Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073515 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073515
Unique NameTCONS_00073515
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1630

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073515 ID=TCONS_00073515|Name=TCONS_00073515|organism=Clytia hemisphaerica|type=transcript|length=1630bp
TAAATGATTTTCGTCGCCGGTTTTCCAGGCTAATTAATTGAATGATAACA
gttcaatattcaaaatttaTCTTCTAAgcttattattttgaaattttttc
ttctcctacagattattgaaaattgataaaCTTAACCAGAGTTTGACAAT
CCTAAAATGAATCTaaaccatggcgttctaaatctaaaGCCTAGATTTAG
AATGCCATGATCTAAATGTTATGAATGATAGATTTGACATTATGAGActt
ctttatgaaaaaaaaatattctactGTAGTTCTTTATAGTTTTCTGGTTA
ACAAAGCTCCGTCAAAGTACATCACCATCGTCATTTTCACCATTCAATTT
AATGGTCAAAGTTTCTGTTGTTCCATGACGTCGATGTTTGCCTTTGCTGT
GTCGCTTTTTCAACGACATCGCGTGCTCTTTCAAGAAGGCGTCTCGACGA
agcattttctgtaaattttcacgaaaatctTCATGGAAAAAACAATAGAT
GAATGGATTTAAACAGGAACTTAAGTTCGGGAAGTACTCCAGTAATGATA
AGACAACGTTTGAAATTTCGAAAGGTATGAAGGTATGAATAAACGTCATC
AAGCATAAAGGTGTATAACAAAGTACAAAGGTCccgaaaacaatcacaat
cacTTTTGTAGCTTTAAATTCGATTATATGACTCATCCAAAAATGTTTGC
ATGGATTATCATGGTGCGGGATAGGAGAAATAGATCCCACTAAATGTTGT
GGTGGTTTTCCCTTGTATCTTTCAATCTCTCGACTCTGCTTGACTGCAAC
TCTCCATATCTGCAGGTAGAGATAGACCATAATGACGCAGGGTAGAAAGA
AAACCACCGGGTATAAACTTCGATCAAAATAAACATCAAATTTTCTACAT
TTGTATTCAACAACTTTGAATGTTTCACCAAAGCCAAATGGTGGCGTTAG
GTGAACGTTATTCAGGATCACGCCCCAGAAAATGGCGTACGCCCATATAA
AAAAGATACATGATCGCCATCTACGCATCAAGCTGCAATGGCGGTAATAA
TATGGTTTTGTTATTGAAATATATCTATCGACAGCTATAAAGAAAAGATG
AGTGACCGAGGCTGCAAAGAATGTAACATCAGCCGTATGGAGCAATCTGC
ACAGGCTAGCTTTGTAACAAAAGTTCATGTTGTTTAGAGCGATGGCTATT
TTGATTGGAATGACGAAAACTGATACTAAGAGGTCAGTGATAGCCAAAGA
TGCGAGAATTTTGTATGTTGCATGACGGCGAAGCGAGCGGATCTTCATGA
TCATTGAGAATGAGAATAAATTTCCGCACAACGCCACAAGAAGGGTGGCT
ATGAGGATTAGGGCGTATATGATCATGGGCGGCTCTGGATCTTGACTGCA
GTGATGTTTACGACATTCCATCTCACCACTCAAGAATAAGGCAACAGTTC
GATATGAAGCATGCTTACTGTGATGGTAATCAAAATCATGTTTTTCACAA
GCTGCAGCTGTAGTTGAAATATGATTCTCGATCAGTAGCAAGCTTGACAT
ATTCTCTTTGGGTAAAGGCAGTGGCATTTCTGCAATCACCTGACTCAAAC
AACATATGTAATCTTGGTTTGGCATCGTCA
Run BLAST on NCBI

protein sequence of TCONS_00073515-protein

>TCONS_00073515-protein ID=TCONS_00073515-protein|Name=TCONS_00073515-protein|organism=Clytia hemisphaerica|type=polypeptide|length=438bp
TMPNQDYICCLSQVIAEMPLPLPKENMSSLLLIENHISTTAAACEKHDFD
YHHSKHASYRTVALFLSGEMECRKHHCSQDPEPPMIIYALILIATLLVAL
CGNLFSFSMIMKIRSLRRHATYKILASLAITDLLVSVFVIPIKIAIALNN
MNFCYKASLCRLLHTADVTFFAASVTHLFFIAVDRYISITKPYYYRHCSL
MRRWRSCIFFIWAYAIFWGVILNNVHLTPPFGFGETFKVVEYKCRKFDVY
FDRSLYPVVFFLPCVIMVYLYLQIWRVAVKQSREIERYKGKPPQHLVGSI
SPIPHHDNPCKHFWMSHIIEFKATKVIVIVFGTFVLCYTPLCLMTFIHTF
IPFEISNVVLSLLEYFPNLSSCLNPFIYCFFHEDFRENLQKMLRRDAFLK
EHAMSLKKRHSKGKHRRHGTTETLTIKLNGENDDGDVL
Run BLAST on NCBI

