Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073534 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073534
Unique NameTCONS_00073534
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1300

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073534 ID=TCONS_00073534|Name=TCONS_00073534|organism=Clytia hemisphaerica|type=transcript|length=1300bp
CCTACATATAAATTGAACTAACTTGTTTCACATATCTTATTAAAGACGGA
ACTGGCATACTGACTATCAAAATATAAGACTTGTATTGATAATATcttat
ttgaaatcaaaatgaatgttgttgtttttatttttgggcTTTTGGCGCTT
TGTGTATTTTGGGTAAATGGGCGCCCTGTTATTGAGAAATCACCGCTCGA
TGCTTTTGCAGAGGAGAACGCTCGTAATGCTCTATTGTTCCCATACCTCA
TCAAGAAAAAGATCAAGCGATGTGGAACGGTCACACAGTCGAAAAATTAC
AACCAAGGCGTTGCTAAGAATCGTAAAAGAAGATTTATCCCGCAAGGAAC
TGCTTGGAATAAAAAGttATTAGCCTGGAGAATCGACGAAAATACAAATG
ACCTACCCAACTTTTTAACACGTTTTATCATCCGTAAAGCATTCAACATT
TGGTCGAAATGGATTCCGATAACTttccaagaaaaaaataaaggcaAAGT
CGATATTTCGATCAGATTTGTTAAGAAAATTCACAGACCCTGTCAAGTAG
CTTTCACTGGACAAGATGGTATCGTAGCGCATGCGTATTATCCTTACCAA
GGACAAgACATTGCCGGAGACATTCACTTCAACGATGACCAAAGGTTCAC
CCACAATGCTGAACCTTCAAACAGAGGGGGTATGGGAACTAATCTAGCAT
GGTCTGCCCTCCATGAGATAGGACACTCTTTAGGGCTTGAACATTCGAAC
ATATACGGCGCAGTAATGTCACCCTTTTACACCTCATTCTATCATCCTGG
AGTTGATCTAGCCTTGACTAATGACGATATCAAAGGTGTCCAGGCCATTT
ATGGTAAATCAACACACAGCAAAACAAATCGAGTCGATTCTTTTCTTGTA
AAATGAGTAGTTGGTGTGAAAAAATGAATGGAGGAGAAAAAGGAAGCTGA
TTTCTTAGCTGATTTTAATGCTATGCGCGTTTACCAGTGTGATGCATGCA
CAACAAGATAGTTTAACAACGAGAAGAAGATAATCATGATGTGGTTCCTA
GAACGAGTGAAAGAGAAAAGAAATGGATAGTTCcgagctggcacacaacg
ttgtttcaacgtttatctaacgttcacaacgtccatataacgttaaatga
acgttgaaacaacgttgtgtgccagctgggtcttTAACGTAGTAGAATAT
AGAACATAGAACGTTGCTATGTCAATCTATGAACCCGACATCCAATTCCG
TGAAATACATAAAAAGGTGACAAACAAACAATACACCTTATCAACCGTAG
Run BLAST on NCBI

protein sequence of TCONS_00073534-protein

>TCONS_00073534-protein ID=TCONS_00073534-protein|Name=TCONS_00073534-protein|organism=Clytia hemisphaerica|type=polypeptide|length=264bp
MNVVVFIFGLLALCVFWVNGRPVIEKSPLDAFAEENARNALLFPYLIKKK
IKRCGTVTQSKNYNQGVAKNRKRRFIPQGTAWNKKLLAWRIDENTNDLPN
FLTRFIIRKAFNIWSKWIPITFQEKNKGKVDISIRFVKKIHRPCQVAFTG
QDGIVAHAYYPYQGQDIAGDIHFNDDQRFTHNAEPSNRGGMGTNLAWSAL
HEIGHSLGLEHSNIYGAVMSPFYTSFYHPGVDLALTNDDIKGVQAIYGKS
THSKTNRVDSFLVK
Run BLAST on NCBI

transcript from alignment at scaffold_94:403661..416521+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073534 ID=TCONS_00073534|Name=TCONS_00073534|organism=Clytia hemisphaerica|type=transcript|length=12861bp|location=Sequence derived from alignment at scaffold_94:403661..416521+ (Clytia hemisphaerica)
CCTACATATAAATTGAACTAACTTGTTTCACATATCTTATTAAAGACGGA ACTGGCATACTGACTATCAAAATATAAGACTTGTATTGATAATATcttat ttgaaatcaaaatgaatgttgttgtttttatttttgggcTTTTGGCGCTT TGTGTATTTTGGGTAAATGGGCGCCCTGTTATTGAGAAATCACCGCTCGA TGCTTTTGCAGAGGAGGTAAGGCAATTTCCGGTATGTTGGGTTAAAGGTT ATTTCAAAGAGTGCGGTTTGATAACCCGTTGTTAATCTTTGTTACTTCat atttttagaaactttttttatgaaactTTTACAACCTGCTATAGTTTTAG GTGTATAaagtaaaaaagttttgaatccCCTCAAGTGTTGCCGAAGAAGC TTGAGTTACATTTTTAATTCCCCCTGAATATCAGAATCTGGCGTAAATAT TTAAatgattttctcgagatttacTTCTGGCTTTCCCGCGATTCCCCGAA AACTCCAGTCCTTATCCGCCCAAGgaaagaattattttaaagtGTTAAGA ATTGATTTCGGAAGTTTTCAAACATTAATTATCTTGACCGTTCTTATCAA TTTAGAAAGATCACAAATATGTGGTAATACTTAGATCTCAGTACAGTTAT