Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073507 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073507
Unique NameTCONS_00073507
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3034

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073507 ID=TCONS_00073507|Name=TCONS_00073507|organism=Clytia hemisphaerica|type=transcript|length=3034bp
AAGAATTCTGcatccaaatttcaggtctctagaaaaatcttctggagttg
ctgcTACAGTCGAGGCGAGGTGCCAGTCTGGAAAGGAGGGAAATGTTACG
CCGGAGCTGCGCCAACTTAACTGGGAAAAGTTGAAGGCAGCAGATCTCAA
ACTTCAAATCTACGCCGGAGATAACCGCTGCAATTTCCAGACACTGGGCG
AGGTGAGAGTGTGGGAgataaaggaaaatgaaattgaaatactGACCCTT
ATTAGCATTCAAGCACCAGTGTGCACTTTCACCTGCAAAATTAATCTCTT
CAGCCATCCTTGCATGAAGATTTACTTTCTTTTGTCTACTGTTTCGACAA
ACTTTTGAGGGGGACTCCaggttgaaattttttccttgaaagcgaaagtg
aatTGGTCACATGACaggtttgtttttgtagatACCTAACCTGAGAAAGC
GCCTGAGATTGGCAAAAAGATTGAAGGCCTAGTCATAATGGTAGCACAAG
TTGTGTGTTGGGACCTCCTTCTGTGTCGCATGTAAACAAACCGACGCAGA
CAGCAGAGAGCAGACGGAGGGGAAAGAAGACGAAGATTCCAGCCAGACAG
ACGGCCTCtcttttttatttggaaatGTCTAGCAAACTGTTAAACTCAAT
TTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCATC
CTGTTCCTGTCAAGTTGACACACCATaatttgCGAAAGTTGTTTGCATAC
GCTAAAAATAAAggcaaaagtggatatccaagAATAAGcTATTCAGTCTG
GAAGCACGTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGT
TATATTTTCATACTTGTGAAATCCTTACAGAAAGAAACCAAGAACACCAT
ATGAAAAATGCTGAATCATTCAATACTAAAAACACACAACAACTTGaatc
ttcaaaagaaaagagatCAGTGGATTTGCTGAAGTTCATTCTTTACTTGT
TCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGGT
GATGAGTACCCTTCTAAACAAAAATCACAAGATCTAGATGGACGAGCTGG
AATAGGGTTAAAGAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAA
GCAATATGGCGGATATACTGGACCTCCTGGTTGAACCGGATACATTGAGC
TCAGATGTCAATGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGG
GTTTCTTATTGGTGCCACATGTGACGGAAGGACAGTCATTCCATTAGATA
GTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAATA
ATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTT
GAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGT
TACGCGGTAGAGGATATAGCTGTGGTGATGACAGCTTCAACACGAGTTTG
AATCTGAGTTTCAACGACGAAAGCTCTACTTCATCCTCGTTCACACATAC
CCCAACATCCACACGAAATTCCTCTCAAAACTCTTCTTCGCAACAATATG
ACTGGTCACACATCCAAGAACAAATCAGTAGAGATATCGACCTGACAGCT
TCTTTCAAATCATCACAACCGAACATGGTGAATAGGATATTAAGCAACTC
TAACTACGCCCCTGAATGTTCAAAGCGAATCATTTGTAATCAAGTGTGTC
ATCGAACAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAA
GTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTC
GGTCGTCATCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCG
ACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCG
TGTAAACGTATCCTTATAATATCATGTCGGAAAAGTTCGTTCAACCTGTG
CACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAGATATAACATTCA
CTCCTTATTATACCTCGTACCCAGGCCTCATAAATGATATGAATGTATGT
GGCATACCACCTGAACCTAACCTTTGGAATAATCCGTTATGCTTCGGTTT
GTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCG
AGCAATTCTTCAAATTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAG
GAATGCCCAGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCG
TGAAAGTCGGGTTGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGA
AACACGATCAAAGAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAG
GAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCC
ACCTGTACCGCCAACCCCGCCCAGGTGATATAATGGCAGTTGATAGTTAG
CAGCTTGAAAGGAGAAGATTAGATGTTTGCACCCAGCTGCTAGACCAAGG
CTGGTTTTGGATATCTCTAGAATACGCTGCAATAGTTTGGTTTGCCTTGA
TATGATGGTATATTGACGTACGAGATCGACATGACGTCACATCACACGAA
ATTTCAATAAAGAACAAAACCagctccatcaataatttcatCAACAGTTG
CAATTTACAAAAACACGCATCTTTTTTTAACTGTACAATGAACCCACAAA
TATTTTTGGATCGGTCTAAAAGCTTCCAGCAATTAAATCCAGTCATTGTC
ATTTGCGGCAATaaattatgatttttctttcaatttttttatagcaTTAA
CagaatttatttaaaaactgtaatttttttgaaaatattgagcGTGTATG
AAATTAGTATTAGTAAGAAGTTTCAATAGTACATAGATTAGAAAGTATAG
ATATTTTGAATATGTTTAGAGTTTAGaaatttaaatgatttttatgttat
tttacgtaaataaatactattttcaaaattatac
Run BLAST on NCBI

protein sequence of TCONS_00073507-protein

>TCONS_00073507-protein ID=TCONS_00073507-protein|Name=TCONS_00073507-protein|organism=Clytia hemisphaerica|type=polypeptide|length=617bp
MSSKLLNSIFLWVDPEPFDIGILPHPVPVKLTHHNLRKLFAYAKNKGKSG
YPRISYSVWKHVACNKLQIEEQLAWLYFHTCEILTERNQEHHMKNAESFN
TKNTQQLESSKEKRSVDLLKFILYLFIQRANVISLKSALVTGDEYPSKQK
SQDLDGRAGIGLKSLNEHAQMSFMASNMADILDLLVEPDTLSSDVNDMQL
TRDAVSKLGFLIGATCDGRTVIPLDSAASTQNEFQKAGYSKIMQMFSCRR
LQSWLKAHLKRNPFGTYSCLSLGQKLRGRGYSCGDDSFNTSLNLSFNDES
STSSSFTHTPTSTRNSSQNSSSQQYDWSHIQEQISRDIDLTASFKSSQPN
MVNRILSNSNYAPECSKRIICNQVCHRTVARTGDILSQSMAKVHRCQHSH
LFLLSSLRSVVIEKCHDTTIVLGSVDTLVVVIACEKIRIFAPCKRILIIS
CRKSSFNLCTPSRPVLLGKNEDITFTPYYTSYPGLINDMNVCGIPPEPNL
WNNPLCFGLSPGDEKEKKIWKECPPEQFFKFVIPFEIDGKCKECPVHLPE
KYQDALRQRESRVEDWHTMVRDSGMKHDQRKRLQSLVNERFQEWLKESGN
SSFLESLAPPVPPTPPR
Run BLAST on NCBI

transcript from alignment at scaffold_93:176977..194332-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073507 ID=TCONS_00073507|Name=TCONS_00073507|organism=Clytia hemisphaerica|type=transcript|length=17356bp|location=Sequence derived from alignment at scaffold_93:176977..194332- (Clytia hemisphaerica)
AAGAATTCTGCATCCAAATTTCAGGTCTCTAGAAAAATCTTCTGGAGTTG CTGCTACAGTCGAGGCGAGGTGCCAGTCTGGAAAGGAGGGAAATGTTACG CCGGAGCTGCGCCAACTTAACTGGGAAAAGTTGAAGGCAGCAGATCTCAA ACTTCAAATCTACGCCGGAGATAACCGCTGCAATTTCCAGACACTGGGCG AGGTGAGAGTGTGGGAGATAAAGGAAAATGAAATTGAAATACTGACCCTT ATTAGCATTCAAGCACCAGTGTGCACTTTCACCTGCAAAATTAATCTCTT CAGCCATCCTTGCATGAAGATTTACTTTCTTTTGTCTACTGTTTCGACAA ACTTTTGAGGGGGACTCCAGGTTGAAATTTTTTCCTTGAAAGCGAAAGTG AATTGGTCACATGACAGGTTTGTTTTTGTAGATACCTAACCTGAGAAAGC GCCTGAGATTGGCAAAAAGATTGAAGGCCTAGTCATAATGGTAGCACAAG TTGTGTGTTGGGACCTCCTTCTGTGTCGCATGTAAACAAACCGACGCAGA CAGCAGAGAGCAGACGGAGGGGAAAGAAGACGAAGATTCCAGCCAGACAG ACGGCCTCTCTTTTTTATTTGGAAATGTCTAGCAAACTGTTAAACTCAAT TTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCATC CTGTTCCTGTCAAGTTGACACACCATGTAAGCTTTTTTTTAAATGTTGTT GTCATTTCTTCCTGTGTCCTGCAGTTGTGTTTAACTGTAGCATACTAAGA TCTTGCAGTATATCTTAGTATTCTAAGACATAACATTATTATAACATCTT TTTAACACTCATTTCAAGTATATAACACCTTTCAGGGGTCCCTCGACAAT GAAAAACTAGCCGTATTGTATAAGGGTTGCGAAGCGATCCAGACTCCACC TCAATTCGCAAGTTGCTAGCAAAATAAGAGACACTCTAAAAATCCCTCTA NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNCTCTAATAAAGCCGCTATAGAGACAGGGTCGTAAGAGCCTTAA TGCCAAACACACCACATAATCCACGGCGGCACAACACCCGCCTCCGCCCG CGCATCACTCCTTTTTTCCTTCTAGTTATTCTAGTGTAAATGGTGCCTTA ATAAAATCGAACGGTATTCGTCGAATGATCGAACATTTTTACTCAAATCA CGAATCGTCTGTCGAAATCATCAAAACATGAAAATAAAATAAAAACAAAA ATGTACAAAGATGGTTTGTTGGTTCTTGGGTAGTTTTGATTTAATTCTTG ACAAATTCGACAAATTTAATTACCTCTGTACTTCTTTATCATAGAATATC CACTTGATTTTGCAAGGTAAGTTTCGTCCTTATCTGATATTCTGATGGCA AATTAGTGGCCACCCACTTTCAACACGCTAAAGCTCTAAAGGGAGCGGGC CAATTTCCCATCGGAGAGGAATGATAGTCAGCCTTTGATGTGCCGGCATC CTCAGTCAGGTTGAACAGTCCTTGCCCGTAAACGTAGAAATATTTCAGTT GGACCCGCCAATCCCCGAAAACGAGGGCTGGGTGTTAGCAGACCTCCCAC CCGCTGCAAAATTCTTTGACACAGTCTCACAAAATTCCGTAATGTAAACC TTCCAGATATTGAAAATTTTCCCGACCTTCAGAGCTTTAGCGTGTTGGAA GAAAATTTCACCATCTGGGTGCTAGATAAGTTTCGTTCACTAAAAGAGCA CTCCTTCCGACCCCGCGCGACTTGCAAAAACCTCTCATTGATTGACCTTA TTTTTGATATATGATACTTGCTGTTAAAAGTCGAGGGATGATGAAGATCC TTTCTGTCACCGTTCAAACTAATTTTTTTTCATTTAACAGCAAAATAAAC ATTTAAAACCGAAGAACCATGGAACCACTGCTTAGATTGCTTAGATGCGT GCCGCCCACGCGGCAATCTGATAAACTTCAGGTTCTAAGTCCGTGTTTTG GCTTCCGGTAATTTTTTTACTGTTCACTGCTAGGGTACACCATTTTAAAA TGGCATTTTTCGCAATCCTAGCTACTAAACGGAGAAAGTTTTCGTGGCTT TAAACCAAACCATTCAAGGTCATTTTGATAAAATCATCGGTTTGAAGATG TGATTTATATAGCAAATTTTCGCTTGGGATAGAAGTTAAAGGTACGTGCA CAATATAGCAAAACTGCTTCGCTCATAAATTCGCTTCGCAATAATGCCCC TAAACAAATTTTTTTTCTTTTAGTTAGTTTTAAATAAAACCCTTTCAGTC CCACGGAAGCCCACAGCAGTTCCTTTGTACCCTTCATTATTTTCCAGAAA ACCATACAGGTTCCTTACTTTCTTTATGATCCATACCATGTATGGTCCTA AATCCGACAGCCCTGCCTAAATCCGACCCCCCAAATAAACTGCTATGAAA AATATTCTATGTTTACAAACATTCCCTCTCCAAGTTGAACAATAAACTAT TGCAAGAACTCTCGAAACAAAACATCTAACATGACTATAATGTCAAGCTG TCAATTAATGTGATCAAAAAAGTGTGAGTTGTTAAAATGATTACCTTCAT TATTCTGAATCCGTTGCTCAAGTTTAAAACGTTAGCAATTTTGTAATAAA AAAATATGTTTTGTATATATAAGAAGCAATTATTGTGATTAGGTTCAATT GGTTCAGTGTATCAAATCTCTCAGTTTAGTTGACACTTTGGTATCTTCAT TGCGTCACAGCGAAAGGTTTGTTTTTATTTTAGTTTGTATCTTTGAAAAA CCCCATCGGATTTAGGCAGGGCTGTCGGATTTAGGACCACTCACGGTAAT GTTTTGGGGCAAAATATAGACCAGACGGTACTAATCGATAAATTCGATTA TTGAAGTAATCGATAATGATCGAAGTAATCGAACAACCACTTATCGATTT TAACAATCGAATGTTGTACCAAAGTTTCAAAAAAATTGTGAGTATTGAAT CACTTTCTTAACAACCCTTGGAAGACTTGATAACCGTTCGAGTACTTTGA GTACGACCCTGGACACCGCCGTACATTGCGCAGTGGAGTCTGGTGGTGAG