Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073619 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073619
Unique NameTCONS_00073619
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1613

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073619 ID=TCONS_00073619|Name=TCONS_00073619|organism=Clytia hemisphaerica|type=transcript|length=1613bp
NNGATGCTATCTTAATGGGTGGAgctaaaatcactaaaaaagGAGCACCA
AATTCACCAAAAGGGCAACAAAATTACTACAATACACAAGGAGCCAGTCA
CATGCCACCGCAACAACAACAAATGCCACCACACCGAAAGAGAAGTAGTT
CCAATCATCTCCAAGTGAGAAGAGAAGAAGAAGAGGAGGATGTTGAAGTT
TTCGACTCGTTTTTGGACACCAAAATGAACGGTAGTTACGTTATCGCTGG
TGATTTTAATGGAACTTGTTTTAGTGATCCAGACTTGTGTAAGTTGAACG
GGATGACCATATACACTTGGTTGAAGATTGATGCAAAAGAATTGGAGAGT
ACAGAAAATGCTTTAGGACGAGATGCTTACATATTGAGCACTGGTGGACA
ATCTAAGAAATCGCGAGGTTTCGCTTTCCTATGGTTTCACGGTAAATTTG
TCATGGTTATCAGTACCGaaacaaaacaatggaaattaGAAATACCgaaa
gataaaataaaacacGATGAGTGGGTCCagctttcttttgtttggaataC
AGACACGTTAACTGGTTATCAAGATGGAACCAAAATAGGTAGTACCAAGG
GCGTGGCCGCTGAACGTCCGGAAGTCCAGTTCACTATTATGACTATCGGA
CGTCCGAATAATGCAGTCGATGCACGCTTCATGATGAAAATGGAAATGGC
TTATTTGACGTTATGGGATAAAGCATTGGAAGAAAAAGAACTCGATAAAT
CATATGAAAATAtaAAACAAAAGATCGATAAGACGAGGAGACGTagtatt
ttagaaaaacattctACCATAAAACAGCACGCATTGGTGAACAGGGAAAT
GCAAAACTAAACAGGTGAATTAACTTGTCAGAGATACTGAATCACCATAC
AAGAAGCTCTCCGAGAAACATGTTATAAAATAAGACGACGGTGTGATTGA
TGTAGAAACTTAAGAACTTTTGCGTCTTCGTGTGTAAAATACAGACCAAT
TCGCTTCGTATGCAAATGACTCTACGAGGAAAATCTCGATAGGCTTGACG
TATGGCTGTCATATCATTCGAACTAAATAAAGTGTTATGGAAATTTTGTA
ACAAAAATCATTGATAATCAACCGTCAGTTTGAAACTCCTGTAATGTTTT
ACTACTGACCAAAATAATAATCCTTTCCCAAGAATTTATTTTGGTGGgct
aaaaatttgatttgatttgatttgattaagGAGCTCCCGTTTTAGAATTA
CGAGAAAATGTTACAGAGCGTTACCTGACCTCTACTACAATCAGTgcaat
aatatattggcaccaGCCTCAAAAAAAACACTGGATTTACTCACTTCCCT
AGCTCCTAAATCCCCTCCCCCCTAATTTCAATGGTTGAAGAAGGCAACAG
GGCAGCAGACTCAACCATCAAAGCTTAGAGGGAGGGAAAATAAGTTTTAA
CATAAATTATATTATTGCAGTGATTGTAGCTGAAAagacttttttgcttt
tttgaaatcttgaattATTTCTAGTAAttataattatattttttaaatgc
ttgtaaataaattaaaagaaaattaaaggaTTTAAAAGATTTCATGTTGA
ATCAGTTTAATGA
Run BLAST on NCBI

protein sequence of TCONS_00073619-protein

>TCONS_00073619-protein ID=TCONS_00073619-protein|Name=TCONS_00073619-protein|organism=Clytia hemisphaerica|type=polypeptide|length=285bp
DAILMGGAKITKKGAPNSPKGQQNYYNTQGASHMPPQQQQMPPHRKRSSS
NHLQVRREEEEEDVEVFDSFLDTKMNGSYVIAGDFNGTCFSDPDLCKLNG
MTIYTWLKIDAKELESTENALGRDAYILSTGGQSKKSRGFAFLWFHGKFV
MVISTETKQWKLEIPKDKIKHDEWVQLSFVWNTDTLTGYQDGTKIGSTKG
VAAERPEVQFTIMTIGRPNNAVDARFMMKMEMAYLTLWDKALEEKELDKS
YENIKQKIDKTRRRSILEKHSTIKQHALVNREMQN
Run BLAST on NCBI