AAAAGCAATAATACGTTCTAaggtagactagagtctacttctggctgaac tttgctttttgataatttttgatgacgctgagtccagtgaagtagactta GGAGCGTTTGgtgaggtcgccattttgaaaaagaatgtttgaaatccaaa taacaaaaaatctattggagttgaaagatgtaataaaaaatgagaaacaa atatcaataacagatttgcaatcccttattctcaaataaaaaaattgtat cGTACTGATTTTACCTTccaaaacaactaaaatctgacggactgttttac agtccgcctaagcaaaagcatattaccatatactaccgggccacttaatt gcgccatccagtctatcaaaaagctttaagtggaccccgggctagttTTT AGGTAGTGTTGCATTTTAATGTGAGAATATCATGTGTAATGACATTGCTT TTAGATCACGATTAAAAAGCTATCAATTGTTTGAAACATACAATTACTGG TACTCAGTAGTAGCTCAATCTCATTAAGTGAAGTTCCTTATAATAATCGA GCTTTAAATTGACATGAAAATATAGCCAAGGTCAATTATTTTCCTATTAG TAAATAACCGCAAATGCTTTTATAAAGTAATCATGCTCGATGGAGACCGA AATTATTATGCGTATTCAAATAGTGTGTGCGTTTACACTGGAAAGTCTCC TTAATTATAAGTCCATCAAAAGCCAAAGAAATAaatttatgatggatgaa tacactggtttattacagttcaCGAGATATATTATAACATGTTAATTGAT TTTGCTCAAGGCTTCTCATTGGCTAATTTTCATTGATATTTCCATAAAGT CGCctttgattggttgatattgataATCATACATCACTCGAAATCCGTAA ACATATTTCTTGTAATATTTTACTCGATAACTTCATTCGACTCTTCGTTA TGTATACGCTATCATAAAggaaaatcctcaaaactcgtCATCTTGACTGG GGTAAGAATGATTGAAATAATGTTAAAACGCTCTGAGAGTCTCATcaaga tttatcaaaatttcgcattttaaaagttaaaagttaCTGTAGTCAAAAAT ATCACGCCCGTTAAATCTGCAGTTTTAAAAGAACTAAacattaagggctc tgaccatagtgaatttttcataattgccgtgtttaaaatgtgttttctga ctgatgtaaccaacaaaactatggcatgttatacattttctgttagacaa actattcctgaatctgaaaattcaaaaattgcattgaaaaaatttgatga agaagaaaatgaagacttttgcgatgaagagtatttcaactttgaagagc ttagtttcggcgaagaaactcgtccgaaaggacgaggaaaattcgaaaca aaaaaatcgcgagtgcaattttcgaattgtacgagttattatgtgattac gagctaatcgcacaatgggtttcactactttttcccagttatgaaagtaa attacactgaaagttttatatttttctcttctctctatGCCGTctctatg tttttcttttattgttgtttatagattttctttctcacaaaatgaatttc gaatgcaattaaaacgttcgatgaaaaaaaaatgtgagaaaaaacattaa aatcaattttataaacattggcgctgcatcgaagagtgtgattaacgatt tattgctctctacaggatgcaattaacgattaattgctctctttgagggc gcgacaaataagaaaaaataacccatcgtgcgattaagttcttaattact tttaaggggtttgattaaaaagcaatttataaaggcaattctttgttaaa agtgttaaagaatctaaaacataacttttatgttcagatactaaaatcaa ttttctgactatggtcagagcctttAAATTAATGTTCGCAAAGAAAATGA ATCTTATCGTAATTTCGTAGTTTAGTTTCTTATATCGCAAAAAAATCACC TGTGCTGATGTTTATGTATGTCAATTGACTCAGAAATTCTCGGTTCCCCT GAGGTCTATTTAAGACAGCATTGCCAAAGCATGAATCATATCCAGAGAGA ATCGAAGTCAGGTTGTAAATAACAATTATCAACTATGTATGAAACTTCTG ATATTTGAAATATGCCTTgtattcaataaaataaataccaaatttatttt caattatcGTGAGTGGTAATTAAAATTATTGTCTGCATTCAACAATAACA CTTCACGGGGCTTATTTTTTGTTAATGCGTCACCGCATTACTCTCGTACA AAATGGaggaaaaaaattgttatttacACCACCGGCTGTGTTTTACTATA AGACAAATATCTTAAGGCCTGGCATTCCTTAATTTTTATAGGAAAATCAG GAAAATgttttacttacttacttgtttttaattttataagaacatagtAC ATAAgaacaaaatggtgaaaataagaacatacacgtttttttttatataa ggaacacgtttataaggaactcgagcctgaaaatggtccaaaaactaagg aattgttaaggaactgctcaggctgagaataagaaaacaagttttaagga acagtaagagatggttatccaaacttagcagctatgtaaataAGGAACTC GATAAGGAACTTTGAtcctgaaattctctgtaaaaataaggaactccagg ctcagagcaaagttaaggttccttataaaaaaaaacgtgtatgctaagaa catctttaggcttaaatctcaaaaagttaagaacatcagaaTATATTAAG AATCATCAGCGTAAGATTTGGCAACTGAATCTAAGAATGCcaaattttca gatattttaAAGCATTTTGACCAATAATTGGCTAatccgaggggtaaatc acttcgaaaaagcgtacgaaatgatttttgatttttgttttttttgtgat tttttgatttttttgtgatttctttttgattttttgatttttttctgtga tttttttgtgatttctttttgattttttgattttttNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNtgatttttttgtgatttttttgtgattttttgattttt ctgtgatttttttgtgattttttgatttttctgtgatttttttgtgattt tttgattttttttttatttttttgtgattttttgatttttttgtgatttt tttgtgatttctgattttttgcatgatttttttgtgatttttctaagaag tgtacgagattttttcgagtaatttacccctcgGGCTAATCTGCCACCTT CGCTCAAAACTTTTACGCAaagggcccccagcggtttgagTGAATGCGTG AACAGTGcgtgaaaatatttaaaaagctgCGTAAATGCGTGAATAGACCT tagagttttttgatttttctaaaaaagcgatgaattgtgggattgtttcg agtgtgttacaatagaaatctcttaggaattcctcaatggaattctattg taatacaatcgaaacaatcccacaatgcatcgtttttttagaaaaatcaa aaactccgataaggtctattggaaaactttgcgtgaacagagtttgcgtg aatttcgtgAATTTGGAGATAACAATCTGCTCGGGAATGCCCGTCTTATT TCTTATGAGATGGACAAAATAATAAATAGTGAAAATtagaatattaagaa catttttaagcttaaactCAAAGAGCTagaaacatccgaaggcttcgtaA AATTTGGACGTTCTTAAAAACAACCATATATGcctttaaaaagttttatg aggaaattggccaaaaaataaaGCATATGCCAAAATACCACCATCATTGA ATTTTGCAATTTGTTCTGAAcctaaaaatgtaattttttagaTTGATTAC TAATGATTACCTAGAAAAAACTTTTacagaaataaaaaacattttcttga ggtGTATTACATGCTAGATTTAAGCTGGGCTTTGATTCTAGCCTAAGAAT ACCACAATAATATTTAAGGttgatttttctcaaaagtttaGAATATTCGt gataaaatggaaaaaacaccattcttataaaaaaaagcgtgtaattaaGT TAGTCAGGTTTAATTTCTAAAAGATGAAGAATTGTCAGATCATTTGATAA TCTATTTAAATTAAGTATCGGCACGCAATGTTTCCTCCCGCGgagaaaat acttaaataacCAACATACTTAGTCGAGACAAGCTTAGCGTAATCATTTT TTCTTATCAATAGCATACCGAGTTGGTTCAAAAAATGTCAGTTCAACGCT CGTCTTGCAAACGTTGGCAATATACTTGCATCTTTAGAATTGCACTTGAA GTAAAGACAAAGATCAAACAAAGCCATTATTACAAATATAAtccaaaaac attcaaaaatacaCTGACCACCTcactcgggtgaaacaaggcatgtccca aatatattttgcgtgacgcacaccgcttcccattattcattaactttcat atatagctcaaaagaatcgtatCNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAATTTAcatcaag ccaatctcaagatatcggccaaaaactgattttgacgttataaaatacat cgaaaaaacacgtcaaaaagacaatttaaatgacgtcattattaaaaaaa agctcaggatctgaggatccaaaagttcaaaaatagtccaataagactca gaatatagcctggaagtctgccaacccctcccaaattgaaatattcgata aaattaaaaagacagccaaaaatcgactttctcgccagaactttaaatct tgaaaaacgttaaaataaccaaaattctcaatatattatgaccttaattg tacaaaagatgtcacggaaccccaggcttggcccctactataaagtgcac tttgggaagcttgtaaaatatacccttaagggcccCACTTACGgtaattt atacaatttttCATCATTATCTTTGCAGAACGCTCGTAATGCTCTATTGT TCCCATACCTCATCAAGAAAAAGATCAAGCGATGTGGAACGGTCACACAG TCGAAAAATTACAACCAAGGCGTTGCTAAGAATCGTAAAAGAAGATTTAT CCCGCAAGGAACTGCTTGGAATAAAAAGGTTAGCCAGTTAGACCTAAATT AAGGTAAAGTTTGATTAACCTTAATCTTTTTACTATCTATTAATGAAAGC ATGTCTGTGATTCAAACCAAAAGTTCGCTCAACTGGAAAGTCTcgaaata ttttcattaatCGGAATACTTCTATATTTATATTTAATTCGAAAACAAAA TTCTTTGTTTCTCGAAGATCCAATTAGAGAGAGTTAGCAATTTTATCAAA GACCCGGTTAaaacaatgggcttttccagaaaaaaaccgtatacctcctg ttgaggagtccatttccgttccaacggaGTAAGGTTTGATGTGTGGCGGA ATTACATaaggagatacaaaaatctgtcaaaataaTAAGTGGAATTTTAT GGTGGTAGCCTTTTAAAttctactaaaattcagaatttcaAAGGGGTGTA AACCTGAAACTGTCTGGAATTCCAGGGgattacagcatttccagccacag agggatgAACCTCCTCAAATTTATTGTGAAATAGCTGGAAAAAGTTCACA AACAAGCCTTATGTTATGTCTCTCTTAGTAAATAATTAATTGAACCATGT ATCAAGCCACGCAAAAAAATAACCCTGGAATGCCTCCAATTTTCGTCCCT GGAATCACCCCATACTCATTTTAGTAATcaaccaacttttttttagttAT TAGCCTGGAGAATCGACGAAAATACAAATGACCTACCCAACTTTTTAACA CGTTTTATCATCCGTAAAGCATTCAACATTTGGTCGAAATGGATTCCGAT AACTttccaagaaaaaaataaaggcaAAGTCGATATTTCGATCAGATTTG TTAAGAAAATTCACAGACCCTGTCAAGTAGCTTTCACTGGACAAGATGGT ATCGTAGCGCATGCGTATTATCCTTACCAAGGACAAggttggtatttttt