transcript from alignment at scaffold_93:109714..111343

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073515 ID=TCONS_00073515|Name=TCONS_00073515|organism=Clytia hemisphaerica|type=transcript|length=1630bp|location=Sequence derived from alignment at scaffold_93:109714..111343 (Clytia hemisphaerica)
TGACGATGCCAAACCAAGATTACATATGTTGTTTGAGTCAGGTGATTGCA GAAATGCCACTGCCTTTACCCAAAGAGAATATGTCAAGCTTGCTACTGAT CGAGAATCATATTTCAACTACAGCTGCAGCTTGTGAAAAACATGATTTTG ATTACCATCACAGTAAGCATGCTTCATATCGAACTGTTGCCTTATTCTTG AGTGGTGAGATGGAATGTCGTAAACATCACTGCAGTCAAGATCCAGAGCC GCCCATGATCATATACGCCCTAATCCTCATAGCCACCCTTCTTGTGGCGT TGTGCGGAAATTTATTCTCATTCTCAATGATCATGAAGATCCGCTCGCTT CGCCGTCATGCAACATACAAAATTCTCGCATCTTTGGCTATCACTGACCT CTTAGTATCAGTTTTCGTCATTCCAATCAAAATAGCCATCGCTCTAAACA ACATGAACTTTTGTTACAAAGCTAGCCTGTGCAGATTGCTCCATACGGCT GATGTTACATTCTTTGCAGCCTCGGTCACTCATCTTTTCTTTATAGCTGT CGATAGATATATTTCAATAACAAAACCATATTATTACCGCCATTGCAGCT TGATGCGTAGATGGCGATCATGTATCTTTTTTATATGGGCGTACGCCATT TTCTGGGGCGTGATCCTGAATAACGTTCACCTAACGCCACCATTTGGCTT TGGTGAAACATTCAAAGTTGTTGAATACAAATGTAGAAAATTTGATGTTT ATTTTGATCGAAGTTTATACCCGGTGGTTTTCTTTCTACCCTGCGTCATT ATGGTCTATCTCTACCTGCAGATATGGAGAGTTGCAGTCAAGCAGAGTCG AGAGATTGAAAGATACAAGGGAAAACCACCACAACATTTAGTGGGATCTA TTTCTCCTATCCCGCACCATGATAATCCATGCAAACATTTTTGGATGAGT CATATAATCGAATTTAAAGCTACAAAAgtgattgtgattgttttcggGAC CTTTGTACTTTGTTATACACCTTTATGCTTGATGACGTTTATTCATACCT TCATACCTTTCGAAATTTCAAACGTTGTCTTATCATTACTGGAGTACTTC CCGAACTTAAGTTCCTGTTTAAATCCATTCATCTATTGTTTTTTCCATGA agattttcgtgaaaatttacagaaaatgctTCGTCGAGACGCCTTCTTGA AAGAGCACGCGATGTCGTTGAAAAAGCGACACAGCAAAGGCAAACATCGA CGTCATGGAACAACAGAAACTTTGACCATTAAATTGAATGGTGAAAATGA CGATGGTGATGTACTTTGACGGAGCTTTGTTAACCAGAAAACTATAAAGA ACTACagtagaatatttttttttcataaagaagTCTCATAATGTCAAATC TATCATTCATAACATTTAGATCATGGCATTCTAAATCTAGGCtttagatt tagaacgccatggtttAGATTCATTTTAGGATTGTCAAACTCTGGTTAAG tttatcaattttcaataatctgtaggagaagaaaaaatttcaaaataata agcTTAGAAGAtaaattttgaatattgaacTGTTATCATTCAATTAATTA GCCTGGAAAACCGGCGACGAAAATCATTTA