transcript from alignment at scaffold_96:111147..117565+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073619 ID=TCONS_00073619|Name=TCONS_00073619|organism=Clytia hemisphaerica|type=transcript|length=6419bp|location=Sequence derived from alignment at scaffold_96:111147..117565+ (Clytia hemisphaerica)
NNGATGCTATCTTAATGGGTGGAgctaaaatcactaaaaaaggtTAGTAG TTATAAATCTAGTACAAACCTTATTCCCATAGCGAATCTTCGTATTTTCC GCCGGATGGTGTTGGACCCACAGATTTTTAATGCCCGAAGGgatagatgt cgtgctttaagccatcgcaggcaaaaaaaaagaaaatatcgcaagaaata tagtttctattgtttttgaaaatccgcgaagcttctgattggttaagcgc tgaaattctataaTAATGTCATATTACCTAttacctaggtaggatttcct acctaaccgcggcacacttttcagcaaaagcacgacatataacccttcgg gctttacaaatcTGTGGGACccaatgaaaacaatcaaaggGTTGTCTAAA GGTCCCATATTATACCCTTCAATGCATGTGAAATACAAATAAATACACAA GGGCCTCCTCTTCTACACTCTTCAACCACTTAAACACTCCTGCGTCAAAG ACCCGGCCCCGACCCCGGCCCCCGCCCCACTTGTAAATTCACCCAAGATT TCGTCtttggtggaaaaaaatatcctacaatttcagacccaatggTAATT TGACGTTGATTTCATCCTCACTTGAAATTTAATGTAAATATTGCACTTCA AAAGATCCCATTAGGGATTCTTTagctgggaacaatagaatttcgatAAA AATACTGAAGAAAAATCACCTTAAGACAATCCAAAAGAGAATATCCTTCA AGAATCCAAAACTCTTTATaacaatatcatcttttttccATCAAAGGAGC ACCAAATTCACCAAAAGGGCAACAAAATTACTACAATACACAAGGAGCCA GTCACATGCCACCGCAACAACAACAAATGCCACCACACCGAAAGAGAAGT AGTTCCAATCATCTCCAAGTGAGAAGAGAAGAAGAAGAGGAGGATGTTGA AGTTTTCGACTCGTTTTTGGACACCAAAATGAACGGTAGTTACGTTATCG CTGGTGATTTTAATGGTAAGAAACAAACACCATTTATCATGATATTAGAC Accgtaccagtggataccccttaaaaccacataccccttaaaacccacaa tgttgcatttttggctttcataactaccagatttaattttatgtggtaTG TTTCACTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNttttctacaaaacatcactgc tagggaagacaatcatagacaacgtactttcaacacaaaaagtttcagcc ttacactccaactaaacaatgagatagagggttccactttttattgtggg ttttaaggggtatccactggtacttAAGAATTCATAAAAATGAAAGCGAG TTCGGAAAAAGACTTGATACCAGTAGCGTGGCGGCTCGACAAAATTTTAA GCAAACTGAGAAGGcaattttagaaatttgggaTCTTGCCGTCTCCTATT AAACGTAAAATATCCAGAATAAGACCAGAATAGGATTCCAGGCTAATTTT AATAATCTTTTTCAAAGTATGCCCATCATGTGTCACCTATAAAACAAAGT AAACATTTTTTGGTACGTTTTCCTCGACAGGAACTTGTTTTAGTGATCCA GACTTGTGTAAGTTGAACGGGATGACCATATACACTTGGTTGAAGATTGA TGCAAAAGAATTGGAGAGTACACAAAATGCTTTAGGACGAGATGCTTACA TATTGAGCACTGGTGGACAATCTAAGAAATCACGAGGTTGGTTTACATTC AAATATTGCAcgtaaggcgaaaataaaaaaatatagtgtttccggaatgc agGTAAAGGAAAAAGGCTCTCACGCGGCcggccgaaaaattttttttttg ctatttttgataacttaagatcattgaaatagagctttaaaaataacttt tatttacaaacagtatgaagtaagccctggaATACTAATGCATCAACTaa taacgaacaaaacttgatttacaagcgagaatatctaaccaaacaaCGTT TGATAGCTTGGACGGTCAACTTGATTTCNCGCTGGTGATTTTAATGGTAA GAAACAAACACCATTTATCATGATATTAGACTTAGAATTCATAAAAATGA AAGCGAGTTCGGAAAAAGACTTGATACCAGTCGAGCGTGGCGGCTCGACC