Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073516 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073516
Unique NameTCONS_00073516
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1741

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073516 ID=TCONS_00073516|Name=TCONS_00073516|organism=Clytia hemisphaerica|type=transcript|length=1741bp
TACCGGCTATCATTATAAAGATTGTTGCAAAGATAACTTTAGATCCTACC
CAGTGTAAACACATAATTAAAACTTATTCAAAATACACCGTGTATACGAG
GCTTTATATTAATAGATGATATAACGTAACGATTGAATATGTCAAAAAAC
AGTTtgcaagaaataaataaactacgTTGGCAACTAAGTCAGGAGTTCAA
TAGTTCTATACACAAGTTTCGCTATGATTATTCAAACTTatcgagtctgc
taaattatcATTTGCAAGCATCGAGGTTCCAACACACGTGGAGTTCAATT
CGTTCCCATTACGTTTTTTGTTAAGTGATAATTTCAATGCTGTCGTGTAA
GCCATCCTTTGTAAAATATGTTTTAATCCTTTTTGGAAGTCTTTATGAAA
GAAACAATATATGAATGGATTCAAAGAGCTGTTCAAAAGAGGTAGATACT
CTACGACAATTTTATACGGAACGCCTTCTAAAGTTACTTTTGTGATAAAT
GTATCTATAACCACAAGAATGATCAAAGGTACCCAACACACTACGAAAGT
TCCAAAAACTACACAAATCACTTTAGTAGCTTTCAACTCCAATAAACGTG
CTGCAATGAACTTTTTCGTGCTATGCGCTGCCACTTTATCGAGCGACGCT
TGACTTGAATAATTATTGTAACGTTTGCGGATTTCTTTAGCGTGGGCCAT
CGCTATATGCCACATACGGCCGTACAggagcgccatgatgagacATGGTA
CTACAAAAACAATCATGTATAAATAAGCCGAAAATTGATCCCTGGTCCTG
AGACATCTGTAACCTTTGATTTGGAAGGTGCCTTGTAATTGCAGCGTACT
CCAATTCACATTGTTCATAAAGCCCCAAGATAAAGCGTAAACCCAAATAG
ACGATAAcataattttgatatttttgaaagagAAAAGTCTGGGATAATAA
AATGGTTTGTCAATAGCAATAAATCTATCAATACATATGACTAGTAGATG
GGTTATGGAGGTTGTAAATATAAACGGATCAATATTTCTGTACATTCGAC
ACATCTCTTGACCCATACAGAATTTCCCATTCTTTGAATATGTGAAGATT
TTGATCGGGATTATCACCAACCCAGATAACAAATCACCAATTGCTAATGA
AAGTAGAAAATAGTTAGTAGCTCTTTTACGAAGTGTATTGGATTTAATAA
TGACAGCGCAAACGAGGCTGTTGCCAAGGACACCGATGAGGAATGTCAGG
ACTAAAATAGTGATGTAGACAGCGAAGGTGCTGGTCACCTGGACTTGTGG
ACCACAATGAAAACTTTTGCATTCCATCATTTCTTTAGTATGGTTCGATT
TCAGATAAAATTTGAACACATCACTGACGTATACATTAGTGTCGTTATGA
TGGTGGCTGCAGGGTGCCATGTATTCCTTCATCGCATCCATTGATTTCAA
TATATTTATATCAACTCCATCGAAAAGTTCTGTGACACAACATTTGAGTT
CTTGACTTATGTAAGTCGGAGTTGAAAAGAATCGTGACGCAATTAAACCG
AAATCGATTCCTGTAGTGTTGTAAATGGTAGACCCATTGTTGCGGTGGCT
GATATTGTTTCCAGTGTTGTTAAGGTGGCCTATTTGTGTCCATGAGACAT
TACTGAATCGGTTCAGGCTTGGAGTTGAATTAATCATTTTTCTAggaaaa
atttaaagaattatGTAGTAGTGTTCTATAAATGGAACTTC
Run BLAST on NCBI