tctttgataagTATAGAAGAATTGTGGATGACGTTGGGAATTTATGATAG ATTTTCAAATGTTATAATCGGTTAAAATCCAGTCCCTCAAAATCCAAATT AAATCccaattttcctgtttttctcAAAGGACTTGATCATTGTTTCTTTT TGCGTTCTCACagaaagcaaaaaaagaaaaagaaataggaACCGAACCGG GCCACTTAACAGGTCCACCCaatctatcaaaaagctatgaTTAGTCTCCG GGCTAGGTTGGATTTgtttagcaaaaaaattaaaaccataTTAcacctag tctgaatcgcagacctctatagatatgaTTGCCCTCTCTCTCCACCTCCC TAGGCTGGATTTGTCTTGTTTTTAGTTTCATCAATTTGTTTGTATTTCTG TTTTCCAGACATTGCCGGAGACATTCACTTCAACGATGACCAAAGGTTCA CCCACAATGCTGAACCTTCAAACAGAGGGGGTATGGGAACTAATCTAGCA TGGTCTGCCCTCCATGAGATAGGACACTCTTTAGGTGAGATTTGGTTGGT TGTTATAATGCGTCTAATACAGTCATATGTGTCTTGTGTTATAGGATAAT ACAACAATTGTTAcaggataatatcagtttgtcttttccaatattttttc atctttttctaCTCTGGCTGAACTGGTCATTTACAATCCcacacaaaata tttgagacaaaaaggatttgcttttgaaattttaaacaccacaaataaTT TTTAAGCGAGTTAAactagagttttaacatgacaCTTAAaacttacgacc ttaggatctcaggagttaaaagctcaaaattgtttCGGGcaagattgggc ttttccagaaaaagattttacacccgctgttgaggatatcaacttttaaa aatatactaaaccccctggatatcctctcttataaagatgcttacccatt ggatatcgtattttttacttgaaaagacactttacccctggatatccgct cccttgcaGATAttaaaccccctggatatccacttttgagcaaaaatcgt taaccccctggatatcctctcttataaagatgcttacccattggatatcg tattttttacttgaaaagacactttacccctggatatccgctcccttgca GATAttaaaccccctggatatccacttttgagcaaaaatcgTTAATCCCC TGggtatccgatatcctcaacaggagGTGCACggactatttttggaaaag cccattgtagCCTGACAATTCTGTCTTTGTCAATTTCTCGGTGAGGCGTT GATCAGCCTGGATAAGAGTTCAAGGCTTTTTATCGCCTGTTCCAAATCTT CTGTTCGTGActagatttttgtttttgttggaaagCTTTTAAGAAGAATT ATCGAATTAAGGGTTGGTACTCCAGCATATACATATATATCTTTCACAAT GGTGTATTGTTCTGTGATTATAAAGACCTAAAGTGCAGTTTTTTTATTAG TAAATcgtaatcgttttttttttacccaCGCTATTTTTCCTcccttttgt tgtttttcttttttgaaaaacatatttaCTTAAATTTAGACTGCTCGAAT TAATGGCCTGTGACATATTTCAGATTTATGCAACATAACATGTTATGGTT CCCTAACCATACCATAACTTAGGGTCATCTGCTTTAactctttttttgtt tctactAGATGTGTGGAAACCATGATTGAAAGAATTACTTTTAAATACAA TAACATTGTTTCCACATTATAGAAAAGGAGAGCGCACATttaagcaattc cattggttaATTATGGGTCTACTACGATTTTACCTAAAAAgtgatttcaa aaattatttNTttaagcaattccattggttaGTTATGGGTCTACTACGAT TTTACCTAAAAAgtgatttcaaaaattatttaacaAATTTAAAGACCTCT AGAAATTATTTTAACCTCGAATCAACTTTTGTTTTCTATATCTTAGGGCT TGAACATTCGAACATATACGGCGCAGTAATGTCACCCTTTTACACCTCAT TCTATCATCCTGGAGTTGATCTAGCCTTGACTAATGACGATATCAAAGGT GTCCAGGCCATTTATGGTATGATTCTTTCTCTCATCATGTTCGAAATGAG TCACGTGGGTTTTCTGGACCAATAGGCTTCTTCCTAATAGTAGTATTATT ATAAATCTAAGATTTATCAAAATGGTTTGTTAAAGAGCGCTCTCTTTCCA GATTGCTTATGATTCTGAGCCGTGCCTGATTTTTCATGTTCGAGTTTTCT CGTTCACAAATGAAGGTCAAGGACACAACCGATCTCGCAACCGATCAGAC GAACCCAAAGGCTAAGAGGCTAAAGTAAGGCTAGGGCTGAATCTCCTATg tgtaggatttgaagccaaatATTTACTACCTAGTGGCATGAGccactttt ttttactataaaccctcaaaatacttacaaaattcgaaaatgttaaccgg aaaaaaaaaagtGCTAGATTTAATTCGTCAGAAAGGAAGAGCAAATTTTA AGATGTTAGTTTCGCTTACGTCTCTAGCCATCAAATATAACTCATTGAAA AAGCTTCTTACAGAAATTGCATAATACAATGagaaaatgacattttgaaG CAGAATTAAACTTCAGGTTGTGCTTTCAAATTTgctcaatacaccttttt gaccgtagtcgcgcggtcaggtaCGTGCCACTTTATCATTTAATTACACC CCTGAAACTCAATCCAATCcttatttatacttttttctaaTGTCTTTAGG TGCacaaaaaagactgggacggttttagggcggtaaaacagacaaaaaat gtcCGCGCGGCATTTGGCggttacggtcgaaaaggtgtattttacttttt ctacACAGGCAATTTACCTTTTTATCCTGTGagattaatattttcaaaac ttacGCACGTGAAAGCACTTTCTAAGTAAGATTTACATGAAATTGAATTG TGTGAATTCTTAAATTCCATAGAGACCTTTCACAAGCATGCCCTGCAATG CTCAAAATTTAAGCGCTCCCCTCATCCCATTTTCCCAAATTAGCATATTT