Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073495 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073495
Unique NameTCONS_00073495
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3172

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073495 ID=TCONS_00073495|Name=TCONS_00073495|organism=Clytia hemisphaerica|type=transcript|length=3172bp
aaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGAC
AAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCA
GGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATT
TCTCGTCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgtt
ttgacatgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATC
AATTGCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGG
AATGACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGA
ATGCTTTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAA
AGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTAT
CTTTGCATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTAT
TTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATT
GCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATT
TGCATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACT
TTTTCTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTC
TGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATT
ATACGTACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAG
GAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGT
TTGCAATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGT
CTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACT
ATAGTGATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGAT
GTATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGG
TTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGT
ATTTGATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTC
TTGGGACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCC
TTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCT
CCCTCCAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATC
CTCGATAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTT
TTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACA
TTGTTGACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaac
tcGCAGAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGA
TGCGGCCGAAGGTGACGGAGATTCCATTAATTAACCACCGAATCATGGAT
TGGAATTATACCATTCATATTTTgcattatttttcaatattgttTACAAG
AAAGTAAGAGATATTATATTCACGGTACATTGTGTAATACAGACACAACC
TCCATTTTCAATGCAAAGAAACTTACTGTAGTAACGGATTTTGCACAAGA
TTCGAAACAGAAAGGTGAAAGGTGAAACTACTTGAGgagataatcagatg
gtttgagatatttggcatgtggaCTCCCTCTATTGTCCTGAGAAAAAgcc
caaaatatttttagctaACAATTTTCCAAGTTAAGATATACAAACtacaa
gtttttgacttttagtaaGCAAACAGTAGAATTTTAAAGCACGAACCGTG
TAAGAACCCttttttcttgacttttaaAAATAGTTAGATTTAAAAATACT
TGAGGTTTTACTCAAGACCACAAAAGGTTACTACAGTCCAAATAACTCAA
GCCATCTGATTATCTCGTTAATGTAAGTAAGCTATTTAGCACCGTAAAAT
AATTCTCAAGGGAAAAATAGTGAGTAGTTAGGTTTTAAGtaagctttgaa
aattttttttgaacgcTGTAGAGTAAATGGACAAAACTGAATGAGTTGGA
GGCTAGAAGTAAACGTCCAACTTTTCCTACTGTAGGCAAGAAAAATGATG
TCTTAAGATTTGCGCCGAATCGtggatgacggattgaatctattCTTTTC
GCCTGGCACTTTTTccaaatttagcggtaaatgtTACATTCAATCTCTTT
AGCAGTTGAATGAAAACCACTTATGATGCGCAACTTATGTAGCTTTGAAT
CTTACATAGGAAATTCGTTTCTAGCCTTCAACTTATACAGACGatagaat
atttttaaatagtCCCATTGTACCTACTTAGTATTGGATTTTTACGACaa
ttattttgtttctaaagTATTCTTCGTTTTTTATATTTCCATAGTCCAGA
TGTATTTTGTCATTTCAGTCCATaatatttaagtatttttcaTTTGATTA
TCCATTAGTATTGATCAACAACTCCTTCctcccaaaaatcgaaaatcgga
ATACGCTGCTAGATTAAAACGAACCTACTAAAGTTAACTTTGAATAAGCT
GGTATTAAGAGCTGCATTTTGACACCCAAAGAATCTGCAATGTAATTTTA
AGTCTCGGGAGCTAAATAAATTATCTAATATGGGAACTGGGTTTGTGACG
ACGCACGGTAAAGGATCGTGTTATCAAGCTTCCAAAgtacaaacattttt
ttcaaccaattcTCCTCGGTTTAATGTTGTTGTTTGCGACGAGCAGTCCT
CTAGTGGGAGATTTCTTTTATGACGTACGAGCACGGCAAATAACTAAGCT
CGttttatttgcaaaatatcATTATCTTCTATTTTCTATCTTTATTTGTG
ATTAATAATTTGACGTacataaattatttctttttttcagttagCATTAG
ATTTTAGTCTTAATATATAGATTTATAgtcttttttgtaagaataaatAA
ACTTCTATTCTAAATTGACCGAAGTCTTCCGAAGGAATTAATCGCAATCG
ACTGATAATTGATTTTGTTCCTATTGCGTTGAGAAAAAGGATTGAAAGCT
TTATAGTGGGTCGTAATTGGAA
Run BLAST on NCBI

protein sequence of TCONS_00073495-protein

>TCONS_00073495-protein ID=TCONS_00073495-protein|Name=TCONS_00073495-protein|organism=Clytia hemisphaerica|type=polypeptide|length=510bp
KNFNLESPSKVCRNSRQKKVNLHARMAEEINFAGESAHWCLNANKGYYRF
LVLFFNCLLTFGSYFCFDMPSVLQDSFTGTYGINCTTNSHNVTKCEEHLG
MTETEYNLLYTVYAWMNALVVIGSGIFIDKVGQRVGAVFFSALCVVGSAI
FASGYFLKGRGSMLVLFLTGRLLFGAGNGSLTIAQNRISAYWFEGKELAF
AFGATLSFSRLGSILNFFLTKDFSQTYGLKWTLWGGVFLCILGFGGALVL
YVLDKNGMEQIAQREPGAKKSRKMKVGDIRHLSLQFVLLAVTTMSFYNTV
FPFVADASQFIREKYHYSDDSEMPSYYAGSVYDVSLVATPILGIIVDYLG
YRGLLAFVCAIFTIPVYLILAFTTWHPLYGTVLLGLTYSAAATSLWPSAP
LVVNPGVLGTALGLMTSLQMIGIGVCSLVVGAILDKLKTNDHKWEYVMIF
LLANAVLCVISALFLNIVDWRRSGILNKTKKRNSQKMKKLTESREALVGD
AAEGDGDSIN
Run BLAST on NCBI

transcript from alignment at scaffold_93:193950..206905+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073495 ID=TCONS_00073495|Name=TCONS_00073495|organism=Clytia hemisphaerica|type=transcript|length=12956bp|location=Sequence derived from alignment at scaffold_93:193950..206905+ (Clytia hemisphaerica)
aaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGAC AAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCA GGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGTCagtatttcaa tttcattttcctttatcTCCCACACTCTCACCTCGCCCAGTGTCTGGAAA TTGCAGCGGTTATCTCCGGCGTAGATTTGAAGTTTGAGATCTGCTGCCTT CAACTTTTCCCAGTTAAGTTGGCGCAGCTCCGGCGTAACATTTCCCTCCT TTCCAGACTGGCACCTCGCCTCGACTGTAgcagcaactccagaagatttt tctagagacctgaaatttggatgCAGAATTCTTTTTTGATGGTGTAagta gaatattattatataaaaatatttgtaaaatatttagtatatttatgaaa ataacaaaagatatatctttttttgaaaaaagaagacattgcattgtttt atttttttttttgaagaaaattagcttggaaaaggaggaccctgccgacg caccggactgtccggtgtatttgtccggtggcaaaaagtatcctttcgct acaccggacgcaataagtccggtgtcagtcctgtgttgcatacagggaat tttggacaccggacatttatgaaacaaaaaattaagaaacaccggacgca ccggactggtcatgtccggtgttctGATtatccggtggaaaaaatatcct tctccaacACCGGACATATGACtttcttaagtccggtgtagagattgtcc ggtggtaaaaaaagttctcattttacaccggactttcgcgtgtccggtgt tcgttaagtccggtgcgtcggcagggtcctggaaaaggttgaaatgagtc aaaaaaggtggtaggacccattttcaaggggcctctggaaatggaggaac aaaaagttataagtgaagaataagtttttcttaaaaagagaaaccccaaa tgaaaagaaaatccatttcggcaaaaatgaaaacttttttttgggacatt cccatgctaaagaagcaagaaagtgaaaaaaactatatacataaaaaaaa agaactaaaattagcgaatgtgattttgaattcctcaccctttttctgat aaacatacaaagtttcagcctttaACTAcgttttcctccatttccagaaa catttgttcatcaatagttgcaacttttttttctcctgtcagaaaacaat tttgaaaatgtttcaaaaacgtTCGGCACTTTACCAATtggccgtctagc ccgtgtcaacagaatttgaaaaatcttctgaaGTTGCTACCTTCTTTCCA GCAGGCTAGCTCTAGCCTGGAGatacatgctatgatttcttattctatat actgatggcgaaatatatagcatggcaTGGGCTGAGAGttaatttcccag