAAAAACTTGTGTCAAGAATCGTTGGGAGCTTGTA
TCCGACGATCTGGTGGTTGAATTGATTGATTCAAATCTGAAGAAACCAGA
ATGTAAGAATGGATTTCTTTTGGACGGTTTCCCAAGAACTGTACCACAAG
CTGAAAAGTCTCAACGGTTGATTGAAAAATATTGCATCTGTCATTTGGCT
ACTGGAGATTTATTACGAGCTGTCATTGCATCAGGATCAGATCTTGGAAA
GAAAATAAAGGGTGTAATTGATGCTGGACAGATGGCACCACAACAAGCAC
AGGCAGCACCAGAAACACCTAAAGGAATCAATGGAATCCTTCTTGGTCCA
CCAGGAGCAGGAAAAGGTACCCAGATCACCGGTGAGCCATTAACAAGACG
ATCAGACGATAATGAAGAAGCTCTCCGCAAACGTTTAGCATCCTTCCACA
AATCTACATCACCTTTAGTCAACTTCTATCAAAAACGTGGAATTCATAGC
GCCGTCAATGCCGACCGATCCATGGACGCTGTTTTCGCTTCTATATCCGC
CATCTTTGATGAAGCACGCGACAAAAGATCATAAATTATTCCACATCAAA
AGCGGTAGATCGTATCACGAAGTTTTCAATCCACCCAAAAAAACAATGAC
TGATGACTTGGATGATTTATTAGAAGAGCGAGGCACACCACTTGACCGGG
TCATTGAGATGAAAATTGACGAAGAAAAACTTGTGTCAAGAATCGTTGGG
AGCTTGTATCCGACGATCTGGTGGTTGAATTGATTGATTCAAATCTGAAG
AAACCAGAATGTAAGAATGGATTTCTTTTGGACGGTTTCCCAAGAACTGT
ACCACAAGCTGAAAAGTCTCAACGGTTGATTGAAAAATATTGCATCTGTC
ATTTGGCTACTGGAGATTTATTACGAGCTGTCATTGCATCAGGATCAGAT
CTTGGAAAGAAAATAAAGGGTGTAATTGATGCTGGACAGATGGCACCACA
ACAAGCACAGGCAGCACCAGAAACACCTAAAGGAATCAATGGAATCCTTC
TTGGTCCACCAGGAGCAGGAAAAGGTACCCAGATCACCGGTGAGCCATTA
ACAAGACGATCAGACGATAATGAAGAAGCTCTCCGCAAACGTTTAGCATC
CTTCCACAAATCTACATCACCTTTAGTCAACTTCTATCAAAAACGTGGAA
TTCATAGCGCCGTCAATGCCGACCGATCCATGGACGCTGTTTTCGCTTCT
ATATCCGCCATCTTTGATGAAGCACGCGACAAAAGATCATAAATTATTCC
ACATCAAAAGCGGTAGATCGTATCACGAAGTTTTCAATCCACCCAAAAAA
ACAATGACTGATGACTTGGATGATTTATTAGAAGAGCGAGGCACACCACT
TGACCGGGTCATTGAGATGAAAATTGACGAAGAAAAACTTGTGTCAAGAA
TCGTTGGGAGCTTGTATCCGACGATCTGGTGGTTGAATTGATTGATTCAA
ATCTGAAGAAACCAGAATGTAAGAATGGATTTCTTTTGGACGGTTTCCCA
AGAACTGTACCACAAGCTGAAAAGTCTCAACGGTTGATTGAAAAATATTG
CATCTGTCATTTGGCTACTGGAGATTTATTACGAGCTGTCATTGCATCAG
GATCAGATCTTGGAAAGAAAATAAAGGGTGTAATTGATGCTGGACAGATG
GCACCACAACAAGCACAGGCAGCACCAGAAACACCTAAAGGAATCAATGG
AATCCTTCTTGGTCCACCAGGAGCAGGAAAAGGTACCCAGATCACCGGTG
AGCCATTAACAAGACGATCAGACGATAATGAAGAAGCTCTCCGCAAACGT
TTAGCATCCTTCCACAAATCTACATCACCTTTAGTCAACTTCTATCAAAA
ACGTGGAATTCATAGCGCCGTCAATGCCGACCGATCCATGGACGCTGTTT
TCGCTTCTATATCCGCCATCTTTGATGAAGCACGCGACAAAAGATCATAA
ATTATTCCACATCAAAAGCGGTAGATCGTATCACGAAGTTTTCAATCCAC
CCAAAAAAACAATGACTGATGACTTGGATGATTTATTAGAAGAGCGAGGC
ACACCACTTGACCGGGTCATTGAGATGAAAATTGACGAAGAAAAACTTGT
GTCAAGAATCGTTGGGAGCTTGTATCCGACGATCTGGTGGTTGAATTGAT
TGATTCAAATCTGAAGAAACCAGAATGTAAGAATGGATTTCTTTTGGACG
GTTTCCCAAGAACTGTACCACAAGCTGAAAAGTCTCAACGGTTGATTGAA
AAATATTGCATCTGTCATTTGGCTACTGGAGATTTATTACGAGCTGTCAT
TGCATCAGGATCAGATCTTGGAAAGAAAATAAAGGGTGTAATTGATGCTG
GACAGATGGCACCACAACAAGCACAGGCAGCACCAGAAACACCTAAAGGA
ATCAATGGAATCCTTCTTGGTCCACCAGGAGCAGGAAAAGGTACCCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045773XLOC_045773Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073717-proteinTCONS_00073717-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073717-exon-scaffold_97-1575043694:393350..393597TCONS_00073717-exon-scaffold_97-1575043694:393350..393597Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1575043694:388515..388637TCONS_00073717-exon-scaffold_97-1575043694:388515..388637Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1575043694:388037..388150TCONS_00073717-exon-scaffold_97-1575043694:388037..388150Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1575043694:387590..387684TCONS_00073717-exon-scaffold_97-1575043694:387590..387684Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1575043694:387256..387328TCONS_00073717-exon-scaffold_97-1575043694:387256..387328Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1575043694:385251..386548TCONS_00073717-exon-scaffold_97-1575043694:385251..386548Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:393350..393597TCONS_00073717-exon-scaffold_97-1510915933:393350..393597Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