AAAATTTAAGCAAACTGGGAAGACAATTTTAGGATTTTGGGATCTTTCCG TCCCCTATTAAACGTAAGATATCCAGAATATGACCAGAATAGGATTCCAA GCTAATTTTAATAATCTTCTTCAAAGTATTTTGGTACGTTTTCCTCGACA GGAACTTGTTTTAGTGATCCAGACTTGTGTAAGTTGAACGGGATGACCAT ATACACTTGGTTGAAGATTGATGCAAAAGAATTGGAGAGTACAGAAAATG CTTTAGGACGAGATGCTTACATATTGAGCACTGGTGGACAATCTAAGAAA TCGCGAGGTTGGTTTACATTCAAATATTGCAcgtaaggcgaaaataaaaa aatatagtgtttccggaatgcaggtgaaggaaaaaagctatttttgataa cttaagatcattgaaatagaactttaaagataacatttatttacaaacag tatgaagtaagccctgaatactaatgcaTCAACTaataacgaacaaaact tgatttacaagcgagaatatctaaccaaacgacgtttgatagctttaacg gtcaacttgattttctttttttcacccggccgctttccggaaacactaca tttttttattttcgccttacgGATAATTAATTTGGATTGATTTTGTATCA CGTGATCAGAAGTAATTAGGATAATTCGAAGTTCATTCGGACAACCTAGA GTTAGATATTTCTCGCCTTGTGCACAATCTCGGTTCGAGCTTGAGAATTC CTACGAGCTCTACAATTTAATTTACACAATTTTTCTATTTCAGGTTTCGC TTTCCTATGGTTTCACGGTAAATTTGTCATGGTTATCAGTACCGaaacaa aacaatggaaattaGAAATACCgaaagataaaataaaacacGATGAGTGG GTCCagctttcttttgtttggaataCAGACACGTTAACTGGTTATCAAGA TGGAACCAAAATAGGTAGTACCAAGGGCGTGGCCGCTGAACGTCCGGAAG TCCAGTTCACTATTATGACTATCGGACGTCCGAATAATGCAGTCGATGCA CGCTTCATGATGAAAATGGAAATGGCTTATTTGACGTTATGGGATAAAGC ATTGGAAGAAAAAGAACTCGATAAATCATATGAAAATAGTAAGTATTATT TGTACTCATTGCGTAGCACAACCCTGTAGTGCTAATGTGCCTAGAAAAAT GTTAACTCTGATCATTTACTGATTAAACCAGAAAGTTTTTACCTTGATTT AATAACTTCAAACTTATGGTAAAATGaataattttatggattttaaactg aataaaaatgttcCACTTTAACAGGGTCGATAGTGAATGAAGAATTTTAG aatttaggcaaaaataaaaaaatgcagtgtttccggaatgcggctGAAGG AAAAAGGCTCTCATGCAGCCGGTCGGCAAAAGcttttttttgctaatttt gataacttaagatcattgcaatagaactttaaagatgacttttatgtaca aacaatATGAAATAAGCCCTGAATACAgctgtatcaactactaacgaaca aaacttggtttacaagcgggaatatctaaccaaacaaCGTTTGATAGCTT GGACGGTCAACTTGATTTCCTTTATGAAaaaccatatagatgaacccata gtctgcggccgggtgagaaaatactttttgttcacccggccggtttccgg aaacactatttttttattttagccctattttctatgttttataAGGGAAA ATTGACTGAAATTACTAAATTagatttttaattacttttcaACAAATCAT TGTTAACTTCGTTCACAGACCTGACATTcgataaaaaaaatctaaattcc attttttattttttatagtaAAACAAAAGATCGATAAGACGAGGAGACGT agtattttagaaaaacattctACCATAAAACAGCACGCATTGGTGAACAG GGAAATGCAAAACTAAACAGGTGAATTAACTTGTCAGAGATACTGAATCA CCATACAAGAAGCTCTCCGAGAAACATGTTATAAAATAAGACGACGGTGT GATTGATGTAGAAACTTAAGAACTTTTGCGTCTTCGTGTGTAAAATACAG ACCAATTCGCTTCGTATGCAAATGACTCTACGAGGAAAATCTCGATAGGC TTGACGTATGGCTGTCATATCATTCGAACTAAATAAAGTGTTATGGAAAT TTTGTAACAAAAATCATTGATAATCAACCGTCAGTTTGAAACTCCTGTAA TGTTTTACTACTGACCAAAATAATAATCCTTTCCCAAGAATTTATTTTGG TGGgctaaaaatttgatttgatttgatttgattaagGAGCTCCCGTTTTA GAATTACGAGAAAATGTTACAGAGCGTTACCTGACCTCTACTACAATCAG TgcaataatatattggcaccaGCCTCAAAAAAAACACTGGATTTACTCAC TTCCCTAGCTCCTAAATCCCCTCCCCCCTAATTTCAATGGTTGAAGAAGG CAACAGGGCAGCAGACTCAACCATCAAAGCTTAGAGGGAGGGAAAATAAG TTTTAACATAAATTATATTATTGCAGTGATTGTAGCTGAAAagacttttt tgcttttttgaaatcttgaattATTTCTAGTAAttataattatatttttt aaatgcttgtaaataaattaaaagaaaattaaaggaTTTAAAAGATTTCA TGTTGAATCAGTTTAATGA