GATAGGATTTTTGTGCATCTGTTACGTGCTAATTTCTATTAAATTTAAAG GAGTAAAATGCACAGATTTGTGCAGATTTCGCCTCAAAAAAGACGGtgaa aaagattatttttttgtcaTCATTAAATTGACTtgggaattcaaaaaaaa ttcacaacaGAGTACTTGACCAGAAAAAGttgattacacgcttttttata agaatggtgttttttcatttcatcatcaTGGATAGTCtgaactttttggg gaaaatcattatcaaaatttttatacGGTATATTGTTAGGTTATATTCCA ACCACCCAGCCTAATCTagcatgtaatacatacctcAAGCAAATATTTGG CAAGAACTTTTAGCCTTGCTGGGGAATAATTGgaattttacaaataaaat gctcAAAAGATCctgtgccgtaggaagcattttcttattgggggggctga agtttagtgacaccgcgagggccaaccatggtttgacCGGGGGGGGGGGN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGtttggcccgggggggg ggattttgaaaatctaggctctagattgcttgaaaatgcactcaaaacaa aatgctttcaagaaaaaaccagaaaaactttgcattttgcaaaataacca tttttgaaaagattattGGGGACATAGCCTCCCCCctcccagttgctacg gcactgagatcggtattcttaggttcagaTGCGAAATCCCATGATGGTGT CATTCCAGAGAAATTGAAAGGGATAGAAAAAGCGCTTCTCTGATTATCCA ATAAAGTGTTCTGATCGTTTCTATTGAAAACTCGATTGTTTCAGCTTTAA TTAGGTAgttagaaaaagttaagaaaaaacgGCTGATATCATGCCCCTGA TATAAGGTTCTCGCATAATTTGACCtgaaacaaaaaactttcgtcACACT ACGCTGattatacacattttttaaagcGAAAACTTGAAATCCAAGAAGTC CACTAACTGAAAACAAACTTATCCCTTGAGGGCAAAGGGCCTGGTACATG ATGAGCCATATagttccattgttttcaagaagctgttctACTATCTCTTT CCATTTTTCTGGTTATTCTtagcattttttttgctttagaataatttttt tggcaaatttcatcatgaatattcttataaagtatatcatttttttaaca aaagttTGTACTACAGTGACGTAGAAAAATGTCGAAAACACGAATCCTAA TAATGCTCTACAGACACTTTTGTTTATAAGttgaattgtttttattgata ttgCAAAGCTATTTCTTTTCTTGTAACCTCTTTGCGCAATTCGGTGTTAA AAAtcacttcttctttttctaaatCCTGTGGTCACTTCACAATAAAAATC TCCTTTCCATAAAGAAAAccacaaaaagtcaaaaacaggAACTTCACAAC ataaacatgtttttattttttccttttccgACCTTTCCGTCAATTTAGAA AGTAAATTGTTGCAAAACATTTGAACAGCTCATTGTGACCCGATGAAAGC TAGAACCCAACTGAATAATTCGGCCAAAATACTTCCTtggtgaaaaatat tcttaatttcaaccctttttgaaaaagtgcGCTATGGTTTTAATCCAATT TGAAATGGAatttaaaaattgtattttaaaacCATCTCTTCTTCTGAAGT TTTTGAGCTAGACACAATAGATTTTCATCCTCATTGAGTatgtagacgat cctatcgtctacacaggCTCACTAAAAAGGGGCATAATTTAGGAGGCGAA TAAACGATGGTTAGCCCTGGGCGgagagtaagcagtggcggaggaggtgt ttacagtgtagtctgttccaaactctaccgctGCTTTCTTTTTCTAAACC ACCCTGACGCCCTGATGTTTATTGACCCactaacggacgatagcatcgtc tacatCGAGTGAAAAAGTTCCACCATTAGCGTAGTGGGTTGACCGAAATC GAGGCAAACAGCGGAGGCAATCTTAAATTAGTAATTTGGCACCctattaa aagtaaaatatcGTGGGAAGCTAGCacaaaagtttttgactttttttatc tttttgtctGAAATCTGCTAATTCTTAGATATAAAAAAGCAGAGAGTGGC CGGAATAAGTAGCCAGAGGTGCTTTTTTGCGCTCTTTGTCCTTCAGCGCC TCAAAATATCGGCCACTGGTCCCCTGCCCCAATGCTACTGAGTTCTACCT GGGTACTGAGAAAGTTGTTTATACAGCAGTTTTTTTTACCACATCTTCTA TTGCACCATTTCAGGTAAATCAACACACAGCAAAACAAATCGAGTCGATT CTTTTCTTGTAAAATGAGTAGTTGGTGTGAAAAAATGAATGGAGGAGAAA AAGGAAGCTGATTTCTTAGCTGATTTTAATGCTATGCGCGTTTACCAGTG TGATGCATGCACAACAAGATAGTTTAACAACGAGAAGAAGATAATCATGA TGTGGTTCCTAGAACGAGTGAAAGAGAAAAGAAATGGATAGTTCcgagct ggcacacaacgttgtttcaacgtttatctaacgttcacaacgtccatata acgttaaatgaacgttgaaacaacgttgtgtgccagctgggtcttTAACG TAGTAGAATATAGAACATAGAACGTTGCTATGTCAATCTATGAACCCGAC ATCCAATTCCGTGAAATACATAAAAAGGTGACAAACAAACAATACACCTT ATCAACCGTAG

Coding sequence (CDS) from alignment at scaffold_94:403661..416521+

>TCONS_00073534 ID=TCONS_00073534|Name=TCONS_00073534|organism=Clytia hemisphaerica|type=CDS|length=4770bp|location=Sequence derived from alignment at scaffold_94:403661..416521+ (Clytia hemisphaerica)