:388515..388637TCONS_00073717-exon-scaffold_97-1510915933:388515..388637Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:388037..388150TCONS_00073717-exon-scaffold_97-1510915933:388037..388150Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:387590..387684TCONS_00073717-exon-scaffold_97-1510915933:387590..387684Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:387256..387328TCONS_00073717-exon-scaffold_97-1510915933:387256..387328Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1510915933:385251..386548TCONS_00073717-exon-scaffold_97-1510915933:385251..386548Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:393350..393597TCONS_00073717-exon-scaffold_97-1491911889:393350..393597Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:388515..388637TCONS_00073717-exon-scaffold_97-1491911889:388515..388637Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:388037..388150TCONS_00073717-exon-scaffold_97-1491911889:388037..388150Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:387590..387684TCONS_00073717-exon-scaffold_97-1491911889:387590..387684Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:387256..387328TCONS_00073717-exon-scaffold_97-1491911889:387256..387328Clytia hemisphaericaexon
TCONS_00073717-exon-scaffold_97-1491911889:385251..386548TCONS_00073717-exon-scaffold_97-1491911889:385251..386548Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_97supercontigscaffold_97:385251..393597 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
113.358 110.82 205.022 217.39 24.0317 17.8399 53.4936 56.9682 66.0398 68.8974 73.3111 66.2316 72.614 80.207 83.415 87.7672 98.9641 94.9318 33.2755 36.5874 58.837 62.1515 69.8906 74.1981 63.6524 71.991 71.9094 76.9522 33.8394 37.1255
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000850Adenylat/UMP-CMP_kin
IPR006259Adenyl_kin_sub
IPR007862Adenylate_kinase_lid-dom
IPR033690Adenylat_kinase_CS
IPR028587AK2
IPR027417P-loop_NTPase
Vocabulary: Biological Process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0006172ADP biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0019205nucleobase-containing compound kinase activity
GO:0005524ATP binding
GO:0004017adenylate kinase activity
GO:0016776phosphotransferase activity, phosphate group as acceptor
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006172 ADP biosynthetic process
biological_process GO:0006139 nucleobase-containing compound metabolic process
molecular_function GO:0004017 adenylate kinase activity
molecular_function GO:0005524 ATP binding
molecular_function GO:0019205 nucleobase-containing compound kinase activity
molecular_function GO:0016776 phosphotransferase activity, phosphate group as acceptor
Blast
BLAST of TCONS_00073717 vs. Swiss-Prot (Human)
Match: KAD2 (Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 2.467e-101
Identity = 147/223 (65.92%), Postives = 180/223 (80.72%), Query Frame = 3
Query:  186 ETPKGINGILLGPPGAGKGTQSQRLIEKYCICHLATGDLLRAVIASGSDLGKKIKGVIDAGQLVSDDLVVELIDSNLKKPECKNGFLLDGFPRTVPQAEKLDDLLEERGTPLDRVIEMKIDEEKLVSRIVGRLFHIKSGRSYHEVFNPPKKTMTDDITGEPLTRRSDDNEEALRKRLASFHKSTSPLVNFYQKRGIHSAVNADRSMDAVFASISAIFDEARDK 854
            E PKGI  +LLGPPGAGKGTQ+ RL E +C+CHLATGD+LRA++ASGS+LGKK+K  +DAG+LVSD++VVELI+ NL+ P CKNGFLLDGFPRTV QAE LDDL+E+R   LD VIE  I +  L+ RI GRL H KSGRSYHE FNPPK+ M DDITGEPL RRSDDNE+AL+ RL ++H  T+PL+ +Y+KRGIHSA++A ++ D VFASI A F +A  K
Sbjct:   11 EYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCK 233          
The following BLAST results are available for this feature:
BLAST of TCONS_00073717 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KAD22.467e-10165.92Adenylate kinase 2, mitochondrial OS=Homo sapiens ... [more]
back to top