Coding sequence (CDS) from alignment at scaffold_96:111147..117565+

>TCONS_00073619 ID=TCONS_00073619|Name=TCONS_00073619|organism=Clytia hemisphaerica|type=CDS|length=4290bp|location=Sequence derived from alignment at scaffold_96:111147..117565+ (Clytia hemisphaerica)
GATGCTATCTTAATGGGTGGAgctaaaatcactaaaaaagGAGCACCAAA
TTCACCAAAAGGGCAACAAAATTACTACAATACACAAGGAGCCAGTCACA
TGCCACCGCAACAACAACAAATGCCACCACACCGAAAGAGAAGTAGTTCC
AATCATCTCCAAGTGAGAAGAGAAGAAGAAGAGGAGGATGTTGAAGTTTT
CGACTCGTTTTTGGACACCAAAATGAACGGTAGTTACGTTATCGCTGGTG
ATTTTAATGGAACTTGTTTTAGTGATCCAGACTTGTGTAAGTTGAACGGG
ATGACCATATACACTTGGTTGAAGATTGATGCAAAAGAATTGGAGAGTAC
AGAAAATGCTTTAGGACGAGATGCTTACATATTGAGCACTGGTGGACAAT
CTAAGAAATCGCGAGGTTTCGCTTTCCTATGGTTTCACGGTAAATTTGTC
ATGGTTATCAGTACCGaaacaaaacaatggaaattaGAAATACCgaaaga
taaaataaaacacGATGAGTGGGTCCagctttcttttgtttggaataCAG
ACACGTTAACTGGTTATCAAGATGGAACCAAAATAGGTAGTACCAAGGGC
GTGGCCGCTGAACGTCCGGAAGTCCAGTTCACTATTATGACTATCGGACG
TCCGAATAATGCAGTCGATGCACGCTTCATGATGAAAATGGAAATGGCTT
ATTTGACGTTATGGGATAAAGCATTGGAAGAAAAAGAACTCGATAAATCA
TATGAAAATAtaAAACAAAAGATCGATAAGACGAGGAGACGTagtatttt
agaaaaacattctACCATAAAACAGCACGCATTGGTGAACAGGGAAATGC
AAAACTAAGATGCTATCTTAATGGGTGGAgctaaaatcactaaaaaagGA
GCACCAAATTCACCAAAAGGGCAACAAAATTACTACAATACACAAGGAGC
CAGTCACATGCCACCGCAACAACAACAAATGCCACCACACCGAAAGAGAA
GTAGTTCCAATCATCTCCAAGTGAGAAGAGAAGAAGAAGAGGAGGATGTT
GAAGTTTTCGACTCGTTTTTGGACACCAAAATGAACGGTAGTTACGTTAT
CGCTGGTGATTTTAATGGAACTTGTTTTAGTGATCCAGACTTGTGTAAGT
TGAACGGGATGACCATATACACTTGGTTGAAGATTGATGCAAAAGAATTG
GAGAGTACAGAAAATGCTTTAGGACGAGATGCTTACATATTGAGCACTGG
TGGACAATCTAAGAAATCGCGAGGTTTCGCTTTCCTATGGTTTCACGGTA
AATTTGTCATGGTTATCAGTACCGaaacaaaacaatggaaattaGAAATA
CCgaaagataaaataaaacacGATGAGTGGGTCCagctttcttttgtttg
gaataCAGACACGTTAACTGGTTATCAAGATGGAACCAAAATAGGTAGTA
CCAAGGGCGTGGCCGCTGAACGTCCGGAAGTCCAGTTCACTATTATGACT
ATCGGACGTCCGAATAATGCAGTCGATGCACGCTTCATGATGAAAATGGA
AATGGCTTATTTGACGTTATGGGATAAAGCATTGGAAGAAAAAGAACTCG
ATAAATCATATGAAAATAtaAAACAAAAGATCGATAAGACGAGGAGACGT
agtattttagaaaaacattctACCATAAAACAGCACGCATTGGTGAACAG
GGAAATGCAAAACTAAGATGCTATCTTAATGGGTGGAgctaaaatcacta
aaaaagGAGCACCAAATTCACCAAAAGGGCAACAAAATTACTACAATACA
CAAGGAGCCAGTCACATGCCACCGCAACAACAACAAATGCCACCACACCG
AAAGAGAAGTAGTTCCAATCATCTCCAAGTGAGAAGAGAAGAAGAAGAGG
AGGATGTTGAAGTTTTCGACTCGTTTTTGGACACCAAAATGAACGGTAGT
TACGTTATCGCTGGTGATTTTAATGGAACTTGTTTTAGTGATCCAGACTT