protein sequence of TCONS_00073516-protein

>TCONS_00073516-protein ID=TCONS_00073516-protein|Name=TCONS_00073516-protein|organism=Clytia hemisphaerica|type=polypeptide|length=493bp
MINSTPSLNRFSNVSWTQIGHLNNTGNNISHRNNGSTIYNTTGIDFGLIA
SRFFSTPTYISQELKCCVTELFDGVDINILKSMDAMKEYMAPCSHHHNDT
NVYVSDVFKFYLKSNHTKEMMECKSFHCGPQVQVTSTFAVYITILVLTFL
IGVLGNSLVCAVIIKSNTLRKRATNYFLLSLAIGDLLSGLVIIPIKIFTY
SKNGKFCMGQEMCRMYRNIDPFIFTTSITHLLVICIDRFIAIDKPFYYPR
LFSFKNIKIMLSSIWVYALSWGFMNNVNWSTLQLQGTFQIKGYRCLRTRD
QFSAYLYMIVFVVPCLIMALLYGRMWHIAMAHAKEIRKRYNNYSSQASLD
KVAAHSTKKFIAARLLELKATKVICVVFGTFVVCWVPLIILVVIDTFITK
VTLEGVPYKIVVEYLPLLNSSLNPFIYCFFHKDFQKGLKHILQRMAYTTA
LKLSLNKKRNGNELNSTCVGTSMLANDNLADSISLNNHSETCV
Run BLAST on NCBI

transcript from alignment at scaffold_93:123239..124979

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073516 ID=TCONS_00073516|Name=TCONS_00073516|organism=Clytia hemisphaerica|type=transcript|length=1741bp|location=Sequence derived from alignment at scaffold_93:123239..124979 (Clytia hemisphaerica)
GAAGTTCCATTTATAGAACACTACTACataattctttaaatttttccTAG AAAAATGATTAATTCAACTCCAAGCCTGAACCGATTCAGTAATGTCTCAT GGACACAAATAGGCCACCTTAACAACACTGGAAACAATATCAGCCACCGC AACAATGGGTCTACCATTTACAACACTACAGGAATCGATTTCGGTTTAAT TGCGTCACGATTCTTTTCAACTCCGACTTACATAAGTCAAGAACTCAAAT GTTGTGTCACAGAACTTTTCGATGGAGTTGATATAAATATATTGAAATCA ATGGATGCGATGAAGGAATACATGGCACCCTGCAGCCACCATCATAACGA CACTAATGTATACGTCAGTGATGTGTTCAAATTTTATCTGAAATCGAACC ATACTAAAGAAATGATGGAATGCAAAAGTTTTCATTGTGGTCCACAAGTC CAGGTGACCAGCACCTTCGCTGTCTACATCACTATTTTAGTCCTGACATT CCTCATCGGTGTCCTTGGCAACAGCCTCGTTTGCGCTGTCATTATTAAAT CCAATACACTTCGTAAAAGAGCTACTAACTATTTTCTACTTTCATTAGCA ATTGGTGATTTGTTATCTGGGTTGGTGATAATCCCGATCAAAATCTTCAC ATATTCAAAGAATGGGAAATTCTGTATGGGTCAAGAGATGTGTCGAATGT ACAGAAATATTGATCCGTTTATATTTACAACCTCCATAACCCATCTACTA GTCATATGTATTGATAGATTTATTGCTATTGACAAACCATTTTATTATCC CAGACTTTTctctttcaaaaatatcaaaattatgTTATCGTCTATTTGGG TTTACGCTTTATCTTGGGGCTTTATGAACAATGTGAATTGGAGTACGCTG CAATTACAAGGCACCTTCCAAATCAAAGGTTACAGATGTCTCAGGACCAG GGATCAATTTTCGGCTTATTTATACATGATTGTTTTTGTAGTACCATgtc tcatcatggcgctccTGTACGGCCGTATGTGGCATATAGCGATGGCCCAC GCTAAAGAAATCCGCAAACGTTACAATAATTATTCAAGTCAAGCGTCGCT CGATAAAGTGGCAGCGCATAGCACGAAAAAGTTCATTGCAGCACGTTTAT TGGAGTTGAAAGCTACTAAAGTGATTTGTGTAGTTTTTGGAACTTTCGTA GTGTGTTGGGTACCTTTGATCATTCTTGTGGTTATAGATACATTTATCAC AAAAGTAACTTTAGAAGGCGTTCCGTATAAAATTGTCGTAGAGTATCTAC CTCTTTTGAACAGCTCTTTGAATCCATTCATATATTGTTTCTTTCATAAA GACTTCCAAAAAGGATTAAAACATATTTTACAAAGGATGGCTTACACGAC AGCATTGAAATTATCACTTAACAAAAAACGTAATGGGAACGAATTGAACT CCACGTGTGTTGGAACCTCGATGCTTGCAAATgataatttagcagactcg atAAGTTTGAATAATCATAGCGAAACTTGTGTATAGAACTATTGAACTCC TGACTTAGTTGCCAAcgtagtttatttatttcttgcaAACTGTTTTTTGA CATATTCAATCGTTACGTTATATCATCTATTAATATAAAGCCTCGTATAC ACGGTGTATTTTGAATAAGTTTTAATTATGTGTTTACACTGGGTAGGATC TAAAGTTATCTTTGCAACAATCTTTATAATGATAGCCGGTA