Coding sequence (CDS) from alignment at scaffold_93:109714..111343

>TCONS_00073515 ID=TCONS_00073515|Name=TCONS_00073515|organism=Clytia hemisphaerica|type=CDS|length=1317bp|location=Sequence derived from alignment at scaffold_93:109714..111343 (Clytia hemisphaerica)
ACGATGCCAAACCAAGATTACATATGTTGTTTGAGTCAGGTGATTGCAGA
AATGCCACTGCCTTTACCCAAAGAGAATATGTCAAGCTTGCTACTGATCG
AGAATCATATTTCAACTACAGCTGCAGCTTGTGAAAAACATGATTTTGAT
TACCATCACAGTAAGCATGCTTCATATCGAACTGTTGCCTTATTCTTGAG
TGGTGAGATGGAATGTCGTAAACATCACTGCAGTCAAGATCCAGAGCCGC
CCATGATCATATACGCCCTAATCCTCATAGCCACCCTTCTTGTGGCGTTG
TGCGGAAATTTATTCTCATTCTCAATGATCATGAAGATCCGCTCGCTTCG
CCGTCATGCAACATACAAAATTCTCGCATCTTTGGCTATCACTGACCTCT
TAGTATCAGTTTTCGTCATTCCAATCAAAATAGCCATCGCTCTAAACAAC
ATGAACTTTTGTTACAAAGCTAGCCTGTGCAGATTGCTCCATACGGCTGA
TGTTACATTCTTTGCAGCCTCGGTCACTCATCTTTTCTTTATAGCTGTCG
ATAGATATATTTCAATAACAAAACCATATTATTACCGCCATTGCAGCTTG
ATGCGTAGATGGCGATCATGTATCTTTTTTATATGGGCGTACGCCATTTT
CTGGGGCGTGATCCTGAATAACGTTCACCTAACGCCACCATTTGGCTTTG
GTGAAACATTCAAAGTTGTTGAATACAAATGTAGAAAATTTGATGTTTAT
TTTGATCGAAGTTTATACCCGGTGGTTTTCTTTCTACCCTGCGTCATTAT
GGTCTATCTCTACCTGCAGATATGGAGAGTTGCAGTCAAGCAGAGTCGAG
AGATTGAAAGATACAAGGGAAAACCACCACAACATTTAGTGGGATCTATT
TCTCCTATCCCGCACCATGATAATCCATGCAAACATTTTTGGATGAGTCA
TATAATCGAATTTAAAGCTACAAAAgtgattgtgattgttttcggGACCT
TTGTACTTTGTTATACACCTTTATGCTTGATGACGTTTATTCATACCTTC
ATACCTTTCGAAATTTCAAACGTTGTCTTATCATTACTGGAGTACTTCCC
GAACTTAAGTTCCTGTTTAAATCCATTCATCTATTGTTTTTTCCATGAag
attttcgtgaaaatttacagaaaatgctTCGTCGAGACGCCTTCTTGAAA
GAGCACGCGATGTCGTTGAAAAAGCGACACAGCAAAGGCAAACATCGACG
TCATGGAACAACAGAAACTTTGACCATTAAATTGAATGGTGAAAATGACG
ATGGTGATGTACTTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045629XLOC_045629Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073515-proteinTCONS_00073515-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073515-exon-scaffold_93-1491911889:109714..111343TCONS_00073515-exon-scaffold_93-1491911889:109714..111343Clytia hemisphaericaexon
TCONS_00073515-exon-scaffold_93-1510915933:109714..111343TCONS_00073515-exon-scaffold_93-1510915933:109714..111343Clytia hemisphaericaexon
TCONS_00073515-exon-scaffold_93-1575043694:109714..111343TCONS_00073515-exon-scaffold_93-1575043694:109714..111343Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:109714..111343 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0499335 0.0730395 0.0282686 0 0.0336691 0.0266057 1.63703 2.01338 1.57792 2.57996 1.97298 3.20915 0.597765 0.327637 0.241008 0.106498 0.487303 0.864468 0.902367 0.888717 0.844874 0.883072 0.486648 1.17115 0.884588 1.43541 1.91712 2.15561 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
BLAST of TCONS_00073515 vs. Swiss-Prot (Human)
Match: DRD1 (D(1A) dopamine receptor OS=Homo sapiens GN=DRD1 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.264e-21
Identity = 86/310 (27.74%), Postives = 133/310 (42.90%), Query Frame = -3
Query:  450 GNLFSFSMIMKIRSLRRHATYKILASLAITDLLVSVFVIPIKIAIALNNMNFCYKASLCRLLHTADVTFFAASVTHLFFIAVDRYISITKPYYYRHCSLMRRWRSCIFFIWAYAIFWGVILNNVH------LTPPFGFGETFKVVEYKC-RKFDVYFDRSLYPVVFFLPCVIMVYLYLQIWRVAVKQSREI---ERYK--GKPPQHLVGSISPIPHHDNPCKHFWMSHIIEFKATKVIVIVFGTFVLCYTPLCLMTFIHTFI------PFEISNVVLSLLEYFPNLSSCLNPFIYCFFHEDFRENLQKML 1325
            GN    + +++ R LR   T   + SLA++DLLV+V V+P K    +    F    S C +    D+    AS+ +L  I+VDRY +I+ P+ Y      +     I   W  ++    I   +        +P  G   +       C       +  S   + F++P  IM+  Y +I+R+A KQ R I   ER     K  Q   G+  P+     P   F MS   E K  K + ++ G FV C+ P  ++  I  F       PF I +    +  +F   +S LNP IY  F+ DFR+    +L
Sbjct:   40 GNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI--AGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKPV-ECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYA-FNADFRKAFSTLL 345          
The following BLAST results are available for this feature:
BLAST of TCONS_00073515 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DRD11.264e-2127.74D(1A) dopamine receptor OS=Homo sapiens GN=DRD1 PE... [more]
back to top