GTGTAAGTTGAACGGGATGACCATATACACTTGGTTGAAGATTGATGCAA
AAGAATTGGAGAGTACAGAAAATGCTTTAGGACGAGATGCTTACATATTG
AGCACTGGTGGACAATCTAAGAAATCGCGAGGTTTCGCTTTCCTATGGTT
TCACGGTAAATTTGTCATGGTTATCAGTACCGaaacaaaacaatggaaat
taGAAATACCgaaagataaaataaaacacGATGAGTGGGTCCagctttct
tttgtttggaataCAGACACGTTAACTGGTTATCAAGATGGAACCAAAAT
AGGTAGTACCAAGGGCGTGGCCGCTGAACGTCCGGAAGTCCAGTTCACTA
TTATGACTATCGGACGTCCGAATAATGCAGTCGATGCACGCTTCATGATG
AAAATGGAAATGGCTTATTTGACGTTATGGGATAAAGCATTGGAAGAAAA
AGAACTCGATAAATCATATGAAAATAtaAAACAAAAGATCGATAAGACGA
GGAGACGTagtattttagaaaaacattctACCATAAAACAGCACGCATTG
GTGAACAGGGAAATGCAAAACTAAGATGCTATCTTAATGGGTGGAgctaa
aatcactaaaaaagGAGCACCAAATTCACCAAAAGGGCAACAAAATTACT
ACAATACACAAGGAGCCAGTCACATGCCACCGCAACAACAACAAATGCCA
CCACACCGAAAGAGAAGTAGTTCCAATCATCTCCAAGTGAGAAGAGAAGA
AGAAGAGGAGGATGTTGAAGTTTTCGACTCGTTTTTGGACACCAAAATGA
ACGGTAGTTACGTTATCGCTGGTGATTTTAATGGAACTTGTTTTAGTGAT
CCAGACTTGTGTAAGTTGAACGGGATGACCATATACACTTGGTTGAAGAT
TGATGCAAAAGAATTGGAGAGTACAGAAAATGCTTTAGGACGAGATGCTT
ACATATTGAGCACTGGTGGACAATCTAAGAAATCGCGAGGTTTCGCTTTC
CTATGGTTTCACGGTAAATTTGTCATGGTTATCAGTACCGaaacaaaaca
atggaaattaGAAATACCgaaagataaaataaaacacGATGAGTGGGTCC
agctttcttttgtttggaataCAGACACGTTAACTGGTTATCAAGATGGA
ACCAAAATAGGTAGTACCAAGGGCGTGGCCGCTGAACGTCCGGAAGTCCA
GTTCACTATTATGACTATCGGACGTCCGAATAATGCAGTCGATGCACGCT
TCATGATGAAAATGGAAATGGCTTATTTGACGTTATGGGATAAAGCATTG
GAAGAAAAAGAACTCGATAAATCATATGAAAATAtaAAACAAAAGATCGA
TAAGACGAGGAGACGTagtattttagaaaaacattctACCATAAAACAGC
ACGCATTGGTGAACAGGGAAATGCAAAACTAAGATGCTATCTTAATGGGT
GGAgctaaaatcactaaaaaagGAGCACCAAATTCACCAAAAGGGCAACA
AAATTACTACAATACACAAGGAGCCAGTCACATGCCACCGCAACAACAAC
AAATGCCACCACACCGAAAGAGAAGTAGTTCCAATCATCTCCAAGTGAGA
AGAGAAGAAGAAGAGGAGGATGTTGAAGTTTTCGACTCGTTTTTGGACAC
CAAAATGAACGGTAGTTACGTTATCGCTGGTGATTTTAATGGAACTTGTT
TTAGTGATCCAGACTTGTGTAAGTTGAACGGGATGACCATATACACTTGG
TTGAAGATTGATGCAAAAGAATTGGAGAGTACAGAAAATGCTTTAGGACG
AGATGCTTACATATTGAGCACTGGTGGACAATCTAAGAAATCGCGAGGTT
TCGCTTTCCTATGGTTTCACGGTAAATTTGTCATGGTTATCAGTACCGaa
acaaaacaatggaaattaGAAATACCgaaagataaaataaaacacGATGA
GTGGGTCCagctttcttttgtttggaataCAGACACGTTAACTGGTTATC
AAGATGGAACCAAAATAGGTAGTACCAAGGGCGTGGCCGCTGAACGTCCG
GAAGTCCAGTTCACTATTATGACTATCGGACGTCCGAATAATGCAGTCGA
TGCACGCTTCATGATGAAAATGGAAATGGCTTATTTGACGTTATGGGATA
AAGCATTGGAAGAAAAAGAACTCGATAAATCATATGAAAATAtaAAACAA
AAGATCGATAAGACGAGGAGACGTagtattttagaaaaacattctACCAT