atgaatgttgttgtttttatttttgggcTTTTGGCGCTTTGTGTATTTTG
GGTAAATGGGCGCCCTGTTATTGAGAAATCACCGCTCGATGCTTTTGCAG
AGGAGAACGCTCGTAATGCTCTATTGTTCCCATACCTCATCAAGAAAAAG
ATCAAGCGATGTGGAACGGTCACACAGTCGAAAAATTACAACCAAGGCGT
TGCTAAGAATCGTAAAAGAAGATTTATCCCGCAAGGAACTGCTTGGAATA
AAAAGttATTAGCCTGGAGAATCGACGAAAATACAAATGACCTACCCAAC
TTTTTAACACGTTTTATCATCCGTAAAGCATTCAACATTTGGTCGAAATG
GATTCCGATAACTttccaagaaaaaaataaaggcaAAGTCGATATTTCGA
TCAGATTTGTTAAGAAAATTCACAGACCCTGTCAAGTAGCTTTCACTGGA
CAAGATGGTATCGTAGCGCATGCGTATTATCCTTACCAAGGACAAgACAT
TGCCGGAGACATTCACTTCAACGATGACCAAAGGTTCACCCACAATGCTG
AACCTTCAAACAGAGGGGGTATGGGAACTAATCTAGCATGGTCTGCCCTC
CATGAGATAGGACACTCTTTAGGGCTTGAACATTCGAACATATACGGCGC
AGTAATGTCACCCTTTTACACCTCATTCTATCATCCTGGAGTTGATCTAG
CCTTGACTAATGACGATATCAAAGGTGTCCAGGCCATTTATGGTAAATCA
ACACACAGCAAAACAAATCGAGTCGATTCTTTTCTTGTAAAATGAatgaa
tgttgttgtttttatttttgggcTTTTGGCGCTTTGTGTATTTTGGGTAA
ATGGGCGCCCTGTTATTGAGAAATCACCGCTCGATGCTTTTGCAGAGGAG
AACGCTCGTAATGCTCTATTGTTCCCATACCTCATCAAGAAAAAGATCAA
GCGATGTGGAACGGTCACACAGTCGAAAAATTACAACCAAGGCGTTGCTA
AGAATCGTAAAAGAAGATTTATCCCGCAAGGAACTGCTTGGAATAAAAAG
ttATTAGCCTGGAGAATCGACGAAAATACAAATGACCTACCCAACTTTTT
AACACGTTTTATCATCCGTAAAGCATTCAACATTTGGTCGAAATGGATTC
CGATAACTttccaagaaaaaaataaaggcaAAGTCGATATTTCGATCAGA
TTTGTTAAGAAAATTCACAGACCCTGTCAAGTAGCTTTCACTGGACAAGA
TGGTATCGTAGCGCATGCGTATTATCCTTACCAAGGACAAgACATTGCCG
GAGACATTCACTTCAACGATGACCAAAGGTTCACCCACAATGCTGAACCT
TCAAACAGAGGGGGTATGGGAACTAATCTAGCATGGTCTGCCCTCCATGA
GATAGGACACTCTTTAGGGCTTGAACATTCGAACATATACGGCGCAGTAA
TGTCACCCTTTTACACCTCATTCTATCATCCTGGAGTTGATCTAGCCTTG
ACTAATGACGATATCAAAGGTGTCCAGGCCATTTATGGTAAATCAACACA
CAGCAAAACAAATCGAGTCGATTCTTTTCTTGTAAAATGAatgaatgttg
ttgtttttatttttgggcTTTTGGCGCTTTGTGTATTTTGGGTAAATGGG
CGCCCTGTTATTGAGAAATCACCGCTCGATGCTTTTGCAGAGGAGAACGC
TCGTAATGCTCTATTGTTCCCATACCTCATCAAGAAAAAGATCAAGCGAT
GTGGAACGGTCACACAGTCGAAAAATTACAACCAAGGCGTTGCTAAGAAT
CGTAAAAGAAGATTTATCCCGCAAGGAACTGCTTGGAATAAAAAGttATT
AGCCTGGAGAATCGACGAAAATACAAATGACCTACCCAACTTTTTAACAC
GTTTTATCATCCGTAAAGCATTCAACATTTGGTCGAAATGGATTCCGATA
ACTttccaagaaaaaaataaaggcaAAGTCGATATTTCGATCAGATTTGT
TAAGAAAATTCACAGACCCTGTCAAGTAGCTTTCACTGGACAAGATGGTA
TCGTAGCGCATGCGTATTATCCTTACCAAGGACAAgACATTGCCGGAGAC
ATTCACTTCAACGATGACCAAAGGTTCACCCACAATGCTGAACCTTCAAA
CAGAGGGGGTATGGGAACTAATCTAGCATGGTCTGCCCTCCATGAGATAG
GACACTCTTTAGGGCTTGAACATTCGAACATATACGGCGCAGTAATGTCA
CCCTTTTACACCTCATTCTATCATCCTGGAGTTGATCTAGCCTTGACTAA
TGACGATATCAAAGGTGTCCAGGCCATTTATGGTAAATCAACACACAGCA
AAACAAATCGAGTCGATTCTTTTCTTGTAAAATGAatgaatgttgttgtt
tttatttttgggcTTTTGGCGCTTTGTGTATTTTGGGTAAATGGGCGCCC
TGTTATTGAGAAATCACCGCTCGATGCTTTTGCAGAGGAGAACGCTCGTA
ATGCTCTATTGTTCCCATACCTCATCAAGAAAAAGATCAAGCGATGTGGA
ACGGTCACACAGTCGAAAAATTACAACCAAGGCGTTGCTAAGAATCGTAA
AAGAAGATTTATCCCGCAAGGAACTGCTTGGAATAAAAAGttATTAGCCT
GGAGAATCGACGAAAATACAAATGACCTACCCAACTTTTTAACACGTTTT
ATCATCCGTAAAGCATTCAACATTTGGTCGAAATGGATTCCGATAACTtt
ccaagaaaaaaataaaggcaAAGTCGATATTTCGATCAGATTTGTTAAGA
AAATTCACAGACCCTGTCAAGTAGCTTTCACTGGACAAGATGGTATCGTA
GCGCATGCGTATTATCCTTACCAAGGACAAgACATTGCCGGAGACATTCA
CTTCAACGATGACCAAAGGTTCACCCACAATGCTGAACCTTCAAACAGAG
GGGGTATGGGAACTAATCTAGCATGGTCTGCCCTCCATGAGATAGGACAC
TCTTTAGGGCTTGAACATTCGAACATATACGGCGCAGTAATGTCACCCTT
TTACACCTCATTCTATCATCCTGGAGTTGATCTAGCCTTGACTAATGACG