TGTACGGTGGGCGGAACCAAACCCATTTTTACCACCGTACATGTCCCACC GTACACGAAAAAGACCGCCGTACATTGTACGGTGGGTAGCAACTCCAGAA GTCAGGCAACTTTTGTTGACGTCAAACCAAATATTTCATTTTTCCGTGAA CTTTGAACCCTTCGAATTTTTTTTCTGTGTATGCTAAAGCGTTCCGGTTT TTACTAAAAGAAAGCCCGTGATCTTAGCTTTCCAGCGGTATATAACACTG TGGACTTGGGCTAGGCTGGACTTAAAAAATTGTTGGTTTGCCGTCACCCG ACTGACCCCACCTTGAAACCTGCCCACCCAAAAATTTTTATTGCCATTTT AAAGAAGATTTTTTTTCCTTCAAAAACTTCAAACAATAAAAAATCAAAAC TGGTATCTTGTTTGTCTCAAGTATAAGAATCGTAAATTCCCTGCTAGCAC TTCTGTTTTTTATTCAAAATTACCTAAATGTAAACAAACTGTCAACCCTT CCATGGACAAAGATTTCATAAATCGCCAAAATAAAAAAAAATTCCCACCG ACCGACCCACCTCCAAAGTCTAGGGTCGGGTGACGGCAAACCAACAATTT TTTAAGCCCAGCCCTAGACGGCAAATTGTTAAAGTGCCGAACAATTTTGA AACATTTTTAAAAATTTTTTCCAACAGGAGAAAAGAAAATGCAACTACAG TATCAATGAACAAATGTTTCTGGAAATGGAGGAAAATGTAGTTGAAGGCT GAAACTCTGTATGTTTATCAGAAAAAAGGTTGAGGAATCCAAAAATCACA ATCGCTAATTTTAGTTCTTTGATTTTCATGTAGTTTTTTTTCACTTTTTT ACTTCTTTAGCATGAGAATGTCCCAAAAAAAGTTTATATTTCTGCCGAAA TGGGTTTTCTTTTCATTTGGGATTTCTCCTTTCAGAAAAACTTATTCTTT ACTTATAACTTTTTGTTCCTCCATTTCCAGAGGCCCCTTGAAAATGGGTC CTATCACCTTTTTTGATTCATTTCAACCTTTTCCAAGCTAATTTTCTTCA AAAACAAAAATAAAACAATGCAATGTCTTCTTTTTTCAAAAAAAGATATA TCTTTCGTTATTTTTTACAATATTTTTATATAATAATATTCTAACACCAT CAAAGAATTCTCCCTCCAAATTTCAGGTCTCTAGCTACACTAGAAAAAGA GGATATGCAAAATTAAAGAAGCCTGACTGGGAAATATCTTTTTTTTCTTT TTTGACACATTTTTCGAATTTTTCCAAGCTATTTTAGTCAAATTTTTGAC ACTAAAATTTGAATATCTTTACAACCACTAATCCTCTGGAGGCCTATGAC CCCTCATTTTTTTTCTTTTTCAAAGCTCTACAAGATAAAATAGGTTTTAA AAGAAAAAAAATCTTCTGGAGTTGCTACGGTGGGTAGTCAGTCTAAACTT AAACTCCTATATCAGGATTAGAAACTAGGCTAGTCTTACTTACCTCTTTT ATCTTTTCCTTTACAACAATATTTCTATTTCTATCCATTTACACGCTTTT TCTTTTATAAGAATAACTTCTATAAGAATATCAGGGTGAGATTTCGGGTT TAAAACAATAGGCCTATTGTTTAGAACAATAGACAAATAAGAATAATGCT CACCCTCAATCAAAGTACACTATTCTTATAAAAAAAAAAGCGTGTATTTG CATAAGCCTAAAAAAGCTAACATCGCAAATATTTAACAAAAACTTGTTTA TAAAAATAAAAAAGTATAAAAAGGAAGAAGAATATTATACAATGATAAAT AGTTATACAATAATGAATAGTAATAAATAGTAAGACAGTAAAAATAATAA AAAATGTTAAAATATATTGAATAAATAGTTTATTAGTTTAAAAATTCTAA AAAAAATAAAAAAAGGGGCAATTCGAAAAAGTTGGTGATCATCAAAATAC CAAAAACTTAACAAAAGAAAATTTAATGGGGAAAAAGAAAACAAGGGTAT TGAGGAGTGTAAGTGCTCAAACCTGAAGGAAAGGATAAACAGAAAGGCGG GAACTTAAGAATCTCGAAGTATAGGTGTTCTTAGTCATAACAAATTAGGT TTCATATGATTTTTCTACTTCTGTTATAAATTTATTTCTATCTAATATTA TTTGATATCTTTGATGGTAATTTGTTCCATAAGTCAATGGTGAAGGGAAA GTACGAGTTCTCATAAACTTTCAGTCTGGCATGTTGTCGATTGTATCTAA TATTTACACAGCGTTGACGTGCTGGTTTTAATTGATTGTCCACAAATTTT GAATTATTGTTGATGTCAAATAGTAANTCTTTCTTTTGTTTGTGATACGG ATAAGTTTGCATTTATCGGGATGAAATTCCATTGACCAGTTATTTTCCCA GTGAACTAAGTTGTTTAAGTCATTTTGGAGCACATGACCGTCTGCTAGCT GTTTTATAATTCTGTACAGTAGAGAATCATCTGCAGAGAGTGGAAGTGAC GACTCTACCGTTAGAGGCATGTCATTGATGTAAACGAGAAACAGCAGGGG CCCTAAAAATACAATGCTGACAAGTTGANCTTCAGACATGCTATTTGTCT TCTAGTTTCCTATGACTGCCGTTTAAGTGATTTGATCATTCGAGTTGGAC TGAAGACATATTGCCACTTGTTTTCCACCAAACAAACCGCCTTTCTTTGT ACCATTTCTAAGTTGTTGATGAGTAGCTGTGTACTATTTGGACTCCAAAC AGAGCTAGCATATTCCAAGATTGGTCGCACAAANCCCTGAGAGAAGTTTA TATCGAAATCTGCAACAAAAACGAAAGTGGTCTCTTCTACTGATTGCTTC CCAGCACTCCTTGGCAGCTGTTTATCGAATTTCCACCAATGAGGTTGCCA CATTTCAAACGGCCCTTCTTTTTGGCACCCGTGGCCTCTCAGTGCCTTGC ACGACGGGCGGCTGTAAAATCCCACCCACCCAGGAATTTTATGCGAGAGT TAGATTGTCAACAAAGTGCCGTAAAAAATCATTGAATAAAAGAAGAACTT AAAATCTTTAATATTTTCATTTTGAAGAATAGGTGCAAAAAAGTGAAACA TATAAAAGTTTAATTTTTCATTCAGTGAAAATTCCAAGCACTTTTCTGTG GCCGTTATACGGCCAGAAAACTCAATTTAAAAAAGATTTTGAGTCATAAA AAGTCGGAGAAATATAGACAGTAATAGTAAACAATAGTCAAAGTTATTTA CTCTATAATCAAAGGTAAGCTCAATTTCTCTCGCATTCTTTATATCTTTC AACATACAATATAATATTTTTTCTTCTCTCTTTGTGTGTTTTTCTCTCTT GCCATTCTTTTGACGAAATCAACATCAAAACATTCGAATCGAAGGCTCAT TAGAAAAATGTCAAAACATTTGTTTTTTTAGGGCCATTTTTTTATTGTTA CCTACAGTTTTATTTTTTTATTCTATTGTAGAGTAGAATTATTAACCGTT TTATTGATTTACTAAGAAGGCCGCTAGAAATATGTCCCATTTNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTTTTGTTCTTC AAGCAGCATTTCTTTCCATCAGGAGCCATAAGCTTTAAAAAAGACCTGTT TTAACCAGTCTAGAAGGGCTAATTTTCTAAAATTTTCTCCCGTCGGCGCC AACCATCGTGGCGCCTCCTTAGACACTAATTAAGGGACACTAAACTACGG CCCTATCATCCTAACACCTACCACTTTCAAAGTGGAGCCGCAGCCCCTAT CCATGCATGGTTAAAGTGTATTCTATTATAGTTACTAGTAAACGATAATT TTGTTTATGTTACGAAAGAAAAGTACTTATTCTTGTTGCATTTTAATTCT TGATATCATTAATAAACTCTTAACTAGGAGTCCGTTAGGGGTGGTCTCAG ATAATAGCAATGGCATGGCTGAAACTCTATTTTTCTAGATAAAAAAACGG CCAGTGGGAAAAGTGCTTGGAATTTTGCCTGTCATTGTCTCAATCGAAAT GGGGGATTTGGAAAATTTTCTATGTTTAGTTTTTTGCACAAACCCCTGTA ACTATAGGCGAGCACCCCGTTGCTAAGATGTTGGCTTGAAATCGAAAATG AAACCACTCAAAACGAAAGTAAAATGGGCCCGTACTCGAAATCCTGTAAT CTTGATATACAAGTTTAAGTCTATACTGGTAGTCGATTGGGTTAGCGAAT TCCCATTGTACACGACATGTCAGGCCGCCTTCATGTATACACCTTAGGCG GAATAAGGGCAGACTAGGTACGCGTGTGTTCTCTGATTCCCTCCCCTCAA TTGAACGATCAAAAACTAAAACTAAAAGAAAAACTCCTGGAAACAAAAGC CAAGCGAATGGAAAGTATTTCATCAACCTTGTTCCCAGCATACTATCCGC TTTTCGACGTTTACTGATTAGGCGCCAGATATTCTCTGCGGCGGCAGCGG ACGGGGGTACTTGGTTTGCAAGGTGACGGGTATAACCGAGCCAAAAGTCG ACAAATCGACCCTTTGAGAGAAAAAAATTGACCTTTTTGGGACCCTTTGA GAGATTTTCGCAAACTTTTGGGCGATTTCCCCCCTTAGAGGTAGCCCAAA AGCGGTTTGCGCGAATGCGTGAATGGGCTCTTTTGGTTGTGCGTGAATGC GTGTTGACTGCGACTGACCACAACACCCTTGTGAGCACGCGTACATCCAC TGGACAATTGTAAGGTGGTAATTCCATTTACGGTGGGATTTTGTACGGTG TTTTCGATCTAACCTAAAGTACCACCGGATACCCACCGGACACCCACCGC ACTCTACCGCGCAATGTACAGCGGTGTCCAGGGTCGTCTTTGATTGTTAT TGATTACTTTCGATAACTTTGACAACTTCGATAACCAATTAATTATTTCG ATAATCAATTACTATGAAAAAAACTGTCCTAAAACCAAAGCACAAAAAGA AGCCCCTTGTTTATTTCCCAGCCATTTTCCCTGTCAAGATCTTGCATAAT GCATACCTTTGTGGATCCGGGCTTCAGACTATTTCTTAGTATGCTGTTGG ATTCCAGTGGATTGGGTGATTGCTAGAGGAATGGGGGATATGAGAAAAAG TTTCCAATTTCATCTACCAAATAATTGAATTAGGCCTGGCCCAAATATCC CAAATATCTTAAACCACAGTAAAATTGTTTGAGAAAATGGACCTGTATGA TAAAGTAATTCTAAATTGGGCGTTTATGAATTTTTGTGGCTGTTAGGAGG GGCGTTGAAAGAAGGGGGCTTTTATTAAACAGTTTATAACGTTTATAAGG TCGCTTTAGTAAAATGAATAGGAATCTCATTTTGCCTTTTCATTATTGTT TGAGTACGAATGTTGACTCAGAGATGTAGAAACTGTCAAACTCAGTTAAA ATACTTAGCATACTACAACCTCTTACCTCTTTCAGGCCAAATTTTAGAAG GGCAAGGCAGCGTCTGTTGGTGGCCAAAAAGGGCACTTTTTCCAGTCCTT TTCCACTAAAAAGGCTGTTTTTACCAATATCTTAGTAATTTCAAGAGGGG CAGCGTCCGATAACCGGACGCTTAAAGGACATGAAAAAGTGCCTATTACT ACAACCTAATACAAGTCAAATATACCCTCTAATGTTGACATCCTTCATCT TATTCGGGACACCCTTCTTTTTTTAGAGCTGAAAAAAGTTGAAAGGTCAA AACTATTTTTCTTTGCTTAGTTGTCACAGTCAGAGAGGAAAAACCCTTTT TCAATCAGTGATTCTAACTTTCACGTTATTTCTTATAATAAAGAATGGTG TCGGAATTAGATAGGGATGTCAATATTAGACCAACTTACGGTAATTTATT AATCAGTGGTAGTATACTCTGTCATCTTAGTATGCTATGGTTAAACCTGG CTGCTATAAATTTGAGATTCCTACTGTAAATCTTTTGAGGCAGAAATCTG GCTCACATGCCTTGCATGCAAGCATTGGGTACAAATCCAAATATACATTT CCCATAGATTTTGTATGAAGACTTAGAGCTACAATGATCAAAGGGATCAA AGGCGGAAACAACAATGATATCAAACTTATTATTTATGCTGGAGTTAGGC TCGGTTGGTTTTTTTCATTATTCAGCATTATTATGATTAGCTATTAGAAG TTCTATATTCAACTATAAAAGCTTCTGCACCGCATAAATGAAACATCCTT TGTCTTTTGACAAATTTCCTTTCTCAAGACTTCTAAGCCAATCAAAAGAC AAGCACAAAAAACTTTGCCAGGTCTCTCTTGGCAACCAAATCTGCTGCTA GAGTCATTGTCATCATAAAAATCATGCTTGGATTCAGCAAACAGGTGAGC TGCCAGATTTCCAGGCTATTTGAAAATGAAAAAGGTGGAAATTGGAGCAA AAAAGGGAAGTTGATATCTGAATCTTCAGAAAGAAGAATGTAGGAATTTA AATTGACCAAGGAAAATTCTAAATCTTAGAATTCACAACTTTTTTCTGAC AATAAAGATAGAAATAATTAATTATTTCTTTCTACTACTAGAAATTCAAT TTATCTTTGCATTACACTGAAAAAGCTGAGTGTGTTTTTCTTTTTTAGAA TTTGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATC CAAGAATAAGGTATGTATTATGATTTATATGATGCTTAAAAATTGCAATT AGATAAAATGATTAAAAGATGAGGATTCAGGAAATGTCTTTGTGACTATG TTAGTGATATTATCATTGTTTGATCTTTGACCTTTGATACCTTTCAAGCC AAGGGGCAATCTACATGAAGGTATATTAAAATTTGCATACCTGAGGTTTA AAAAAGAACTGTAAAATTTGTGTAAAATAACAAAGTTATATCTCTTCTTT TTTATTGAGCTATTATACACCAAATTTGGCTAAGGCATTAAAAAAAACCT CATTTATTAGAAAAATGTTTTTTTTCACCCAATCTGTATTGCATTTTCCC AATAAAATGATTTTTGAAACAAATTTGATTTATGATAAGTTACACTTTTA GCCTTTCTTCTCTTTCCAATTCTGAAAACTAAATAAGGACAAAATACCTA TTTGTTTTAGATCTTTATGGAACGATTGAATTATTATTGGAGTAATTGTG TTATTTTTATTTTTTTTGATTTCTAGCTATTCAGTCTGGAAGCACGTAGC TTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTGTAAGTTGTTC CTTACCAAATAGGGATAACTTTTTGGTTTCCATTATATTTTCCCTTTTAA TGTTCCATTGTTTAACTTATTTTTGGAAGAAAATGTACCTTCAAATTGCT TTTGATGAATTAGGGGGATTGTAGCTTAGGCCTGTACTTAAAATAATAAT AATGATGAATGCAGCCTTTCAATTTGACCAAATTTATGACATAGTTAGTT TTTATATCCCTTTCATACTCTCAAGTACCTAATAAACTGTCTGTTTTAAA ATCTTTCAATTCTTTAATTTCTTAGTCCATATTTACCTGAGTACGTGCTC TTAGTGGAAATTCTTCAAATCTTCCTTTCAGATATTTTCATACTTGTGAA ATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAATCATT CAATACTAAAAACACACAACAACTTGGTAGGTTGCTTTCTTTTAGATGAA GATTTTGAATCAAAATACATTTCAAAGAAAGTGTTCTAAAGTAGATGTTC TGTCGTAGGATCAGCAGGTCCCCCAAGTTGTAACATTTTAACAAGGCTTT TGTCAAACTAATTGTACGGAAGAAGAAATTTTCAGTTAGTGCAGCACCAG