AAAACAGCACGCATTGGTGAACAGGGAAATGCAAAACTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045717XLOC_045717Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073619-exon-scaffold_96-1491911889:111147..111188TCONS_00073619-exon-scaffold_96-1491911889:111147..111188Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1510915933:111147..111188TCONS_00073619-exon-scaffold_96-1510915933:111147..111188Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1575043694:111147..111188TCONS_00073619-exon-scaffold_96-1575043694:111147..111188Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1491911889:111943..112161TCONS_00073619-exon-scaffold_96-1491911889:111943..112161Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1510915933:111943..112161TCONS_00073619-exon-scaffold_96-1510915933:111943..112161Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1575043694:111943..112161TCONS_00073619-exon-scaffold_96-1575043694:111943..112161Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1491911889:114998..115153TCONS_00073619-exon-scaffold_96-1491911889:114998..115153Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1510915933:114998..115153TCONS_00073619-exon-scaffold_96-1510915933:114998..115153Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1575043694:114998..115153TCONS_00073619-exon-scaffold_96-1575043694:114998..115153Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1491911889:115640..115984TCONS_00073619-exon-scaffold_96-1491911889:115640..115984Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1510915933:115640..115984TCONS_00073619-exon-scaffold_96-1510915933:115640..115984Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1575043694:115640..115984TCONS_00073619-exon-scaffold_96-1575043694:115640..115984Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1491911889:116715..117565TCONS_00073619-exon-scaffold_96-1491911889:116715..117565Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1510915933:116715..117565TCONS_00073619-exon-scaffold_96-1510915933:116715..117565Clytia hemisphaericaexon
TCONS_00073619-exon-scaffold_96-1575043694:116715..117565TCONS_00073619-exon-scaffold_96-1575043694:116715..117565Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073619-proteinTCONS_00073619-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_96supercontigscaffold_96:111147..117565 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.160615 0.365046 0.142561 0.286411 0.115907 0.79143 1.04066 0.567897 0.911542 0.608304 0.099749 0.882662 0.246133 1.95617 6.65146 4.10892 2.58634 0.0268616 0 3.39231 3.10238 2.60005 1.9978 0 0 0 0 0.0575021 0.0291445
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013320ConA-like_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073619 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top