Coding sequence (CDS) from alignment at scaffold_93:123239..124979

>TCONS_00073516 ID=TCONS_00073516|Name=TCONS_00073516|organism=Clytia hemisphaerica|type=CDS|length=1482bp|location=Sequence derived from alignment at scaffold_93:123239..124979 (Clytia hemisphaerica)
ATGATTAATTCAACTCCAAGCCTGAACCGATTCAGTAATGTCTCATGGAC
ACAAATAGGCCACCTTAACAACACTGGAAACAATATCAGCCACCGCAACA
ATGGGTCTACCATTTACAACACTACAGGAATCGATTTCGGTTTAATTGCG
TCACGATTCTTTTCAACTCCGACTTACATAAGTCAAGAACTCAAATGTTG
TGTCACAGAACTTTTCGATGGAGTTGATATAAATATATTGAAATCAATGG
ATGCGATGAAGGAATACATGGCACCCTGCAGCCACCATCATAACGACACT
AATGTATACGTCAGTGATGTGTTCAAATTTTATCTGAAATCGAACCATAC
TAAAGAAATGATGGAATGCAAAAGTTTTCATTGTGGTCCACAAGTCCAGG
TGACCAGCACCTTCGCTGTCTACATCACTATTTTAGTCCTGACATTCCTC
ATCGGTGTCCTTGGCAACAGCCTCGTTTGCGCTGTCATTATTAAATCCAA
TACACTTCGTAAAAGAGCTACTAACTATTTTCTACTTTCATTAGCAATTG
GTGATTTGTTATCTGGGTTGGTGATAATCCCGATCAAAATCTTCACATAT
TCAAAGAATGGGAAATTCTGTATGGGTCAAGAGATGTGTCGAATGTACAG
AAATATTGATCCGTTTATATTTACAACCTCCATAACCCATCTACTAGTCA
TATGTATTGATAGATTTATTGCTATTGACAAACCATTTTATTATCCCAGA
CTTTTctctttcaaaaatatcaaaattatgTTATCGTCTATTTGGGTTTA
CGCTTTATCTTGGGGCTTTATGAACAATGTGAATTGGAGTACGCTGCAAT
TACAAGGCACCTTCCAAATCAAAGGTTACAGATGTCTCAGGACCAGGGAT
CAATTTTCGGCTTATTTATACATGATTGTTTTTGTAGTACCATgtctcat
catggcgctccTGTACGGCCGTATGTGGCATATAGCGATGGCCCACGCTA
AAGAAATCCGCAAACGTTACAATAATTATTCAAGTCAAGCGTCGCTCGAT
AAAGTGGCAGCGCATAGCACGAAAAAGTTCATTGCAGCACGTTTATTGGA
GTTGAAAGCTACTAAAGTGATTTGTGTAGTTTTTGGAACTTTCGTAGTGT
GTTGGGTACCTTTGATCATTCTTGTGGTTATAGATACATTTATCACAAAA
GTAACTTTAGAAGGCGTTCCGTATAAAATTGTCGTAGAGTATCTACCTCT
TTTGAACAGCTCTTTGAATCCATTCATATATTGTTTCTTTCATAAAGACT
TCCAAAAAGGATTAAAACATATTTTACAAAGGATGGCTTACACGACAGCA
TTGAAATTATCACTTAACAAAAAACGTAATGGGAACGAATTGAACTCCAC
GTGTGTTGGAACCTCGATGCTTGCAAATgataatttagcagactcgatAA
GTTTGAATAATCATAGCGAAACTTGTGTATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045630XLOC_045630Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073516-proteinTCONS_00073516-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073516-exon-scaffold_93-1491911889:123239..124979TCONS_00073516-exon-scaffold_93-1491911889:123239..124979Clytia hemisphaericaexon