TTTCTTAATCTGCCATTAAAATCAGGGACATAAGTAAGATAATCTCCTTT ATTTGTTAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTC ATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGC TTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACAAGATCTAG ATGGACGAGCTGGAATAGGGTTAAAGGTATGTGGACTTTAGTTTGATTCC CTAAAAAATGTGATTTTTGATAAAAGGAAAAGTATAAATCTTTTAGAAAG CTACATAAAAACTTTTTTGTATATATATATTTCTCTTTTCTCATTATTCT GGTGCTTAGATCTGTATTTTGTGTGATGTAATGATCAGCTTCTCAGAATA TTCATCTGCTCAACACATATTTTTTTAGAGTTTAAATGAGCATGCGCAAA TGTCATTTATGGCAAGCAATATGGCGGATATACTGGACCTCCTGGTTGAA CCGGATACATTGAGCTCAGATGTCAATGACATGCAACTAACAAGAGATGC TGTCAGTAAATTGGGGTTTCTTATTGGTGCCACATGTGACGGAAGGTACT GATTTTTTTACACACAATCTAATACAGAACGATTCAGATACTGATGACGA TACACCCTATGGAGCCTAGATTCTTTTTTATCAGATTTTCAGTATCTGAG TATTGGGCTAACAATCAATTTCTTGGTTTTGATTTCGAGACGTGGATTTG AGGTATCTTGCTGGTTTCAGAACCCAATCTTGTTTCATTTGACATTTGGT ATACATAAAAATGTTAAAACTCTGCTACTCGAGAAGGAAATGATTAAAAA TTGACTTTTCTTTCTGTTTGGTTTGCATTTGAAGTTATTTCTACGATTCA ATCAGCGTTCACTTTTTTTCATAATGTATCTGAAACTCGTCTTATACCAT ATTTCTATTACAGGACAGTCATTCCATTAGATAGTGCAGCCAGTACACAA AATGAATTCCAAAAAGCTGGCTACTCCAAAGTATGTACTGATTAATTCTT TTCAAATTTCAAACAGATTCATTGAATGTATAGCAATAGAAAAGTTGTCA AAACTACCTCAAGGAAAGTCTGCTTTTATAATTGATTTTGACTTCAATCT TGCATGAAAAAAAACGAAGACAAACCAGGGTTTTGCAAAAAAAATAGAGT GTTTTCCTAATTTTCTTTAGATAATGCAGATGTTTAGTTGTCGGCGTTTG CAGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAACGTATTC GTGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATATAGCTGTGGTG ATGACAGTAAGTCTGAAAAATAAGTTTTTCTGTTAGATGCTTTCAGAAGT ATCATATCGTCATGATAAGAAAATATANACAAGTCCATCTGATAGAGGCC GTCGGACGACCTCATGTCCAGGGAATGAAACTGAAAGACACTTGCTGGTC TGGGCTTTTCTTTCGAAATATATATTTTCTTTTTCCTAAGCTCAAAGGTT TTCCTTCTTTGGAGACCTCAAGGTCTGTTCAAAGAAATTGGTAGCTCGAA CATTATGATACCATTACTCGAAAGAGAAAAAAAAATATCAATCTTCATTT TGGAAAATTTTAAAGCCTTAAAATATTCCACTCAAAATAATTTTTCCACA GAGGCTTTACTTTTATTTTATCTTTTCTCCTTCAAGAGCAATGTATCAAA ATGTGCGGACTGCCAATTTTTTTGAGCAAGCAGACTGCAGTTGACATTTC ATTTGACGTTGAAATTTATTGATTGTCTTTACATAACGTAATACTTTATT TTACGAATATTTTTATACTCTTCAATCAGTCTACATCAAATACTCTTCTC GTCAACTTCTAGGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAA AGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAAATTC CTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGAAC AAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAACCG AACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGGTA TGTTCTAACGAAATTTAGTGTTCAAAGCTCTATCATTTTAGATGGATTTC TGTTTCACAGGAGTTCGGAAAGCAGATGGTCAGTACTAAAATCACAGATA TTAATGACGTGATGATGTACTAAGAAATTTTTATATATGCAGTAGTAATG AAATTTGTGATCTTATCATTTTTTGAAACTTGCTCCGAATCTTTGTAGTT ATTTGAAAAAATGTTAAATTTGAAACCGTACTAATTCTACCTGCATACTC ATGTGTAGGGTGGAAAAGCATGTGTTAGCACGAATCCAGACTACTATTCC TGTAAATCTCACTTCTCATTGTTTATCACAGTTCAAAGCGAATCATTTGT AATCAAGTGTGTCATCGAACAGTGGCTCGTACAGGAGACATCCTTTCACA AAGTATGGCTAAAGTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTAT CCTCATTACGTTCGGTCGTCATCGAGAAATGCCATGACACTACAATCGTC CTTGGGAGCGTCGACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCG AATTTTTGCACCGTGTAAACGTATCCTTATAATGTAAGTATACCGTTGGC CCTTTTACGCCGGTCCTTTTAAACCAATATTCCTGAACCTGTTTAATTAG GTAGATCATTTATATTGATGCTTAGACTGCGAAAGGTTTTATTGGTCGAA ACATTAGTTCCAAAAGTGACGACTTAAGTACCACAGCGACCGTAGTACAG TGGTAGAGCATCCGGCTACGGTTCGCAAGGTTGTGTGTTCAACCCCCAGC CGGGTCATACCAAAGATTCCCAAAATGGTACTTGATACCTCTCTGCTTGA TGCTCAGCAATTAAGAGAAGGATCAAGGNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGGAGAAATCCAGGGAGAAAGAGTGGCG CCCTCCCCTACCTTCGGGTAGATAGCTATCGAAAGAGGAGCCTTCGGGTC GCCTCCGACTGCGGTCGCCGACTTTAACCACAGCGCAGCTTTAAAAACTT CCCTGTAACAATGGATATGAGGCTGGTCTTATGTTCTGTATCAATGGTCG AGTGGTCAAAGTATCAGTATCTCAAACCAGATGTTTGTGTTTGTGGTTCG AATCCCCGCTCCTTGCAATGTTCTGTTTAGTTAAAATAGCCTATTCGGCT TGAGTTCGAAATGATTACTGGTCTATCCACGCAACCTATCGACTCTATCT ATCTTAGACTCCCATACAGGAACTGACATAAACTACAAAGTATCGAGGAA TTGGATTTCAACAATAATTCGTTTATTTCGTTTGTTCTATAGATCATGTC GGAAAAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGA AAGAACGAAGATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCT CATAAATGATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGA ATAATCCGTTATGCTTCGGTAAGACTATCAACATTTTAAATACCTCGTAC TTAGGTTCCATAAATGAAAATGATATCAAGGCATACGGTATACTAACAAA CTATACCTAACCTTTGGAATAATTCACTGTTCTAAAGAACGCGTCATCTC TATCACTTTAAATGACCAATCCGTGAAGTATCTTGTAAAAACTCCAAGGC ATCTCAATGTCTTGTAAAATTGCCCTTATTATCAAAATTCTGTCACCAAA AACTTTGCATTTTCAAAGGATTTGCGAAAGTTTTAAGTGTGAAATTTCCT TCATCAGATTAAGTCCATCGTAAAACTTAAAACATCGTAAAGGTTTTGTT TATGAATGAGAGTGATATGATATCGTTTGCCTTCTCATCAATTTTTATTT ACAAGCTTAAAAATTTACATTGTATTGACATGGATGTGGAGCAAGATTGG TGAGAAAGAGGAAAAGAAGAACAATTTTTGTTTATTCAGCATAATATAAC AAAAGGCAGACACTGTCCTGATATGAAATATGTGTCTGATATGAAACGGG ACCACTTCTGTAAAAAGAAAACCTTTAAATTTTGTTTTTCTCTTTCATAT CTTGCATTCTCCTTCATCTCAACCAATCATATTCAAAAAAGTTCAACCAA TCATTTTGCAGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGA AAGAATGTCCACCCGAGCAATTCTTCAAATTCGTCATCCCATTTGAAATT GACGGCAAGTGTAAGGTATGCCCAAAAAAGCCTTTTTATATCAAGATTTA GAATTATAAAGCATTTATTAGAGTTAATAATACCACCTCTGATATTTCAC TAATCGAATTTAAAAGCATAACACATTATTTTATAAAACATGTTAGTAAG AGACACTTGCTTCTGAATTTCTAACCTTCGTGATTTAATATTGGTTGGCC GTACTGGTGTATGCTAGAAGCTGTGGTTGAACTTCTATTGTTAAGACTAC TTTGTAAGACTAGTTTGAGGTATCGAAATTTCATAAAGAAGAAGATATTG AATGCGTTAAGTTTAATTTGTAACATGACTTTTTGGTTTCAGGAATGCCC AGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCGTGAAAGGT AGCTTGTTGAAATTTTCTCTAAGACTTTGTTCTTTATAAAAGTTTTTTTT CCAACAACTGCACTTTTTACTTTTATTATACTTCTCATCTCCTTCAAATA GCTATCTGCGATCCGTTCTCCTCAAGTTTTTTTCTAAATTGACGAGCATG AATTTTAGCCTGCGTAAGTTTCCAACTTAAATCAAAAGTTGTAATGGTTA TCATTTAGGAAATTTTGATATTTTTATTTTTGCTCCTTTTTTACAGTCGG GTTGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGAAACACGATCA AAGAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAGGTGCCGTATT TTTATACTGAATTCGAAAATGACAGTTGTAATAAAATATGCTTGCTATAG GCATACGACTTTTGTAAGTTCTGTTAGCTAAGAATACTCGCGTTTCAATG ATTTTGTCTTTTATGTTTTCAGGAATGGTTAAAAGAAAGTGGAAACAGTT CTTTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAACCCCGCCCAGGTGA TATAATGGCAGTTGATAGTTAGCAGCTTGAAAGGAGAAGATTAGATGTTT GCACCCAGCTGCTAGACCAAGGCTGGTTTTGGATATCTCTAGAATACGCT GCAATAGTTTGGTTTGCCTTGATATGATGGTATATTGACGTACGAGATCG ACATGACGTCACATCACACGAAATTTCAATAAAGAACAAAACCAGCTCCA TCAATAATTTCATCAACAGTTGCAATTTACAAAAACACGCATCTTTTTTT AACTGTACAATGAACCCACAAATATTTTTGGATCGGTCTAAAAGCTTCCA GCAATTAAATCCAGTCATTGTCATTTGCGGCAATAAATTATGATTTTTCT TTCAATTTTTTTATAGCATTAACAGAATTTATTTAAAAACTGTAATTTTT TTGAAAATATTGAGCGTGTATGAAATTAGTATTAGTAAGAAGTTTCAATA GTACATAGATTAGAAAGTATAGATATTTTGAATATGTTTAGAGTTTAGAA ATTTAAATGATTTTTATGTTATTTTACGTAAATAAATACTATTTTCAAAA TTATAC

Coding sequence (CDS) from alignment at scaffold_93:176977..194332-

>TCONS_00073507 ID=TCONS_00073507|Name=TCONS_00073507|organism=Clytia hemisphaerica|type=CDS|length=27810bp|location=Sequence derived from alignment at scaffold_93:176977..194332- (Clytia hemisphaerica)
GAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCC
ACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCATACT
ATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTTACAATC
ACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAAAAAT
ACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAGAA
AGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAATTCG
TCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAAGTTC
GTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAG
ATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCATAAATGAT
ATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAATAATCCGTT
ATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAACAGT
GGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCCATCGGT
GCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGTCATC
GAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGACACCCTCGT
TGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAACGTA
TCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAAAG
CTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAAATTCCT
CTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGAACAA
ATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAACCGAA
CATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGATAAT
GCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTTGA
AGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGTTA
CGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCATTAGAT
AGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAAG
TTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGGCGGATA
TACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTCAATGAC
ATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTGGTGC
CACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTG
AAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAA
GTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACAAG
ATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATACTTGTGA
AATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAATCAT
TCAATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGCACGTAG
CTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATTTGCGAA
AGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAGAATA
AGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCCTGAG
CCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGACACA
CCATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGG
CGCCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCA
TACTATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTTAC
AATCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAA
AAATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATG
AGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAA
TTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAA
GTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAAC
GAAGATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCATAAA
TGATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAATAATC
CGTTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAA
CAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCCAT
CGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGT
CATCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGACACCC
TCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAA
CGTATCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACG
AAAGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAAAT
TCCTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGA
ACAAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAAC
CGAACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGA
TAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCAT
TTGAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAA
GTTACGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCATT
AGATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCA
AAAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGGCG
GATATACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTCAA
TGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTG
GTGCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTT
GCTGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGT
TGAAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCA
CAAGATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATACTT
GTGAAATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAA
TCATTCAATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGCAC
GTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATTTG
CGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAG
AATAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCC
TGAGCCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGA
CACACCATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGC
TTGGCGCCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATT
GGCATACTATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGT
TTACAATCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCC
AGAAAAATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGT
GATGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTT
CAAATTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGG
AAAAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAA
GAACGAAGATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCA
TAAATGATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAAT
AATCCGTTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCAT
CGAACAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGT
CCATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGG
TCGTCATCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGAC
ACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTG
TAAACGTATCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAAC
GACGAAAGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACG
AAATTCCTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCC
AAGAACAAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCA
CAACCGAACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGA
ATGATAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGC
TCATTTGAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTC
AAAAGTTACGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTC
CATTAGATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTAC
TCCAAAAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATAT
GGCGGATATACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATG
TCAATGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTT
ATTGGTGCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGG
ATTTGCTGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATT
TCGTTGAAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAA
ATCACAAGATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCAT
ACTTGTGAAATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGC
TGAATCATTCAATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAA
GCACGTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAA
TTTGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATC
CAAGAATAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTG
ATCCTGAGCCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAG
TTGACACACCATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGA
AAGCTTGGCGCCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAA
GATTGGCATACTATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAA
GCGTTTACAATCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACC
TTCCAGAAAAATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCC
AGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAAT
TCTTCAAATTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATG
TCGGAAAAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGG
GAAAGAACGAAGATATAACATTCACTCCTTATTATACCTCGTACCCAGGC
CTCATAAATGATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTG
GAATAATCCGTTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTG
TCATCGAACAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTA
AAGTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGT
TCGGTCGTCATCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGT
CGACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCAC
CGTGTAAACGTATCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTT
CAACGACGAAAGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCA
CACGAAATTCCTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACAC
ATCCAAGAACAAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATC
ATCACAACCGAACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCC
CTGAATGATAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGA
AAGCTCATTTGAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTT
GGTCAAAAGTTACGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTC
ATTCCATTAGATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGG
CTACTCCAAAAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCA
ATATGGCGGATATACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCA
GATGTCAATGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTT
TCTTATTGGTGCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCA
GTGGATTTGCTGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGT
CATTTCGTTGAAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAAC
AAAAATCACAAGATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTT
TCATACTTGTGAAATCCTTACAGAAAGAAACCAAGAACACCATATGAAAA
ATGCTGAATCATTCAATACTAAAAACACACAACAACTTGCTATTCAGTCT
GGAAGCACGTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGG
TTAATTTGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGA
TATCCAAGAATAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGG
GTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGT
CAAGTTGACACACCATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTC
TTGAAAGCTTGGCGCCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGT
TGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGAAACACGATCAAA
GAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTT
CACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGT
CGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAG
CAATTCTTCAAATTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAGAT
CATGTCGGAAAAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTT
CTGGGAAAGAACGAAGATATAACATTCACTCCTTATTATACCTCGTACCC
AGGCCTCATAAATGATATGAATGTATGTGGCATACCACCTGAACCTAACC
TTTGGAATAATCCGTTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAG
TGTGTCATCGAACAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATG
GCTAAAGTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATT
ACGTTCGGTCGTCATCGAGAAATGCCATGACACTACAATCGTCCTTGGGA
GCGTCGACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTT
GCACCGTGTAAACGTATCCTTATAATGCTTCAACACGAGTTTGAATCTGA
GTTTCAACGACGAAAGCTCTACTTCATCCTCGTTCACACATACCCCAACA
TCCACACGAAATTCCTCTCAAAACTCTTCTTCGCAACAATATGACTGGTC
ACACATCCAAGAACAAATCAGTAGAGATATCGACCTGACAGCTTCTTTCA
AATCATCACAACCGAACATGGTGAATAGGATATTAAGCAACTCTAACTAC
GCCCCTGAATGATAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGG
TTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTC
TCTTGGTCAAAAGTTACGCGGTAGAGGATATAGCTGTGGTGATGACAGAC
AGTCATTCCATTAGATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAG
CTGGCTACTCCAAAAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCA
AGCAATATGGCGGATATACTGGACCTCCTGGTTGAACCGGATACATTGAG
CTCAGATGTCAATGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGG
GGTTTCTTATTGGTGCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAG
ATCAGTGGATTTGCTGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGA
ATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCT
AAACAAAAATCACAAGATCTAGATGGACGAGCTGGAATAGGGTTAAAGAT
ATTTTCATACTTGTGAAATCCTTACAGAAAGAAACCAAGAACACCATATG
AAAAATGCTGAATCATTCAATACTAAAAACACACAACAACTTGCTATTCA
GTCTGGAAGCACGTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGC
TTGGTTAATTTGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAG
TGGATATCCAAGAATAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCT
TTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCATCCTGTTC
CTGTCAAGTTGACACACCATGAATGGTTAAAAGAAAGTGGAAACAGTTCT
TTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAACCCCGCCCAGGTGATC
GGGTTGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGAAACACGAT
CAAAGAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAGGAATGCCC
AGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCGTGAAAGGT
TTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACC
CGAGCAATTCTTCAAATTCGTCATCCCATTTGAAATTGACGGCAAGTGTA
AGATCATGTCGGAAAAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGT
TCTTCTGGGAAAGAACGAAGATATAACATTCACTCCTTATTATACCTCGT
ACCCAGGCCTCATAAATGATATGAATGTATGTGGCATACCACCTGAACCT
AACCTTTGGAATAATCCGTTATGCTTCGTTCAAAGCGAATCATTTGTAAT
CAAGTGTGTCATCGAACAGTGGCTCGTACAGGAGACATCCTTTCACAAAG
TATGGCTAAAGTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCT
CATTACGTTCGGTCGTCATCGAGAAATGCCATGACACTACAATCGTCCTT
GGGAGCGTCGACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAAT
TTTTGCACCGTGTAAACGTATCCTTATAATGCTTCAACACGAGTTTGAAT
CTGAGTTTCAACGACGAAAGCTCTACTTCATCCTCGTTCACACATACCCC
AACATCCACACGAAATTCCTCTCAAAACTCTTCTTCGCAACAATATGACT
GGTCACACATCCAAGAACAAATCAGTAGAGATATCGACCTGACAGCTTCT
TTCAAATCATCACAACCGAACATGGTGAATAGGATATTAAGCAACTCTAA
CTACGCCCCTGAATGATAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAG
CTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAACGTATTCGTGTC
TTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATATAGCTGTGGTGATGAC
AGACAGTCATTCCATTAGATAGTGCAGCCAGTACACAAAATGAATTCCAA
AAAGCTGGCTACTCCAAAAGTTTAAATGAGCATGCGCAAATGTCATTTAT
GGCAAGCAATATGGCGGATATACTGGACCTCCTGGTTGAACCGGATACAT
TGAGCTCAGATGTCAATGACATGCAACTAACAAGAGATGCTGTCAGTAAA
TTGGGGTTTCTTATTGGTGCCACATGTGACGGAAGAATCTTCAAAAGAAA
AGAGATCAGTGGATTTGCTGAAGTTCATTCTTTACTTGTTCATCCAACGT
GCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGGTGATGAGTACCC
TTCTAAACAAAAATCACAAGATCTAGATGGACGAGCTGGAATAGGGTTAA
AGATATTTTCATACTTGTGAAATCCTTACAGAAAGAAACCAAGAACACCA
TATGAAAAATGCTGAATCATTCAATACTAAAAACACACAACAACTTGCTA
TTCAGTCTGGAAGCACGTAGCTTGTAACAAATTACAAATTGAAGAACAAT
TAGCTTGGTTAATTTGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCA
AAAGTGGATATCCAAGAATAAGATGTCTAGCAAACTGTTAAACTCAATTT
TCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCATCCT
GTTCCTGTCAAGTTGACACACCATGAATGGTTAAAAGAAAGTGGAAACAG
TTCTTTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAACCCCGCCCAGGT
GATCGGGTTGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGAAACA
CGATCAAAGAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAGGAAT
GCCCAGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCGTGAA
AGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAATGTC
CACCCGAGCAATTCTTCAAATTCGTCATCCCATTTGAAATTGACGGCAAG
TGTAAGATCATGTCGGAAAAGTTCGTTCAACCTGTGCACACCCTCCAGAC
CAGTTCTTCTGGGAAAGAACGAAGATATAACATTCACTCCTTATTATACC
TCGTACCCAGGCCTCATAAATGATATGAATGTATGTGGCATACCACCTGA
ACCTAACCTTTGGAATAATCCGTTATGCTTCGTTCAAAGCGAATCATTTG
TAATCAAGTGTGTCATCGAACAGTGGCTCGTACAGGAGACATCCTTTCAC
AAAGTATGGCTAAAGTCCATCGGTGCCAACATTCTCATCTCTTCCTTTTA
TCCTCATTACGTTCGGTCGTCATCGAGAAATGCCATGACACTACAATCGT
CCTTGGGAGCGTCGACACCCTCGTTGTCGTTATAGCTTGTGAAAAAATCC
GAATTTTTGCACCGTGTAAACGTATCCTTATAATGCTTCAACACGAGTTT
GAATCTGAGTTTCAACGACGAAAGCTCTACTTCATCCTCGTTCACACATA
CCCCAACATCCACACGAAATTCCTCTCAAAACTCTTCTTCGCAACAATAT
GACTGGTCACACATCCAAGAACAAATCAGTAGAGATATCGACCTGACAGC
TTCTTTCAAATCATCACAACCGAACATGGTGAATAGGATATTAAGCAACT
CTAACTACGCCCCTGAATGATAATGCAGATGTTTAGTTGTCGGCGTTTGC
AGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAACGTATTCG
TGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATATAGCTGTGGTGA
TGACAGACAGTCATTCCATTAGATAGTGCAGCCAGTACACAAAATGAATT
CCAAAAAGCTGGCTACTCCAAAAGTTTAAATGAGCATGCGCAAATGTCAT
TTATGGCAAGCAATATGGCGGATATACTGGACCTCCTGGTTGAACCGGAT
ACATTGAGCTCAGATGTCAATGACATGCAACTAACAAGAGATGCTGTCAG
TAAATTGGGGTTTCTTATTGGTGCCACATGTGACGGAAGAATCTTCAAAA
GAAAAGAGATCAGTGGATTTGCTGAAGTTCATTCTTTACTTGTTCATCCA
ACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGGTGATGAGT
ACCCTTCTAAACAAAAATCACAAGATCTAGATGGACGAGCTGGAATAGGG
TTAAAGATATTTTCATACTTGTGAAATCCTTACAGAAAGAAACCAAGAAC
ACCATATGAAAAATGCTGAATCATTCAATACTAAAAACACACAACAACTT
GCTATTCAGTCTGGAAGCACGTAGCTTGTAACAAATTACAAATTGAAGAA
CAATTAGCTTGGTTAATTTGCGAAAGTTGTTTGCATACGCTAAAAATAAA
GGCAAAAGTGGATATCCAAGAATAAGATGTCTAGCAAACTGTTAAACTCA
ATTTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTCCTCA
TCCTGTTCCTGTCAAGTTGACACACCATGAATGGTTAAAAGAAAGTGGAA
ACAGTTCTTTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAACCCCGCCC
AGGTGATCGGGTTGAAGATTGGCATACTATGGTGAGAGACTCGGGAATGA
AACACGATCAAAGAAAGCGTTTACAATCACTTGTTAATGAGAGATTCCAG
GAATGCCCAGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGACAGCG
TGAAAGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAAAGAA
TGTCCACCCGAGCAATTCTTCAAATTCGTCATCCCATTTGAAATTGACGG
CAAGTGTAAGATCATGTCGGAAAAGTTCGTTCAACCTGTGCACACCCTCC
AGACCAGTTCTTCTGGGAAAGAACGAAGATATAACATTCACTCCTTATTA
TACCTCGTACCCAGGCCTCATAAATGATATGAATGTATGTGGCATACCAC
CTGAACCTAACCTTTGGAATAATCCGTTATGCTTCGTTCAAAGCGAATCA
TTTGTAATCAAGTGTGTCATCGAACAGTGGCTCGTACAGGAGACATCCTT
TCACAAAGTATGGCTAAAGTCCATCGGTGCCAACATTCTCATCTCTTCCT
TTTATCCTCATTACGTTCGGTCGTCATCGAGAAATGCCATGACACTACAA
TCGTCCTTGGGAGCGTCGACACCCTCGTTGTCGTTATAGCTTGTGAAAAA
ATCCGAATTTTTGCACCGTGTAAACGTATCCTTATAATGCTTCAACACGA
GTTTGAATCTGAGTTTCAACGACGAAAGCTCTACTTCATCCTCGTTCACA
CATACCCCAACATCCACACGAAATTCCTCTCAAAACTCTTCTTCGCAACA
ATATGACTGGTCACACATCCAAGAACAAATCAGTAGAGATATCGACCTGA
CAGCTTCTTTCAAATCATCACAACCGAACATGGTGAATAGGATATTAAGC
AACTCTAACTACGCCCCTGAATGATAATGCAGATGTTTAGTTGTCGGCGT
TTGCAGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAACGTA
TTCGTGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATATAGCTGTG
GTGATGACAGACAGTCATTCCATTAGATAGTGCAGCCAGTACACAAAATG
AATTCCAAAAAGCTGGCTACTCCAAAAGTTTAAATGAGCATGCGCAAATG
TCATTTATGGCAAGCAATATGGCGGATATACTGGACCTCCTGGTTGAACC
GGATACATTGAGCTCAGATGTCAATGACATGCAACTAACAAGAGATGCTG
TCAGTAAATTGGGGTTTCTTATTGGTGCCACATGTGACGGAAGAATCTTC
AAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTCATTCTTTACTTGTTCA
TCCAACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGGTGAT
GAGTACCCTTCTAAACAAAAATCACAAGATCTAGATGGACGAGCTGGAAT
AGGGTTAAAGATATTTTCATACTTGTGAAATCCTTACAGAAAGAAACCAA
GAACACCATATGAAAAATGCTGAATCATTCAATACTAAAAACACACAACA
ACTTGCTATTCAGTCTGGAAGCACGTAGCTTGTAACAAATTACAAATTGA