ATATCAAAGGTGTCCAGGCCATTTATGGTAAATCAACACACAGCAAAACA
AATCGAGTCGATTCTTTTCTTGTAAAATGAatgaatgttgttgtttttat
ttttgggcTTTTGGCGCTTTGTGTATTTTGGGTAAATGGGCGCCCTGTTA
TTGAGAAATCACCGCTCGATGCTTTTGCAGAGGAGAACGCTCGTAATGCT
CTATTGTTCCCATACCTCATCAAGAAAAAGATCAAGCGATGTGGAACGGT
CACACAGTCGAAAAATTACAACCAAGGCGTTGCTAAGAATCGTAAAAGAA
GATTTATCCCGCAAGGAACTGCTTGGAATAAAAAGttATTAGCCTGGAGA
ATCGACGAAAATACAAATGACCTACCCAACTTTTTAACACGTTTTATCAT
CCGTAAAGCATTCAACATTTGGTCGAAATGGATTCCGATAACTttccaag
aaaaaaataaaggcaAAGTCGATATTTCGATCAGATTTGTTAAGAAAATT
CACAGACCCTGTCAAGTAGCTTTCACTGGACAAGATGGTATCGTAGCGCA
TGCGTATTATCCTTACCAAGGACAAgACATTGCCGGAGACATTCACTTCA
ACGATGACCAAAGGTTCACCCACAATGCTGAACCTTCAAACAGAGGGGGT
ATGGGAACTAATCTAGCATGGTCTGCCCTCCATGAGATAGGACACTCTTT
AGGGCTTGAACATTCGAACATATACGGCGCAGTAATGTCACCCTTTTACA
CCTCATTCTATCATCCTGGAGTTGATCTAGCCTTGACTAATGACGATATC
AAAGGTGTCCAGGCCATTTATGGTAAATCAACACACAGCAAAACAAATCG
AGTCGATTCTTTTCTTGTAAAATGAatgaatgttgttgtttttatttttg
ggcTTTTGGCGCTTTGTGTATTTTGGGTAAATGGGCGCCCTGTTATTGAG
AAATCACCGCTCGATGCTTTTGCAGAGGAGAACGCTCGTAATGCTCTATT
GTTCCCATACCTCATCAAGAAAAAGATCAAGCGATGTGGAACGGTCACAC
AGTCGAAAAATTACAACCAAGGCGTTGCTAAGAATCGTAAAAGAAGATTT
ATCCCGCAAGGAACTGCTTGGAATAAAAAGttATTAGCCTGGAGAATCGA
CGAAAATACAAATGACCTACCCAACTTTTTAACACGTTTTATCATCCGTA
AAGCATTCAACATTTGGTCGAAATGGATTCCGATAACTttccaagaaaaa
aataaaggcaAAGTCGATATTTCGATCAGATTTGTTAAGAAAATTCACAG
ACCCTGTCAAGTAGCTTTCACTGGACAAGATGGTATCGTAGCGCATGCGT
ATTATCCTTACCAAGGACAAgACATTGCCGGAGACATTCACTTCAACGAT
GACCAAAGGTTCACCCACAATGCTGAACCTTCAAACAGAGGGGGTATGGG
AACTAATCTAGCATGGTCTGCCCTCCATGAGATAGGACACTCTTTAGGGC
TTGAACATTCGAACATATACGGCGCAGTAATGTCACCCTTTTACACCTCA
TTCTATCATCCTGGAGTTGATCTAGCCTTGACTAATGACGATATCAAAGG
TGTCCAGGCCATTTATGGTAAATCAACACACAGCAAAACAAATCGAGTCG
ATTCTTTTCTTGTAAAATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045641XLOC_045641Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073534-proteinTCONS_00073534-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073534-exon-scaffold_94-1491911889:403661..403876TCONS_00073534-exon-scaffold_94-1491911889:403661..403876Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:403661..403876TCONS_00073534-exon-scaffold_94-1510915933:403661..403876Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:403661..403876TCONS_00073534-exon-scaffold_94-1575043694:403661..403876Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1491911889:409539..409688TCONS_00073534-exon-scaffold_94-1491911889:409539..409688Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:409539..409688TCONS_00073534-exon-scaffold_94-1510915933:409539..409688Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:409539..409688TCONS_00073534-exon-scaffold_94-1575043694:409539..409688Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1491911889:410357..410597TCONS_00073534-exon-scaffold_94-1491911889:410357..410597Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:410357..410597TCONS_00073534-exon-scaffold_94-1510915933:410357..410597Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:410357..410597TCONS_00073534-exon-scaffold_94-1575043694:410357..410597Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1491911889:411019..411144TCONS_00073534-exon-scaffold_94-1491911889:411019..411144Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:411019..411144TCONS_00073534-exon-scaffold_94-1510915933:411019..411144Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:411019..411144TCONS_00073534-exon-scaffold_94-1575043694:411019..411144Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1491911889:412607..412726TCONS_00073534-exon-scaffold_94-1491911889:412607..412726Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:412607..412726TCONS_00073534-exon-scaffold_94-1510915933:412607..412726Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:412607..412726TCONS_00073534-exon-scaffold_94-1575043694:412607..412726Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1491911889:416075..416521TCONS_00073534-exon-scaffold_94-1491911889:416075..416521Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1510915933:416075..416521TCONS_00073534-exon-scaffold_94-1510915933:416075..416521Clytia hemisphaericaexon
TCONS_00073534-exon-scaffold_94-1575043694:416075..416521TCONS_00073534-exon-scaffold_94-1575043694:416075..416521Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:403661..416521 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.236518 0 0.267798 0 0 0.0362282 0 0.569354 1.59448 3.44722 0.958499 1.10264 2.4223 2.27961 3.76048 1.11605 2.84085 2.00185 0.924124 2.63097 1.37208 0.334625 1.08475 0.246549 2.03151 0.900185 37.6204 25.9587 0.525034 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR021190Pept_M10A
IPR006026Peptidase_Metallo
IPR024079MetalloPept_cat_dom
IPR001818Pept_M10_metallopeptidase
IPR033739M10A_MMP
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0004222metalloendopeptidase activity
GO:0008237metallopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Cellular Component
TermDefinition
GO:0031012extracellular matrix
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
cellular_component GO:0031012 extracellular matrix
molecular_function GO:0004222 metalloendopeptidase activity
molecular_function GO:0008237 metallopeptidase activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00073534 vs. Swiss-Prot (Human)
Match: MMP1 (Interstitial collagenase OS=Homo sapiens GN=MMP1 PE=1 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 7.470e-31
Identity = 73/169 (43.20%), Postives = 95/169 (56.21%), Query Frame = 1
Query:  355 WNKKLLAWRIDENTNDLPNFLTRFIIRKAFNIWSKWIPITFQEKNKGKVDISIRFVKKIHRPCQVAFTGQDGIVAHAYYPYQGQDIAGDIHFNDDQRFTHNAEPSNRGGMGTNLAWSALHEIGHSLGLEHSNIYGAVMSPFYTSFYHPGVDLALTNDDIKGVQAIYGKS 861
            W +  L +RI+  T DLP       I KAF +WS   P+TF + ++G+ DI I FV+  HR     F G  G +AHA+ P  G  I GD HF++D+R+T+N           NL   A HE+GHSLGL HS   GA+M P YT       D+ L  DDI G+QAIYG+S
Sbjct:  109 WEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHR-DNSPFDGPGGNLAHAFQP--GPGIGGDAHFDEDERWTNNFRE-------YNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF----SGDVQLAQDDIDGIQAIYGRS 263          
The following BLAST results are available for this feature:
BLAST of TCONS_00073534 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MMP17.470e-3143.20Interstitial collagenase OS=Homo sapiens GN=MMP1 P... [more]
back to top