TCONS_00073516-exon-scaffold_93-1510915933:123239..124979TCONS_00073516-exon-scaffold_93-1510915933:123239..124979Clytia hemisphaericaexon
TCONS_00073516-exon-scaffold_93-1575043694:123239..124979TCONS_00073516-exon-scaffold_93-1575043694:123239..124979Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:123239..124979 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.045165 0 0 0 0.024678 1.81615 1.39366 0.409807 0.555956 0.351929 0.26219 0.893288 0.623791 0.144647 0.197564 1.4603 1.49676 1.50165 1.46833 0.694098 0.589744 0.477941 0.941455 0.621587 0.887603 1.2384 0.779439 0.15422 0.0785629
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
BLAST of TCONS_00073516 vs. Swiss-Prot (Human)
Match: 5HT4R (5-hydroxytryptamine receptor 4 OS=Homo sapiens GN=HTR4 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 8.887e-32
Identity = 94/316 (29.75%), Postives = 149/316 (47.15%), Query Frame = -1
Query:  362 VYITILVLTFLIGVLGNSLVCAVIIKSNTLRKRATNYFLLSLAIGDLLSGLVIIPIKIFTYSKNGKFCMGQEMCRMYRNIDPFIFTTSITHLLVICIDRFIAI-DKPFYYPRLFSFKNIKIMLSSIWVYALSWGFM------NNVNWSTLQLQGTFQIKG---YRCLRTRDQFSAYLYMIVFVVPCLIMALLYGRMWHIAMAHAKEIRK-RYNNYSSQASLDKVAAHSTKKFIAARLLELKATKVICVVFGTFVVCWVPLIILVVIDTFITKVTLEGVPYKIVVEYLPL--LNSSLNPFIYCFFHKDFQKGLKHIL 1270
            V +T L    L+ +LGN LV   +     LRK  TNYF++SLA  DLL  ++++P       ++  +  G+  C +  ++D  + T SI HL  I +DR+ AI  +P  Y    +   I +ML   WV      F+      NN+    L  +  F       Y        ++    ++ F +P L+M L Y R++  A  HA +I+  +    SS++       HST +       E KA K +C++ G F +CW P  +  ++D FI       VP ++   +L L  +NS LNPF+Y F +K F++    IL
Sbjct:   21 VLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRT----ETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYT----VPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIIL 327          
The following BLAST results are available for this feature:
BLAST of TCONS_00073516 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
5HT4R8.887e-3229.755-hydroxytryptamine receptor 4 OS=Homo sapiens GN=... [more]
back to top