AGAACAATTAGCTTGGTTAATTTGCGAAAGTTGTTTGCATACGCTAAAAA
TAAAGGCAAAAGTGGATATCCAAGAATAAGATGTCTAGCAAACTGTTAAA
CTCAATTTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATCCTTC
CTCATCCTGTTCCTGTCAAGTTGACACACCATGAATGGTTAAAAGAAAGT
GGAAACAGTTCTTTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAACCCC
GCCCAGGTGATCGGGTTGAAGATTGGCATACTATGGTGAGAGACTCGGGA
ATGAAACACGATCAAAGAAAGCGTTTACAATCACTTGTTAATGAGAGATT
CCAGGAATGCCCAGTTCACCTTCCAGAAAAATACCAAGATGCACTTCGAC
AGCGTGAAAGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTTGGAA
AGAATGTCCACCCGAGCAATTCTTCAAATTCGTCATCCCATTTGAAATTG
ACGGCAAGTGTAAGATCATGTCGGAAAAGTTCGTTCAACCTGTGCACACC
CTCCAGACCAGTTCTTCTGGGAAAGAACGAAGATATAACATTCACTCCTT
ATTATACCTCGTACCCAGGCCTCATAAATGATATGAATGTATGTGGCATA
CCACCTGAACCTAACCTTTGGAATAATCCGTTATGCTTCGTTCAAAGCGA
ATCATTTGTAATCAAGTGTGTCATCGAACAGTGGCTCGTACAGGAGACAT
CCTTTCACAAAGTATGGCTAAAGTCCATCGGTGCCAACATTCTCATCTCT
TCCTTTTATCCTCATTACGTTCGGTCGTCATCGAGAAATGCCATGACACT
ACAATCGTCCTTGGGAGCGTCGACACCCTCGTTGTCGTTATAGCTTGTGA
AAAAATCCGAATTTTTGCACCGTGTAAACGTATCCTTATAATGCTTCAAC
ACGAGTTTGAATCTGAGTTTCAACGACGAAAGCTCTACTTCATCCTCGTT
CACACATACCCCAACATCCACACGAAATTCCTCTCAAAACTCTTCTTCGC
AACAATATGACTGGTCACACATCCAAGAACAAATCAGTAGAGATATCGAC
CTGACAGCTTCTTTCAAATCATCACAACCGAACATGGTGAATAGGATATT
AAGCAACTCTAACTACGCCCCTGAATGATAATGCAGATGTTTAGTTGTCG
GCGTTTGCAGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTTGGAA
CGTATTCGTGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATATAGC
TGTGGTGATGACAGACAGTCATTCCATTAGATAGTGCAGCCAGTACACAA
AATGAATTCCAAAAAGCTGGCTACTCCAAAAGTTTAAATGAGCATGCGCA
AATGTCATTTATGGCAAGCAATATGGCGGATATACTGGACCTCCTGGTTG
AACCGGATACATTGAGCTCAGATGTCAATGACATGCAACTAACAAGAGAT
GCTGTCAGTAAATTGGGGTTTCTTATTGGTGCCACATGTGACGGAAGAAT
CTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTCATTCTTTACTTG
TTCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGACAGG
TGATGAGTACCCTTCTAAACAAAAATCACAAGATCTAGATGGACGAGCTG
GAATAGGGTTAAAGATATTTTCATACTTGTGAAATCCTTACAGAAAGAAA
CCAAGAACACCATATGAAAAATGCTGAATCATTCAATACTAAAAACACAC
AACAACTTGCTATTCAGTCTGGAAGCACGTAGCTTGTAACAAATTACAAA
TTGAAGAACAATTAGCTTGGTTAATTTGCGAAAGTTGTTTGCATACGCTA
AAAATAAAGGCAAAAGTGGATATCCAAGAATAAGATGTCTAGCAAACTGT
TAAACTCAATTTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGGAATC
CTTCCTCATCCTGTTCCTGTCAAGTTGACACACCATGAATGGTTAAAAGA
AAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCCACCTGTACCGCCAA
CCCCGCCCAGGTGATCGGGTTGAAGATTGGCATACTATGGTGAGAGACTC
GGGAATGAAACACGATCAAAGAAAGCGTTTACAATCACTTGTTAATGAGA
GATTCCAGGAATGCCCAGTTCACCTTCCAGAAAAATACCAAGATGCACTT
CGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAGATTT
GGAAAGAATGTCCACCCGAGCAATTCTTCAAATTCGTCATCCCATTTGAA
ATTGACGGCAAGTGTAAGATCATGTCGGAAAAGTTCGTTCAACCTGTGCA
CACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAGATATAACATTCACT
CCTTATTATACCTCGTACCCAGGCCTCATAAATGATATGAATGTATGTGG
CATACCACCTGAACCTAACCTTTGGAATAATCCGTTATGCTTCGTTCAAA
GCGAATCATTTGTAATCAAGTGTGTCATCGAACAGTGGCTCGTACAGGAG
ACATCCTTTCACAAAGTATGGCTAAAGTCCATCGGTGCCAACATTCTCAT
CTCTTCCTTTTATCCTCATTACGTTCGGTCGTCATCGAGAAATGCCATGA
CACTACAATCGTCCTTGGGAGCGTCGACACCCTCGTTGTCGTTATAGCTT
GTGAAAAAATCCGAATTTTTGCACCGTGTAAACGTATCCTTATAATGCTT
CAACACGAGTTTGAATCTGAGTTTCAACGACGAAAGCTCTACTTCATCCT
CGTTCACACATACCCCAACATCCACACGAAATTCCTCTCAAAACTCTTCT
TCGCAACAATATGACTGGTCACACATCCAAGAACAAATCAGTAGAGATAT
CGACCTGACAGCTTCTTTCAAATCATCACAACCGAACATGGTGAATAGGA
TATTAAGCAACTCTAACTACGCCCCTGAATGATAATGCAGATGTTTAGTT
GTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCCCTTT
GGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAGGATA
TAGCTGTGGTGATGACAGACAGTCATTCCATTAGATAGTGCAGCCAGTAC
ACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAAGTTTAAATGAGCATG
CGCAAATGTCATTTATGGCAAGCAATATGGCGGATATACTGGACCTCCTG
GTTGAACCGGATACATTGAGCTCAGATGTCAATGACATGCAACTAACAAG
AGATGCTGTCAGTAAATTGGGGTTTCTTATTGGTGCCACATGTGACGGAA
GAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTCATTCTTTA
CTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTGGTGA
CAGGTGATGAGTACCCTTCTAAACAAAAATCACAAGATCTAGATGGACGA
GCTGGAATAGGGTTAAAGATATTTTCATACTTGTGAAATCCTTACAGAAA
GAAACCAAGAACACCATATGAAAAATGCTGAATCATTCAATACTAAAAAC
ACACAACAACTTGCTATTCAGTCTGGAAGCACGTAGCTTGTAACAAATTA
CAAATTGAAGAACAATTAGCTTGGTTAATTTGCGAAAGTTGTTTGCATAC
GCTAAAAATAAAGGCAAAAGTGGATATCCAAGAATAAGATGTCTAGCAAA
CTGTTAAACTCAATTTTCCTTTGGGTTGATCCTGAGCCATTCGATATTGG
AATCCTTCCTCATCCTGTTCCTGTCAAGTTGACACACCATGAATGGTTAA
AAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCCACCTGTACCG
CCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCATACTATGGTGAGAG
ACTCGGGAATGAAACACGATCAAAGAAAGCGTTTACAATCACTTGTTAAT
GAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAAAAATACCAAGATGC
ACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAGAAAGAGAAGAAG
ATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAATTCGTCATCCCATT
TGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAAGTTCGTTCAACCTG
TGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAGATATAACATT
CACTCCTTATTATACCTCGTACCCAGGCCTCATAAATGATATGAATGTAT
GTGGCATACCACCTGAACCTAACCTTTGGAATAATCCGTTATGCTTCGTT
CAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAACAGTGGCTCGTACA
GGAGACATCCTTTCACAAAGTATGGCTAAAGTCCATCGGTGCCAACATTC
TCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGTCATCGAGAAATGCC
ATGACACTACAATCGTCCTTGGGAGCGTCGACACCCTCGTTGTCGTTATA
GCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAACGTATCCTTATAAT
GCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAAAGCTCTACTTCA
TCCTCGTTCACACATACCCCAACATCCACACGAAATTCCTCTCAAAACTC
TTCTTCGCAACAATATGACTGGTCACACATCCAAGAACAAATCAGTAGAG
ATATCGACCTGACAGCTTCTTTCAAATCATCACAACCGAACATGGTGAAT
AGGATATTAAGCAACTCTAACTACGCCCCTGAATGATAATGCAGATGTTT
AGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTTGAAGCGAAATCC
CTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGTTACGCGGTAGAG
GATATAGCTGTGGTGATGACAGACAGTCATTCCATTAGATAGTGCAGCCA
GTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAAGTTTAAATGAG
CATGCGCAAATGTCATTTATGGCAAGCAATATGGCGGATATACTGGACCT
CCTGGTTGAACCGGATACATTGAGCTCAGATGTCAATGACATGCAACTAA
CAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTGGTGCCACATGTGAC
GGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTCATTC
TTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGCTTTG
GTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACAAGATCTAGATGG
ACGAGCTGGAATAGGGTTAAAGATATTTTCATACTTGTGAAATCCTTACA
GAAAGAAACCAAGAACACCATATGAAAAATGCTGAATCATTCAATACTAA
AAACACACAACAACTTGCTATTCAGTCTGGAAGCACGTAGCTTGTAACAA
ATTACAAATTGAAGAACAATTAGCTTGGTTAATTTGCGAAAGTTGTTTGC
ATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAGAATAAGATGTCTAG
CAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCCTGAGCCATTCGATA
TTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGACACACCATGAATGG
TTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCCACCTGT
ACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCATACTATGGTG
AGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTTACAATCACTTGT
TAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAAAAATACCAAG
ATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAGAAAGAGAA
GAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAATTCGTCATCC
CATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAAGTTCGTTCAA
CCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAGATATAA
CATTCACTCCTTATTATACCTCGTACCCAGGCCTCATAAATGATATGAAT
GTATGTGGCATACCACCTGAACCTAACCTTTGGAATAATCCGTTATGCTT
CGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAACAGTGGCTCG
TACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCCATCGGTGCCAAC
ATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGTCATCGAGAAA
TGCCATGACACTACAATCGTCCTTGGGAGCGTCGACACCCTCGTTGTCGT
TATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAACGTATCCTTA
TAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAAAGCTCTAC
TTCATCCTCGTTCACACATACCCCAACATCCACACGAAATTCCTCTCAAA
ACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGAACAAATCAGT
AGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAACCGAACATGGT
GAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGATAATGCAGAT
GTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTTGAAGCGAA
ATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGTTACGCGGT
AGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCATTAGATAGTGCA
GCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAAGTTTAAA
TGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGGCGGATATACTGG
ACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTCAATGACATGCAA
CTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTGGTGCCACATG
TGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAAGTTC
ATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAAGTCAGC
TTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACAAGATCTAG
ATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATACTTGTGAAATCCT
TACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAATCATTCAATA
CTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGCACGTAGCTTGTA
ACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATTTGCGAAAGTTGT
TTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAGAATAAGATGT
CTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCCTGAGCCATTC
GATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGACACACCATGA
ATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCGCCAC
CTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCATACTAT
GGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTTACAATCAC
TTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAAAAATAC
CAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAGAAAG
AGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAATTCGTC
ATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAAGTTCGT
TCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGAAGAT
ATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCATAAATGATAT
GAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAATAATCCGTTAT
GCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAACAGTGG
CTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCCATCGGTGC
CAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGTCATCGA
GAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGACACCCTCGTTG
TCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAACGTATC
CTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAAAGCT
CTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAAATTCCTCT
CAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGAACAAAT
CAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAACCGAACA
TGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGATAATGC
AGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTTGAAG
CGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGTTACG
CGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCATTAGATAG
TGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAAAGTT
TAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGGCGGATATA
CTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTCAATGACAT
GCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTGGTGCCA
CATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGCTGAA
GTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTGAAGT
CAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACAAGAT
CTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATACTTGTGAAA
TCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAATCATTC
AATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGCACGTAGCT
TGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATTTGCGAAAG
TTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAGAATAAG
ATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCCTGAGCC
ATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGACACACC
ATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTTGGCG
CCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGGCATA
CTATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTTACAA
TCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAGAAAA
ATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGATGAG
AAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCAAATT
CGTCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAAAAGT
TCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGAACGA
AGATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCATAAATG
ATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAATAATCCG
TTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCGAACA
GTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCCATCG
GTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTCGTCA
TCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGACACCCTC
GTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTAAACG
TATCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGACGAA
AGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAAATTC
CTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAAGAAC
AAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACAACCG
AACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAATGATA
ATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTCATTT
GAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAAAAGT
TACGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCATTAG
ATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTCCAAA
AGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGGCGGA
TATACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTCAATG
ACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTATTGGT
GCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGATTTGC
TGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTCGTTG
AAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAATCACA
AGATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATACTTGT
GAAATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTGAATC
ATTCAATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGCACGT
AGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATTTGCG
AAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCAAGAA
TAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGATCCTG
AGCCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTTGACA
CACCATGAATGGTTAAAAGAAAGTGGAAACAGTTCTTTTCTTGAAAGCTT
GGCGCCACCTGTACCGCCAACCCCGCCCAGGTGATCGGGTTGAAGATTGG
CATACTATGGTGAGAGACTCGGGAATGAAACACGATCAAAGAAAGCGTTT
ACAATCACTTGTTAATGAGAGATTCCAGGAATGCCCAGTTCACCTTCCAG
AAAAATACCAAGATGCACTTCGACAGCGTGAAAGGTTTGTCGCCAGGTGA
TGAGAAAGAGAAGAAGATTTGGAAAGAATGTCCACCCGAGCAATTCTTCA
AATTCGTCATCCCATTTGAAATTGACGGCAAGTGTAAGATCATGTCGGAA
AAGTTCGTTCAACCTGTGCACACCCTCCAGACCAGTTCTTCTGGGAAAGA
ACGAAGATATAACATTCACTCCTTATTATACCTCGTACCCAGGCCTCATA
AATGATATGAATGTATGTGGCATACCACCTGAACCTAACCTTTGGAATAA
TCCGTTATGCTTCGTTCAAAGCGAATCATTTGTAATCAAGTGTGTCATCG
AACAGTGGCTCGTACAGGAGACATCCTTTCACAAAGTATGGCTAAAGTCC
ATCGGTGCCAACATTCTCATCTCTTCCTTTTATCCTCATTACGTTCGGTC
GTCATCGAGAAATGCCATGACACTACAATCGTCCTTGGGAGCGTCGACAC
CCTCGTTGTCGTTATAGCTTGTGAAAAAATCCGAATTTTTGCACCGTGTA
AACGTATCCTTATAATGCTTCAACACGAGTTTGAATCTGAGTTTCAACGA
CGAAAGCTCTACTTCATCCTCGTTCACACATACCCCAACATCCACACGAA
ATTCCTCTCAAAACTCTTCTTCGCAACAATATGACTGGTCACACATCCAA
GAACAAATCAGTAGAGATATCGACCTGACAGCTTCTTTCAAATCATCACA
ACCGAACATGGTGAATAGGATATTAAGCAACTCTAACTACGCCCCTGAAT
GATAATGCAGATGTTTAGTTGTCGGCGTTTGCAGAGCTGGTTGAAAGCTC
ATTTGAAGCGAAATCCCTTTGGAACGTATTCGTGTCTTTCTCTTGGTCAA
AAGTTACGCGGTAGAGGATATAGCTGTGGTGATGACAGACAGTCATTCCA
TTAGATAGTGCAGCCAGTACACAAAATGAATTCCAAAAAGCTGGCTACTC
CAAAAGTTTAAATGAGCATGCGCAAATGTCATTTATGGCAAGCAATATGG
CGGATATACTGGACCTCCTGGTTGAACCGGATACATTGAGCTCAGATGTC
AATGACATGCAACTAACAAGAGATGCTGTCAGTAAATTGGGGTTTCTTAT
TGGTGCCACATGTGACGGAAGAATCTTCAAAAGAAAAGAGATCAGTGGAT
TTGCTGAAGTTCATTCTTTACTTGTTCATCCAACGTGCGAATGTCATTTC
GTTGAAGTCAGCTTTGGTGACAGGTGATGAGTACCCTTCTAAACAAAAAT
CACAAGATCTAGATGGACGAGCTGGAATAGGGTTAAAGATATTTTCATAC
TTGTGAAATCCTTACAGAAAGAAACCAAGAACACCATATGAAAAATGCTG
AATCATTCAATACTAAAAACACACAACAACTTGCTATTCAGTCTGGAAGC
ACGTAGCTTGTAACAAATTACAAATTGAAGAACAATTAGCTTGGTTAATT
TGCGAAAGTTGTTTGCATACGCTAAAAATAAAGGCAAAAGTGGATATCCA
AGAATAAGATGTCTAGCAAACTGTTAAACTCAATTTTCCTTTGGGTTGAT
CCTGAGCCATTCGATATTGGAATCCTTCCTCATCCTGTTCCTGTCAAGTT
GACACACCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045622XLOC_045622Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073507-proteinTCONS_00073507-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073507-exon-scaffold_93-1575043694:193607..194332TCONS_00073507-exon-scaffold_93-1575043694:193607..194332Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:184173..184234TCONS_00073507-exon-scaffold_93-1575043694:184173..184234Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:183594..183656TCONS_00073507-exon-scaffold_93-1575043694:183594..183656Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:183157..183251TCONS_00073507-exon-scaffold_93-1575043694:183157..183251Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:182757..182923TCONS_00073507-exon-scaffold_93-1575043694:182757..182923Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:182388..182554TCONS_00073507-exon-scaffold_93-1575043694:182388..182554Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:181953..182019TCONS_00073507-exon-scaffold_93-1575043694:181953..182019Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:181627..181762TCONS_00073507-exon-scaffold_93-1575043694:181627..181762Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:180836..181070TCONS_00073507-exon-scaffold_93-1575043694:180836..181070Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:180250..180501TCONS_00073507-exon-scaffold_93-1575043694:180250..180501Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:179215..179390TCONS_00073507-exon-scaffold_93-1575043694:179215..179390Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:178468..178571TCONS_00073507-exon-scaffold_93-1575043694:178468..178571Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:178085..178140TCONS_00073507-exon-scaffold_93-1575043694:178085..178140Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:177743..177836TCONS_00073507-exon-scaffold_93-1575043694:177743..177836Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1575043694:176977..177610TCONS_00073507-exon-scaffold_93-1575043694:176977..177610Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:193607..194332TCONS_00073507-exon-scaffold_93-1510915933:193607..194332Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:184173..184234TCONS_00073507-exon-scaffold_93-1510915933:184173..184234Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:183594..183656TCONS_00073507-exon-scaffold_93-1510915933:183594..183656Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:183157..183251TCONS_00073507-exon-scaffold_93-1510915933:183157..183251Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:182757..182923TCONS_00073507-exon-scaffold_93-1510915933:182757..182923Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:182388..182554TCONS_00073507-exon-scaffold_93-1510915933:182388..182554Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:181953..182019TCONS_00073507-exon-scaffold_93-1510915933:181953..182019Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:181627..181762TCONS_00073507-exon-scaffold_93-1510915933:181627..181762Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:180836..181070TCONS_00073507-exon-scaffold_93-1510915933:180836..181070Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:180250..180501TCONS_00073507-exon-scaffold_93-1510915933:180250..180501Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:179215..179390TCONS_00073507-exon-scaffold_93-1510915933:179215..179390Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:178468..178571TCONS_00073507-exon-scaffold_93-1510915933:178468..178571Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:178085..178140TCONS_00073507-exon-scaffold_93-1510915933:178085..178140Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:177743..177836TCONS_00073507-exon-scaffold_93-1510915933:177743..177836Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1510915933:176977..177610TCONS_00073507-exon-scaffold_93-1510915933:176977..177610Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:193607..194332TCONS_00073507-exon-scaffold_93-1491911889:193607..194332Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:184173..184234TCONS_00073507-exon-scaffold_93-1491911889:184173..184234Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:183594..183656TCONS_00073507-exon-scaffold_93-1491911889:183594..183656Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:183157..183251TCONS_00073507-exon-scaffold_93-1491911889:183157..183251Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:182757..182923TCONS_00073507-exon-scaffold_93-1491911889:182757..182923Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:182388..182554TCONS_00073507-exon-scaffold_93-1491911889:182388..182554Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:181953..182019TCONS_00073507-exon-scaffold_93-1491911889:181953..182019Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:181627..181762TCONS_00073507-exon-scaffold_93-1491911889:181627..181762Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:180836..181070TCONS_00073507-exon-scaffold_93-1491911889:180836..181070Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:180250..180501TCONS_00073507-exon-scaffold_93-1491911889:180250..180501Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:179215..179390TCONS_00073507-exon-scaffold_93-1491911889:179215..179390Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:178468..178571TCONS_00073507-exon-scaffold_93-1491911889:178468..178571Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:178085..178140TCONS_00073507-exon-scaffold_93-1491911889:178085..178140Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:177743..177836TCONS_00073507-exon-scaffold_93-1491911889:177743..177836Clytia hemisphaericaexon
TCONS_00073507-exon-scaffold_93-1491911889:176977..177610TCONS_00073507-exon-scaffold_93-1491911889:176977..177610Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:176977..194332 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
15.9532 16.4654 3.10175 1.67366 12.1436 10.0114 8.10103 8.95148 4.61131 7.03943 6.56187 4.2723 5.51734 5.47151 5.68775 7.54151 7.02105 7.77616 3.34942 2.97598 3.47996 4.19924 18.9241 16.9904 13.9783 15.2345 4.47564 2.78755 12.3866 13.1568
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006599CARP_motif
IPR012945Tubulin-bd_cofactor_C_dom
IPR017901C-CAP_CF_C-like
Blast
BLAST of TCONS_00073507 vs. Swiss-Prot (Human)
Match: TBCC1 (TBCC domain-containing protein 1 OS=Homo sapiens GN=TBCCD1 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 5.977e-96
Identity = 197/609 (32.35%), Postives = 330/609 (54.19%), Query Frame = 1
Query:  649 IFLWVDPEPFDIGILPHPVPVKLTHHNLRKLFAYAKNKGKSG-YPRISYSVWKHVACNKLQIEEQLAWLYFHTCEILTERNQEHHMKNAESF-NTKNTQQLESSKEKRSVDLLKFILYLFIQRANVISLKSALVTGDEYPS---KQKSQDLDGRAGIGLKSLNEHAQMSFMASNMADILDLLVEPDTLSSDVNDMQ---LTRDAVSKLGFLI-GATCDGRTVIPLDSAASTQNEFQKAGYSKIMQMFSCRRLQSWLKAHLKRNPFGTYSCLSLGQKLRGRGYSCGDDSFNTSLNLSFNDEXXXXXXXXXXXXXXRXXXXXXXXXXYDWSHIQEQISRDIDLTASFKSSQPNMVNRILSNSNYAPECSKRIICNQVCHRTVARTGDILSQSMAKVHRCQXXXXXXXXXXXXVVIEKCHDTTIVLGSVDTLVVVIACEKIRIFAPCKRILIISCRKSSFNLCTPSRPVLLGKNEDITFTPYYTSYPGLINDMNVCGIPPEPNLWNNPLCFGLSPGDEKEKKIWKECPPEQFFKFVIPFEIDGKCKECPVHLPEKYQDALRQRESRVEDWHTMVRDSGMKHDQRKRLQSLVNERFQEWLKESGNSSFLESLA 2448
            + LWV  EPF +G L  P P K + H LRK+  Y + +   G YPR+ +S W+H+AC KLQ+ + LAWLYF   + L+ +  E  ++ +E   N  + +++E  + + SVD L+F+L+L+IQ+ N +SL+++L+ G+E+PS   K +S DL  ++    K+ N+++  +F+  +++D+L+LL++P  L++  +      ++R+AV  L FLI G     R + PL   A  Q     +G+SKI + FS  +L++WL+           SCL+              + F TS  L    + +                         W+H  E  ++                 +I  N++ AP   + ++ +QV  +T+A++ D L+ +  K+HRC  S ++LLS LRSV IEKC ++  VLG V T + + +C+ +++ A C R+ I S     F++ TP+RP++L  N+ +TF P++T YP L + M   G+   PN W+NP+       D    ++++  PP +F+ F+IPFE++G   E P  LP  YQ AL QRE +++ W   V+++ +  DQRK+ Q LV  +F EWL  +G+   L+SL 
Sbjct:    6 VLLWVKAEPFIVGALQVPPPSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYFEIFDSLSMKTPEERLEWSEVLSNCMSEEEVEKQRNQLSVDTLQFLLFLYIQQLNKVSLRTSLI-GEEWPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQLTASFHSTHSSLVSREAVVALSFLIEGTISRARKIYPLHELALWQPLHADSGFSKISKTFSFYKLETWLR-----------SCLT-------------GNPFGTSACLKSGKKLA-------------------------WAHQVEGTTKRA---------------KIACNTHVAPRMHRLVVMSQVYKQTLAKSSDTLAGAHVKIHRCNESFIYLLSPLRSVTIEKCRNSIFVLGPVGTTLHLHSCDNVKVIAVCHRLSISSTTGCIFHVLTPTRPLILSGNQTVTFAPFHTHYPMLEDHMARTGLATVPNYWDNPMVVCRENSD---TRVFQLLPPCEFYVFIIPFEMEGDTTEIPGGLPSVYQKALGQREQKIQIWQKTVKEAHLTKDQRKQFQVLVENKFYEWLINTGHRQQLDSLV 546          
The following BLAST results are available for this feature:
BLAST of TCONS_00073507 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TBCC15.977e-9632.35TBCC domain-containing protein 1 OS=Homo sapiens G... [more]
back to top