atcctaataacggttgaaaatatagccaatcaaattttgatattatttta ctggtcacactttcttatagagaaagcgcaagttccgaaatttgattttt attttagtaagtgaggacagcgccaAATTCGATTATCCCACTGTAAAtct tttgaggcagaaatctgcctcaggtcatacccgtcctgtatacatcagat tataaaagtACAGGACGGTTATCCTGTttaggctagctctaaagctctaa aacagtaTCTAataccagacggtgtcaatcgaacgaatcgaacgctgaat caattgaacgcaattgaacacaatcaaagttgcaattcgattgtcgaacg caatcaaattgcaattgaatattacctAGGATTTGCCGTTCCATTgcttc gattatgttcgattgtattcgacagtatatagacctaactcttcatacaa aaattacgggaaacgcatgtttggactttgtaccctatgcttcacgcaag cacttaagccagagtcccgcaaaggcgggacaaaaatgtTTGTCGAGCTC CCCCGCGGGTGAAAAACTATAATCTGTCAATAatcttctcaagcgaagag tatgcCAAGagctagctttacgatagtgccgcagatcatcagtggatagt attcaattatcatatCATgtagcatagggtacaaagtccaaattaTGCGT TTCCTGTAATTTTCGTATGAAGAGTTAAGTCTATACTGTCCAGTCTAATG TCGGTTATTCCGGAAAAATAGTGGATAGATTCCAGAAAAGTGATaggaat cttagtgcagaaatgggaaACAACAAATGGAAAAAACAACACTACCAATC GATAGCCAATCAATAGACTTTTTTGCCCTTCCATCATCCGTCATATTGAA TTAGGCTTGGATATTGCAGATAAGAATCTTAAAAACACTCGATGATCAAA ACGCTGGCTACACTAAATCTccaaaattctttgaataaaatcactaaaaa atccgacaaattttatgactttctGACTAGGAAAGGGGCACATTTTTAAG AAAGTGAGTCAGTCAAAGGACCCGAACACAACTTTATTTGTGACCGTGGC CTTATGATACAAAGATTATGGTGGTCAAATTGTCGCAGTGAGAGTTcatt gaaaatatgcaaaacatatgcaaaaaaatataatataaaacttacatgca tgaAATTAGCATTATATCTGATTATATTAAAGTGCAATCTCAGAATCTTG TAAAAGAAAGATTaattttgcttctcttgaaaaccaGAAATACAAATAGT TATATCCTCTCATCTCTGACAACAACAACCAGCACTTCAATAAACCGCCA TAACATTATACataaagctgaaaaatcaccagaAAAGGTACACAATTTAC CATTAAATCATCCTGACGGTAACTGTGTGTGTATGTGTTTGTGTctgtcc gaaaactttggggcaggctggagacttgaaaaatgatcagatttggatga aatttggcacacttgttccttgggtgaatatatgggggtgttttttcatt ttttgaaaattttcatttttaagggcgtggtcacaagttttcgccaaaac gaggctaaaactttggggtaggctggagacttcaaaaatgctcagatttg gttgaaatttggcacacttgttccttgggtgaatatctgggttttttttt tcattttttgaaaatctttatttttaagggcgtggtcacgagtttttgcc taaacgaggctaaaactttggggcagactGGAGATTTCAAGGGCAAATCC CTGTGGGTGGTTTTCATTGTTTTATAATTTCCATTTTAAGGGGGTGGTCA TGAGTTTTTAGTTGAAATTggttacaattttacaattgggcctataaatg atttaaaaacactgaagttgagcccagtgcggttagcacgttcaacagta atatataatataccgaattactttcaaataatatAGAATATACTTTTTAT ATATCTAATTGACCCAGCAAATTTTTAGCTTGTTCAGACATTTTAGGGAC ATATataaagcaaaaatttcaagattttgcaAGGACTTAAATTTTGCAGG TGGCATTATAGGGAgacaatattttttatgattttgtgcCTTTTACTACC CAATCATGCATGTTGCTTGTTGAAATAagcattattagcgcttctttgat caACATTTTAGAAGtagttatttgacatttttgagttttgttcaaaaata GATATCGCAGATAAGACCTTTCTAAATTTACATTGGGtgatgacacccaa atctgcAAGATCtccaaaatttaatccccgtgaaaatttatcccattgtA CTGGTCGAGTGAAGGAAAGCGTAATTTgtcacaaaacaaaaaagaaatgt gCTGCAAAACTTCTGAAAAgggttttatgaaaaaataaactggCAGTTTT TAATGAAACTTTAACACTTAAAAAATCTAGGCTTTGAGCCATagtggtat tttttttcaatttttgcctgtagtgcaaatcagtacccccaggggggttc ggccaattttggacttctgaccttaaaattGTGCAgcatgcctcacaata ggttaaattttcataaaaaaacactacatcttgaattttttgactttgac aTATATTATAAAGCTTTCCGATACCACTTTAAAAGTAATCATCATGCTCA TAATTATGCTCTTTTTTTTAGGCTATTATCGATTTCTCGTCCTATTCTTT AACTGTTTGCTGACATTTGGAtcctatttttgttttgacatgCCAAggta ttttcagattttcagattttcatgtttttaaaatgacAATCAAAATGTTA TTTGTCAGATTTTATTTTATCGAGATCCTATTAATCTTCCTCCACTgctt tatatttttgaaatctacctTTATTTCATGTATATGCAATGATCGTCAAA TAACTAAAATCTTTCAATGTCTAAATCTTGTTTTAGTGTTTTGCAAGACA GTTTTACTGGGGTgagaatttcttttattttcctaaaGTTTCATTACTAC CAAAAGCTGATATGAAATGTGTCACCATAAGGCTGTAGATAAATACTTAA TACATCGTGTCAAAGCGAAATCAAATTACGCCAAATTAGTCACACTTAAA ATTCATTTGGAGATCATGATTGTCAGTCGAATATTTTTTCAGTCAAGAAT TGACCAATAATCGGTGCTTATTTTTCTGTACAATAGTTAACAATAATGAT ATTGTGGATATATTTGATGAAGGGATGTTTAAATTGTGGGTCCTGTAATT TATAAATCTGTGGTTATTGATCATTTTACTTCATCCCTCAGACTTATGGA ATCAATTGCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCT GGGAATGACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGA TGTAAGacaatatttctttttaaaaagtgtAGAAAACCCAAACACATTTT ATATATATCTATATGTAATTTTAGTATTGATTGCGAATAACAATATTGTT AATTGCAAAATGTATATGGATGTATGTAAGAAATATTGTGTTTGAAGAAT TGAAGATTTGTCAGGGTACACAAACTTCCTTCTCTCGCACTAATCTTGTT TTAATTCAGGATATAAATGTTATTGCTCCTGAAAGGATTATAACAATTTT ATAACGGAACAACTAACTTTTATATTTCTACTTTAGGAATGCTTTGGTAG TTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAGAGGTTTGTAT TATTTTGATGTGGAttccaaaacaaaataaaaagagaTTAAGGGAACTGG TGTCCTCATTTCTTGAGTTTTAATGTATGATAACTAGTAAGTAAATTGCT CATAATTGTATATAATACAAACTAAGAAAGTAAAGTCTGTGACAGTGGAT ATGACAATTATCGTATAAAATTAATATGGTTTACttaaaattattgtttt ttcattttttgatgttgcacACTAACTATAAACATTCTCAAAATCTTCTA CCTCCCATCTCAGATTACATTTAATATTATCAAGTTAGATTAATGTAAAA CTGTAAAAACAGTAGATGAGAAATTATGTCCTTCCTTTAGTTGGTGCAGT GTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGAT ATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGT CTTTTATTTGGGTGAGTTATCTTCATAAATAAAGTTTGTTCCAATCTAAG AAAACATAACTTGTGATTACGATTATCAAAAaagattcatttttcaaaag cagttttcATTCATCTTTGAAACATGTTTGCCCCTTTttctatttgaatt ttttaattatgtAAAATGACATAATTTGTGGAGGATCTTCTTTCTCTAGA GTACTCCGTGCGTAGTAGAGCTTTTTATATGAACAGAACTGTTCCGTATG TAAAATCATATGAATCAGCTTTTTCCCTTTGTATTTTTCAGGGCTGGAAA TGGCTCATTAACAAGTAAGatgttttttcaaattatttccaGCAATATCA TTAACAAAATCAACTCTGGCCTTTTTTGTCTTTGGACCCCTTTGGATGAT CAAGATCATCTTTCTAACTAAAATACGGTGGCCCCTAAGGCTCACAACAT ACTTCCAGTTCTGACACAAATCCATTTTGcaaatttataagaactgaAAG TGTCTTGTGAGCCTTAGGGGCAACCgtaatgaaaaaaacttttttgctcC TGTATCTACTCATTGAATTACTGTTTATGAAACCAGTGTAcagatttttt tattatatccGCAATTTTCTTCTATTTACAGTTGCGCAAAACAGGATCTC AGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTC TTTCATTCTCCAGACTGGCAAGTTAATCAAACTTCTTCAAAGATCAAGAA AATTGTCTTTACCCAAATACACTAAAATTCGATGACCATGATGATACTGC TGGACAGAAaataagggaactaatttttgcgttgaaaaaaaattgaatct ttTAGTGAAAAATGGCCAAATTTGTAATTTGCAGGTTctaattttcacga ttttgcaaaaaaaccaAGAGAAAAGCCTTAATCAGCtcccacgaaaatta gttcctttaAGGTTAAGATTGTCTATGAGGTCCCTACTTATGTTATATGA TACCCAGTCCAAATAGCCATATTTAACTTGATTTAACATTCCGCTGACAT GACCTTAATGTAAACTGTTTTGCATTTCTGTTTTACAGGGAAGCATATTA AACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGAC ACTCTGGGGAGGTAAAGATACTTTTAGGAAAGTTTTTAATCTTGACAAAT AATTGATATTTTGTTACAACGGTTATCCTTTTACACCATTacatttcttt tgaaagtttttcccTTATATCTAATCTATCTTTTCAGGTGTATTTCTGTG CATTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAATG GTATGGAGCAAATAGCCCAGGTGGGTAGCGCTCTATTTATTTAAGAATTC CTTTATGAGGCCCCCTAAGccgttttcgtgatggcgtgataaggaccttt ttcttgcgtgattacgtgatttggaattttttcttcgtgattgtATGATT ATAGGTCAaggcgtgatcgtgatttgaaagatttttgagccgtgatgcgt gatttggtNCGTGATGGCGTGATAAGGACCTTTTTCttcgtgattacgtg atttggaattttttcttcgtgattgcATGATCATAGGTTAaggcgtgatc gtgatttgaaagatttttgagccatgatgcgtgatttggacttgATGCAT GATTATCctaatttttttgctgattttcgtgatcgtgattgaagataAAA ATTATGTGATATCTTGAGCAGACTTACCGATGGGGGGGGGCTCCTTTATT AAGGCAGTGAAAAAAGAAAGTTCCTCCCTCAGACCCGGTGGAAGTGGGTA GACTGGGGAGACTTTCCCATGTTAATGgttgttccaccgggcctgtACCT GATAGTCTTTATTAGATGCTAGAATGTCTATTAATAGATatttaagaaaa gaaatttgacagTAAATTTGTTGCAAAACAGTGGCTTACCGAATAGCGTA AAAACTCGAATAATGGATCTTTAACTGTATATATACTGAACATTCTAAAT TTACTATCTTTACAGCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGAT GGTAATTTCTCCTTTCTGTGTATTTTTCCTTTCtatgtttttcttcttta gaCATGTGTTTTGATAAGCCTGGTTGTCATACTGCTTCATATCACAGTGT TCAAGATCTATTAGAAAATTCATAATAACAATTGTTATAGTTCATTGAGG CTCAGATAACTCCAAATATTGTTTCTTCACTTTACAAAGGAGCTCATCAT TTCTAGCCATCTCAATTAAAATCTTTACTGTTTatgaaatttataaatta tAGCATTACTCACAAGTTTTGAAAAGTCACGATAGGAGTTTTTCGGATTT CGTTGCATTACAACTTTATGAGCATTTTCATTCATATGCTTTTTAGAAAG TTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACC ACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGGta tcatcaaaatttcattatacGGCAACTAATGGGGTCGGTTAAGGCTAAGt agaaaaattcaagaaaagaaGCGGCACAATATCTTTCTTTTGGTATACAG CTAAGGAATATGCCAGTTCTTCGGGTTGCCCTTTTCTTTGTCCAAGTAAT AAAGTTTTTGATCTGTAGAGGTGATTTTGGTATACAGCTAAGGAAAACAC CACGTCTTCTGGTCACCTTTTTTTTTGTCTAAATAATAAAGTCTTTCAAA CTTCATATGCATATAGGTACAAAAAGTTTAGGTACTTTTTTCTAACCCAT TCAATAGATGACTGTAGAATCTCAACTGAATCTTGAACTCCTTTTACTTT ATTGTATTGAAAGTTACAGCCCCTGCAAGTGTTAAagaagattttgagaa acttaacttttaagaaagatatagaggtttttcatggtTTTTCATCAGTT ACGTAACTTCCGTAATGTTCGATTCGCGTAGGGATCACCTCTAAAGATTC GAACGTTACCTTCCATAATGGCGTTATATAAAGCAAAACATGCAAAACTT TTATAcgtctttttttgtttttttttttatacagTCAGTTCATACGTGAG AAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCGGGAAG TGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGG TGAGTCGAgtctaaactttttttaaaaggggTAATCGTCAGttaaacaat gaaattcaactgaaaaaattctttcacGGAGAAAAAGTAAGATAATGACC CTCAGAAAAGTTCACAATAGAATCAACATTTTCTTGTgataaatgaaaca ttttttcatcatttataCTAGCCTTACGATATTCATCTATAACTTAAAAC TGTTCTTTTAGTTTTGTGCAGTTTAAAAGGTCAAGAATATTATTCGCCCT AGTGACTTTATTTTTCTACGTAGAGATGTAATGTTTCACAAAGGTTTTTT TCAAATACCCAGGCAATTTCAATATTCCATTTCAATTGACCCCTTGTGTT AGTATGATCTGATTGGATCTGATTGAATTcgatcactgacctttatatat ccctggaccaagttccTCAATGCCAGCCaggcaaaatattatgatcggag tttttttgaaattggNCAAGTCCCTCAATGCCAGCCaggcaaaatattat gatcagagtttttttgaaattgatacccgcggagagagcgctagatcttg TTTCGCTTGTACACTAATGATATAGCCCCAtttgtcgttaggcaaagtct caaacactacaatggcttcttcgtgggtaccattttcaaaaaaacttcga tcaaagatggcggatgtagcttggtccagggatatataaaggtcagtggg cgAGATCAATTTGattgaaatcattgaaaacaCTCTTCACAATCTGACAC TGAAAGTATCAtaaaattctttcatttcaggATTATTTGGGTTATCGAGG CCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTATTTGATTC TTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTC ACCTATTCTGCTGCTGCTGTAAGTTCAACCCATTTAGCCAAGGCATCACA TGCTAAGGTCGGTCTCCATAAGTGGCCGCCTACCACCAATTCTTTTCAAT CTAAGCTTTTGCTTAGATGTCATTGGCCCGATTTTGGTGtatattttttt gcatttttgcctGTGTTGAACTCTTTTTAGCGAAGAGAACGCTCGAAGTC CAAAAGGACCGACGACGGCAAGCTTTTTCATAAAGGCAAAAAAAATCGTC TCTAGATATTCAGGGTGGTAGAGAAGAATCTCTTCTccaaacaaaaaggt taaagTGGAAGAAGCTATTGCAAAGCGTATGATTTTTGCcatgagttttc aaaaattattttcagtctttcttttgtttttacaagggttttttttattg tttcttCATAGACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCT GGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGG TATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGT AAGTgttgaataaaaatatagagTGTTTGGTTTTTTTAGGAAAGTTCTTT TCCGCGATTCCTTCTATTTCGAGACATGTATCTTTAAAACTTCTAAAGTT TAGAAGTATTctataagtttttttattttttgttaaattacGTAACCTCT GCCATTATGGAAGTAAACGTTCGATTTACGTAAAGAATTGCTTCTaaaca ttcgaacgtttgcttccatatgTGGAAATTACGTGGCTTACTAATGTATG GAAAACCTCAAAACTCATTGGTATGCTATGGCATAGCATACCAATGAGTT TTTATGGTAATCTGTTTTGGGTAATTTCGAATAACAGATTCGTAAGTTGT TTTGAATTTAAGGGCCTAAGAGAAAATTTTTAAGGTAAAAGTTTTATTGA TAGACTACTATATTTTATCATATTATGAAcgtgaaattttgtttttacag GACGAACGATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATG CTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGA AGGGTAAGTTTGAATATCATTGGATAGAACAAACCCTTTGATAATCTTTG TCAGTTTTGAGCTTCGAGAAGGTCATGAAAAATCACACTTATAATTTAAC TCCAGGTTTatgaggcattgttaactggctagaaaatttgttcgagttaa ggagagaTTCGAATCCTAGATGTTCgggttatggagactccacctAACTC TAACAAAATGTGAATggctaaaaaattcttttactcTCCTCATACACACA GAGTGGTAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGA AATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGAC GGAGATTCCATTAATTAACCACCGAATCATGGATTGGAATTATACCATTC ATATTTTgcattatttttcaatattgttTACAAGAAAGTAAGAGATATTA TATTCACGGTACATTGTGTAATACAGACACAACCTCCATTTTCAATGCAA AGAAACTTACTGTAGTAACGGATTTTGCACAAGATTCGAAACAGAAAGGT GAAAGGTGAAACTACTTGAGgagataatcagatggtttgagatatttggc atgtggaCTCCCTCTATTGTCCTGAGAAAAAgcccaaaatatttttagct aACAATTTTCCAAGTTAAGATATACAAACtacaagtttttgacttttagt aaGCAAACAGTAGAATTTTAAAGCACGAACCGTGTAAGAACCCttttttc ttgacttttaaAAATAGTTAGATTTAAAAATACTTGAGGTTTTACTCAAG ACCACAAAAGGTTACTACAGTCCAAATAACTCAAGCCATCTGATTATCTC GTTAATGTAAGTAAGCTATTTAGCACCGTAAAATAATTCTCAAGGGAAAA ATAGTGAGTAGTTAGGTTTTAAGtaagctttgaaaattttttttgaacgc TGTAGAGTAAATGGACAAAACTGAATGAGTTGGAGGCTAGAAGTAAACGT CCAACTTTTCCTACTGTAGGCAAGAAAAATGATGTCTTAAGATTTGCGCC GAATCGtggatgacggattgaatctattCTTTTCGCCTGGCACTTTTTcc aaatttagcggtaaatgtTACATTCAATCTCTTTAGCAGTTGAATGAAAA CCACTTATGATGCGCAACTTATGTAGCTTTGAATCTTACATAGGAAATTC GTTTCTAGCCTTCAACTTATACAGACGatagaatatttttaaatagtCCC ATTGTACCTACTTAGTATTGGATTTTTACGACaattattttgtttctaaa gTATTCTTCGTTTTTTATATTTCCATAGTCCAGATGTATTTTGTCATTTC AGTCCATaatatttaagtatttttcaTTTGATTATCCATTAGTATTGATC AACAACTCCTTCctcccaaaaatcgaaaatcggaATACGCTGCTAGATTA AAACGAACCTACTAAAGTTAACTTTGAATAAGCTGGTATTAAGAGCTGCA TTTTGACACCCAAAGAATCTGCAATGTAATTTTAAGTCTCGGGAGCTAAA TAAATTATCTAATATGGGAACTGGGTTTGTGACGACGCACGGTAAAGGAT CGTGTTATCAAGCTTCCAAAgtacaaacatttttttcaaccaattcTCCT CGGTTTAATGTTGTTGTTTGCGACGAGCAGTCCTCTAGTGGGAGATTTCT TTTATGACGTACGAGCACGGCAAATAACTAAGCTCGttttatttgcaaaa tatcATTATCTTCTATTTTCTATCTTTATTTGTGATTAATAATTTGACGT acataaattatttctttttttcagttagCATTAGATTTTAGTCTTAATAT ATAGATTTATAgtcttttttgtaagaataaatAAACTTCTATTCTAAATT GACCGAAGTCTTCCGAAGGAATTAATCGCAATCGACTGATAATTGATTTT GTTCCTATTGCGTTGAGAAAAAGGATTGAAAGCTTTATAGTGGGTCGTAA TTGGAA

Coding sequence (CDS) from alignment at scaffold_93:193950..206905+

>TCONS_00073495 ID=TCONS_00073495|Name=TCONS_00073495|organism=Clytia hemisphaerica|type=CDS|length=26061bp|location=Sequence derived from alignment at scaffold_93:193950..206905+ (Clytia hemisphaerica)
aaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACA
AAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAG
GTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTT
CTCGTCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgttt
tgacatgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCA
ATTGCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGA
ATGACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAA
TGCTTTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAA
GAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATC
TTTGCATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATT
TTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTG
CGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTT
GCATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTT
TTTCTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCT
GGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTA
TACGTACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGG
AGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTT
TGCAATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTC
TTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTA
TAGTGATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATG
TATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGT
TATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTA
TTTGATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCT
TGGGACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCT
TTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTC
CCTCCAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCC
TCGATAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTT
TTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACAT
TGTTGACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaact
cGCAGAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGAT
GCGGCCGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGA
GTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTC
ATGCAAGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGG
TGCTTGAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAA
CTGTTTGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTT
TGCAAGACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGT
CATAATGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATA
TAATTTACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTG
GCTCTGGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTC
TTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTT
CTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTT
TATTTGGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCA
GCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCT
TTCATTCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACT
TTTCACAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTG
TGCATTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAA
TGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAA
AGATGAAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTG
GCAGTCACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGA
CGCAAGTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGA
TGCCATCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACT
CCTATCCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGC
CTTTGTATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCA
CTACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCT
GCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGG
CGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTA
TCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACG
AACGATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGT
TTTGTGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGA
GTGGTAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAA
TTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGG
AGATTCCATTAATTAAaaaaatttcaacctGGAGTCCCCCTCAAAAGTTT
GTCGAAACAGTAGACAAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAA
GAGATTAATTTTGCAGGTGAAAGTGCACACTGGTGCTTGAATGCTAATAA
GGGCTATTATCGATTTCTCGTCCTATTCTTTAACTGTTTGCTGACATTTG
GAtcctatttttgttttgacatgCCAAgTGTTTTGCAAGACAGTTTTACT
GGGACTTATGGAATCAATTGCACAACAAATAGTCATAATGTAACAAAATG
TGAAGAACATCTGGGAATGACTGAAACTGAATATAATTTACTTTACACTG
TTTATGCATGGATGAATGCTTTGGTAGTTATTGGCTCTGGTATATTCATT
GATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGT
TGTTGGTTCTGCTATCTTTGCATCTGGATATTTCTTGAAAGGGCGTGGAT
CAATGCTTGTCTTATTTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAAT
GGCTCATTAACAATTGCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGG
GAAGGAATTGGCATTTGCATTTGGAGCAACTCTTTCATTCTCCAGACTGG
GAAGCATATTAAACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGA
TTGAAATGGACACTCTGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGG
CGGAGCACTTGTATTATACGTACTGGACAAGAATGGTATGGAGCAAATAG
CCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGAT
ATTCGACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACCACAATGAG
TTTCTACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATAC
GTGAGAAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCG
GGAAGTGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCAT
TGTGgATTATTTGGGTTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCT
TCACCATTCCAGTGTATTTGATTCTTGCTTTCACTACCTGGCATCCGTTG
TATGGAACCGTCCTCTTGGGACTCACCTATTCTGCTGCTGCTACAAGTCT
GTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCC
TTGGTTTGATGACCTCCCTCCAGATGATCGGTATCGGTGTATGCTCACTC
GTTGTGGGTGCAATCCTCGATAAGTTGAAGACGAACGATCACAAATGGGA
ATATGTGATGATCTTTTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTG
CTCTATTCCTCAACATTGTTGACTGGAGAAGGAGTGGTAttttgaacaaa
acaaagaaaagaaactcGCAGAAGATGAAGAAATTGACCGAATCGCGTGA
AGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGATTCCATTAATTAAa
aaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAA
AAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAGG
TGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTTC
TCGTCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgtttt
gacatgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCAA
TTGCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGAA
TGACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAAT
GCTTTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAG
AGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCT
TTGCATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTT
TTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTGC
GCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTG
CATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTTT
TTCTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCTG
GGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTAT
ACGTACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGA
GCCAAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTTT
GCAATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTCT
TCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTAT
AGTGATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATGT
ATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGTT
ATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTAT
TTGATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTT
GGGACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTT
TGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCC
CTCCAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCT
CGATAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTTT
TGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATT
GTTGACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaactc
GCAGAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATG
CGGCCGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGAG
TCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTCA
TGCAAGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGGT
GCTTGAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAAC
TGTTTGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTTT
GCAAGACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGTC
ATAATGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATAT
AATTTACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTGG
CTCTGGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCT
TCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTTC
TTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTTT
ATTTGGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCAG
CTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCTT
TCATTCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACTT
TTCACAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTGT
GCATTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAAT
GGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAA
GATGAAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGG
CAGTCACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGAC
GCAAGTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGAT
GCCATCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACTC
CTATCCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGCC
TTTGTATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCAC
TACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCTG
CTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGC
GTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTAT
CGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACGA
ACGATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGTT
TTGTGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGAG
TGGTAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAAT
TGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGA
GATTCCATTAATTAAaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTG
TCGAAACAGTAGACAAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAG
AGATTAATTTTGCAGGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAG
GGCTATTATCGATTTCTCGTCCTATTCTTTAACTGTTTGCTGACATTTGG
AtcctatttttgttttgacatgCCAAgTGTTTTGCAAGACAGTTTTACTG
GGACTTATGGAATCAATTGCACAACAAATAGTCATAATGTAACAAAATGT
GAAGAACATCTGGGAATGACTGAAACTGAATATAATTTACTTTACACTGT
TTATGCATGGATGAATGCTTTGGTAGTTATTGGCTCTGGTATATTCATTG
ATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTT
GTTGGTTCTGCTATCTTTGCATCTGGATATTTCTTGAAAGGGCGTGGATC
AATGCTTGTCTTATTTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATG
GCTCATTAACAATTGCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGG
AAGGAATTGGCATTTGCATTTGGAGCAACTCTTTCATTCTCCAGACTGGG
AAGCATATTAAACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGAT
TGAAATGGACACTCTGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGC
GGAGCACTTGTATTATACGTACTGGACAAGAATGGTATGGAGCAAATAGC
CCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATA
TTCGACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACCACAATGAGT
TTCTACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACG
TGAGAAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCGG
GAAGTGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCATT
GTGgATTATTTGGGTTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTT
CACCATTCCAGTGTATTTGATTCTTGCTTTCACTACCTGGCATCCGTTGT
ATGGAACCGTCCTCTTGGGACTCACCTATTCTGCTGCTGCTACAAGTCTG
TGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCT
TGGTTTGATGACCTCCCTCCAGATGATCGGTATCGGTGTATGCTCACTCG
TTGTGGGTGCAATCCTCGATAAGTTGAAGACGAACGATCACAAATGGGAA
TATGTGATGATCTTTTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGC
TCTATTCCTCAACATTGTTGACTGGAGAAGGAGTGGTAttttgaacaaaa
caaagaaaagaaactcGCAGAAGATGAAGAAATTGACCGAATCGCGTGAA
GCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGATTCCATTAATTAAaa
aaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAA
AGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAGGT
GAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTTCT
CGTCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgttttg
acatgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCAAT
TGCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGAAT
GACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAATG
CTTTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAGA
GTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTT
TGCATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTT
TGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTGCG
CAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGC
ATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTTTT
TCTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCTGG
GGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTATA
CGTACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAG
CCAAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTTTG
CAATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTCTT
CCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTATA
GTGATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATGTA
TCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGTTA
TCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTATT
TGATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTTG
GGACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTT
GGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCC
TCCAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTC
GATAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTTTT
GTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATTG
TTGACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaactcG
CAGAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGC
GGCCGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGAGT
CCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTCAT
GCAAGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGGTG
CTTGAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAACT
GTTTGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTTTG
CAAGACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGTCA
TAATGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATATA
ATTTACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTGGC
TCTGGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTT
CTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTTCT
TGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTTTA
TTTGGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCAGC
TTATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCTTT
CATTCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACTTT
TCACAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTGTG
CATTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAATG
GTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAG
ATGAAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGGC
AGTCACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGACG
CAAGTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGATG
CCATCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACTCC
TATCCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGCCT
TTGTATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCACT
ACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCTGC
TGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCG
TTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTATC
GGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACGAA
CGATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGTTT
TGTGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGAGT
GGTAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAATT
GACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAG
ATTCCATTAATTAAaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGT
CGAAACAGTAGACAAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGA
GATTAATTTTGCAGGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGG
GCTATTATCGATTTCTCGTCCTATTCTTTAACTGTTTGCTGACATTTGGA
tcctatttttgttttgacatgCCAAgTGTTTTGCAAGACAGTTTTACTGG
GACTTATGGAATCAATTGCACAACAAATAGTCATAATGTAACAAAATGTG
AAGAACATCTGGGAATGACTGAAACTGAATATAATTTACTTTACACTGTT
TATGCATGGATGAATGCTTTGGTAGTTATTGGCTCTGGTATATTCATTGA
TAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTG
TTGGTTCTGCTATCTTTGCATCTGGATATTTCTTGAAAGGGCGTGGATCA
ATGCTTGTCTTATTTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGG
CTCATTAACAATTGCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGA
AGGAATTGGCATTTGCATTTGGAGCAACTCTTTCATTCTCCAGACTGGGA
AGCATATTAAACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGATT
GAAATGGACACTCTGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCG
GAGCACTTGTATTATACGTACTGGACAAGAATGGTATGGAGCAAATAGCC
CAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATAT
TCGACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACCACAATGAGTT
TCTACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGT
GAGAAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCGGG
AAGTGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCATTG
TGgATTATTTGGGTTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTC
ACCATTCCAGTGTATTTGATTCTTGCTTTCACTACCTGGCATCCGTTGTA
TGGAACCGTCCTCTTGGGACTCACCTATTCTGCTGCTGCTACAAGTCTGT
GGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTT
GGTTTGATGACCTCCCTCCAGATGATCGGTATCGGTGTATGCTCACTCGT
TGTGGGTGCAATCCTCGATAAGTTGAAGACGAACGATCACAAATGGGAAT
ATGTGATGATCTTTTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCT
CTATTCCTCAACATTGTTGACTGGAGAAGGAGTGGTAttttgaacaaaac
aaagaaaagaaactcGCAGAAGATGAAGAAATTGACCGAATCGCGTGAAG
CGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGATTCCATTAATTAAaaa
aatttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAA
GAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAGGTG
AAAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTTCTC
GTCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgttttga
catgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCAATT
GCACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGAATG
ACTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAATGC
TTTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAGAG
TTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTT
GCATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTT
GACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTGCGC
AAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCA
TTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTTTTT
CTTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCTGGG
GAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTATAC
GTACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGC
CAAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTTTGC
AATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTCTTC
CCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTATAG
TGATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATGTAT
CTTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGTTAT
CGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTATTT
GATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTTGG
GACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTG
GTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCT
CCAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCG
ATAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTTTTG
TTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATTGT
TGACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaactcGC
AGAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCG
GCCGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGAGTC
CCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTCATG
CAAGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGGTGC
TTGAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAACTG
TTTGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTTTGC
AAGACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGTCAT
AATGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATATAA
TTTACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTGGCT
CTGGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTC
TCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTTCTT
GAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTTTAT
TTGGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCAGCT
TATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCTTTC
ATTCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACTTTT
CACAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTGTGC
ATTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAATGG
TATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGA
TGAAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGGCA
GTCACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGACGC
AAGTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGATGC
CATCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACTCCT
ATCCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGCCTT
TGTATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCACTA
CCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCTGCT
GCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGT
TCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTATCG
GTGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACGAAC
GATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGTTTT
GTGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGAGTG
GTAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAATTG
ACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGA
TTCCATTAATTAAaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTC
GAAACAGTAGACAAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAG
ATTAATTTTGCAGGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGG
CTATTATCGATTTCTCGTCCTATTCTTTAACTGTTTGCTGACATTTGGAt
cctatttttgttttgacatgCCAAgTGTTTTGCAAGACAGTTTTACTGGG
ACTTATGGAATCAATTGCACAACAAATAGTCATAATGTAACAAAATGTGA
AGAACATCTGGGAATGACTGAAACTGAATATAATTTACTTTACACTGTTT
ATGCATGGATGAATGCTTTGGTAGTTATTGGCTCTGGTATATTCATTGAT
AAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGT
TGGTTCTGCTATCTTTGCATCTGGATATTTCTTGAAAGGGCGTGGATCAA
TGCTTGTCTTATTTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGC
TCATTAACAATTGCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAA
GGAATTGGCATTTGCATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAA
GCATATTAAACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGATTG
AAATGGACACTCTGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGG
AGCACTTGTATTATACGTACTGGACAAGAATGGTATGGAGCAAATAGCCC
AGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATATT
CGACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACCACAATGAGTTT
CTACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTG
AGAAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCGGGA
AGTGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGT
GgATTATTTGGGTTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCA
CCATTCCAGTGTATTTGATTCTTGCTTTCACTACCTGGCATCCGTTGTAT
GGAACCGTCCTCTTGGGACTCACCTATTCTGCTGCTGCTACAAGTCTGTG
GCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTG
GTTTGATGACCTCCCTCCAGATGATCGGTATCGGTGTATGCTCACTCGTT
GTGGGTGCAATCCTCGATAAGTTGAAGACGAACGATCACAAATGGGAATA
TGTGATGATCTTTTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTC
TATTCCTCAACATTGTTGACTGGAGAAGGAGTGGTAttttgaacaaaaca
aagaaaagaaactcGCAGAAGATGAAGAAATTGACCGAATCGCGTGAAGC
GTTGGTAGGGGATGCGGCCGAAGGTGACGGAGATTCCATTAATTAAaaaa
atttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAG
AAAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAGGTGA
AAGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTTCTCG
TCCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgttttgac
atgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCAATTG
CACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGAATGA
CTGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAATGCT
TTGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAGAGT
TGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTG
CATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTG
ACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTGCGCA
AAACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCAT
TTGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTTTTTC
TTGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCTGGGG
AGGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTATACG
TACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCC
AAGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTTTGCA
ATTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTCTTCC
CTTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTATAGT
GATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATGTATC
TTTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGTTATC
GAGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTATTTG
ATTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGG
ACTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGG
TGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTC
CAGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGA
TAAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTTTTGT
TAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATTGTT
GACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaactcGCA
GAAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGG
CCGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGAGTCC
CCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTCATGC
AAGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGGTGCT
TGAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAACTGT
TTGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTTTGCA
AGACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGTCATA
ATGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATATAAT
TTACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTGGCTC
TGGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCT
CAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTTCTTG
AAAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTTTATT
TGGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCAGCTT
ATTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCTTTCA
TTCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACTTTTC
ACAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTGTGCA
TTCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAATGGT
ATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGAT
GAAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGGCAG
TCACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGACGCA
AGTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGATGCC
ATCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACTCCTA
TCCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGCCTTT
GTATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCACTAC
CTGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCTGCTG
CTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTT
CTTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTATCGG
TGTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACGAACG
ATCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGTTTTG
TGTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGAGTGG
TAttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAATTGA
CCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGAT
TCCATTAATTAAaaaaatttcaacctGGAGTCCCCCTCAAAAGTTTGTCG
AAACAGTAGACAAAAGAAAGTAAATCTTCATGCAAGGATGGCTGAAGAGA
TTAATTTTGCAGGTGAAAGTGCACACTGGTGCTTGAATGCTAATAAGGGC
TATTATCGATTTCTCGTCCTATTCTTTAACTGTTTGCTGACATTTGGAtc
ctatttttgttttgacatgCCAAgTGTTTTGCAAGACAGTTTTACTGGGA
CTTATGGAATCAATTGCACAACAAATAGTCATAATGTAACAAAATGTGAA
GAACATCTGGGAATGACTGAAACTGAATATAATTTACTTTACACTGTTTA
TGCATGGATGAATGCTTTGGTAGTTATTGGCTCTGGTATATTCATTGATA
AAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTT
GGTTCTGCTATCTTTGCATCTGGATATTTCTTGAAAGGGCGTGGATCAAT
GCTTGTCTTATTTTTGACGGGGCGTCTTTTATTTGGGGCTGGAAATGGCT
CATTAACAATTGCGCAAAACAGGATCTCAGCTTATTGGTTTGAAGGGAAG
GAATTGGCATTTGCATTTGGAGCAACTCTTTCATTCTCCAGACTGGGAAG
CATATTAAACTTTTTCTTGACTAAAGACTTTTCACAGACCTATGGATTGA
AATGGACACTCTGGGGAGGTGTATTTCTGTGCATTCTTGGATTTGGCGGA
GCACTTGTATTATACGTACTGGACAAGAATGGTATGGAGCAAATAGCCCA
GCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATGAAAGTTGGTGATATTC
GACATTTGAGTTTGCAATTCGTTCTATTGGCAGTCACCACAATGAGTTTC
TACAACACTGTCTTCCCTTTTGTGGCTGACGCAAGTCAGTTCATACGTGA
GAAGTACCACTATAGTGATGACAGTGAGATGCCATCTTATTATGCGGGAA
GTGTTTACGATGTATCTTTGGTTGCCACTCCTATCCTCGGTATCATTGTG
gATTATTTGGGTTATCGAGGCCTCTTAGCCTTTGTATGCGCCATCTTCAC
CATTCCAGTGTATTTGATTCTTGCTTTCACTACCTGGCATCCGTTGTATG
GAACCGTCCTCTTGGGACTCACCTATTCTGCTGCTGCTACAAGTCTGTGG
CCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTCTTGGTACCGCCCTTGG
TTTGATGACCTCCCTCCAGATGATCGGTATCGGTGTATGCTCACTCGTTG
TGGGTGCAATCCTCGATAAGTTGAAGACGAACGATCACAAATGGGAATAT
GTGATGATCTTTTTGTTAGCCAATGCTGTTTTGTGTGTCATCTCTGCTCT
ATTCCTCAACATTGTTGACTGGAGAAGGAGTGGTAttttgaacaaaacaa
agaaaagaaactcGCAGAAGATGAAGAAATTGACCGAATCGCGTGAAGCG
TTGGTAGGGGATGCGGCCGAAGGTGACGGAGATTCCATTAATTAAaaaaa
tttcaacctGGAGTCCCCCTCAAAAGTTTGTCGAAACAGTAGACAAAAGA
AAGTAAATCTTCATGCAAGGATGGCTGAAGAGATTAATTTTGCAGGTGAA
AGTGCACACTGGTGCTTGAATGCTAATAAGGGCTATTATCGATTTCTCGT
CCTATTCTTTAACTGTTTGCTGACATTTGGAtcctatttttgttttgaca
tgCCAAgTGTTTTGCAAGACAGTTTTACTGGGACTTATGGAATCAATTGC
ACAACAAATAGTCATAATGTAACAAAATGTGAAGAACATCTGGGAATGAC
TGAAACTGAATATAATTTACTTTACACTGTTTATGCATGGATGAATGCTT
TGGTAGTTATTGGCTCTGGTATATTCATTGATAAAGTTGGTCAAAGAGTT
GGTGCAGTGTTCTTCTCAGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGC
ATCTGGATATTTCTTGAAAGGGCGTGGATCAATGCTTGTCTTATTTTTGA
CGGGGCGTCTTTTATTTGGGGCTGGAAATGGCTCATTAACAATTGCGCAA
AACAGGATCTCAGCTTATTGGTTTGAAGGGAAGGAATTGGCATTTGCATT
TGGAGCAACTCTTTCATTCTCCAGACTGGGAAGCATATTAAACTTTTTCT
TGACTAAAGACTTTTCACAGACCTATGGATTGAAATGGACACTCTGGGGA
GGTGTATTTCTGTGCATTCTTGGATTTGGCGGAGCACTTGTATTATACGT
ACTGGACAAGAATGGTATGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCA
AGAAATCGAGAAAGATGAAAGTTGGTGATATTCGACATTTGAGTTTGCAA
TTCGTTCTATTGGCAGTCACCACAATGAGTTTCTACAACACTGTCTTCCC
TTTTGTGGCTGACGCAAGTCAGTTCATACGTGAGAAGTACCACTATAGTG
ATGACAGTGAGATGCCATCTTATTATGCGGGAAGTGTTTACGATGTATCT
TTGGTTGCCACTCCTATCCTCGGTATCATTGTGgATTATTTGGGTTATCG
AGGCCTCTTAGCCTTTGTATGCGCCATCTTCACCATTCCAGTGTATTTGA
TTCTTGCTTTCACTACCTGGCATCCGTTGTATGGAACCGTCCTCTTGGGA
CTCACCTATTCTGCTGCTGCTACAAGTCTGTGGCCATCAGCGCCTTTGGT
GGTGAATCCTGGCGTTCTTGGTACCGCCCTTGGTTTGATGACCTCCCTCC
AGATGATCGGTATCGGTGTATGCTCACTCGTTGTGGGTGCAATCCTCGAT
AAGTTGAAGACGAACGATCACAAATGGGAATATGTGATGATCTTTTTGTT
AGCCAATGCTGTTTTGTGTGTCATCTCTGCTCTATTCCTCAACATTGTTG
ACTGGAGAAGGAGTGGTAttttgaacaaaacaaagaaaagaaactcGCAG
AAGATGAAGAAATTGACCGAATCGCGTGAAGCGTTGGTAGGGGATGCGGC
CGAAGGTGACGGAGATTCCATTAATTAAaaaaatttcaacctGGAGTCCC
CCTCAAAAGTTTGTCGAAACAGTAGACAAAAGAAAGTAAATCTTCATGCA
AGGATGGCTGAAGAGATTAATTTTGCAGGTGAAAGTGCACACTGGTGCTT
GAATGCTAATAAGGGCTATTATCGATTTCTCGTCCTATTCTTTAACTGTT
TGCTGACATTTGGAtcctatttttgttttgacatgCCAAgTGTTTTGCAA
GACAGTTTTACTGGGACTTATGGAATCAATTGCACAACAAATAGTCATAA
TGTAACAAAATGTGAAGAACATCTGGGAATGACTGAAACTGAATATAATT
TACTTTACACTGTTTATGCATGGATGAATGCTTTGGTAGTTATTGGCTCT
GGTATATTCATTGATAAAGTTGGTCAAAGAGTTGGTGCAGTGTTCTTCTC
AGCCCTTTGTGTTGTTGGTTCTGCTATCTTTGCATCTGGATATTTCTTGA
AAGGGCGTGGATCAATGCTTGTCTTATTTTTGACGGGGCGTCTTTTATTT
GGGGCTGGAAATGGCTCATTAACAATTGCGCAAAACAGGATCTCAGCTTA
TTGGTTTGAAGGGAAGGAATTGGCATTTGCATTTGGAGCAACTCTTTCAT
TCTCCAGACTGGGAAGCATATTAAACTTTTTCTTGACTAAAGACTTTTCA
CAGACCTATGGATTGAAATGGACACTCTGGGGAGGTGTATTTCTGTGCAT
TCTTGGATTTGGCGGAGCACTTGTATTATACGTACTGGACAAGAATGGTA
TGGAGCAAATAGCCCAGCGTGAGCCAGGAGCCAAGAAATCGAGAAAGATG
AAAGTTGGTGATATTCGACATTTGAGTTTGCAATTCGTTCTATTGGCAGT
CACCACAATGAGTTTCTACAACACTGTCTTCCCTTTTGTGGCTGACGCAA
GTCAGTTCATACGTGAGAAGTACCACTATAGTGATGACAGTGAGATGCCA
TCTTATTATGCGGGAAGTGTTTACGATGTATCTTTGGTTGCCACTCCTAT
CCTCGGTATCATTGTGgATTATTTGGGTTATCGAGGCCTCTTAGCCTTTG
TATGCGCCATCTTCACCATTCCAGTGTATTTGATTCTTGCTTTCACTACC
TGGCATCCGTTGTATGGAACCGTCCTCTTGGGACTCACCTATTCTGCTGC
TGCTACAAGTCTGTGGCCATCAGCGCCTTTGGTGGTGAATCCTGGCGTTC
TTGGTACCGCCCTTGGTTTGATGACCTCCCTCCAGATGATCGGTATCGGT
GTATGCTCACTCGTTGTGGGTGCAATCCTCGATAAGTTGAAGACGAACGA
TCACAAATGGGAATATGTGATGATCTTTTTGTTAGCCAATGCTGTTTTGT
GTGTCATCTCTGCTCTATTCCTCAACATTGTTGACTGGAGAAGGAGTGGT
AttttgaacaaaacaaagaaaagaaactcGCAGAAGATGAAGAAATTGAC
CGAATCGCGTGAAGCGTTGGTAGGGGATGCGGCCGAAGGTGACGGAGATT
CCATTAATTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045617XLOC_045617Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073495-exon-scaffold_93-1491911889:193950..194086TCONS_00073495-exon-scaffold_93-1491911889:193950..194086Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:193950..194086TCONS_00073495-exon-scaffold_93-1510915933:193950..194086Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:193950..194086TCONS_00073495-exon-scaffold_93-1575043694:193950..194086Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:198121..198196TCONS_00073495-exon-scaffold_93-1491911889:198121..198196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:198121..198196TCONS_00073495-exon-scaffold_93-1510915933:198121..198196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:198121..198196TCONS_00073495-exon-scaffold_93-1575043694:198121..198196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:198386..198410TCONS_00073495-exon-scaffold_93-1491911889:198386..198410Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:198386..198410TCONS_00073495-exon-scaffold_93-1510915933:198386..198410Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:198386..198410TCONS_00073495-exon-scaffold_93-1575043694:198386..198410Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:198741..198850TCONS_00073495-exon-scaffold_93-1491911889:198741..198850Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:198741..198850TCONS_00073495-exon-scaffold_93-1510915933:198741..198850Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:198741..198850TCONS_00073495-exon-scaffold_93-1575043694:198741..198850Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:199136..199191TCONS_00073495-exon-scaffold_93-1491911889:199136..199191Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:199136..199191TCONS_00073495-exon-scaffold_93-1510915933:199136..199191Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:199136..199191TCONS_00073495-exon-scaffold_93-1575043694:199136..199191Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:199540..199660TCONS_00073495-exon-scaffold_93-1491911889:199540..199660Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:199540..199660TCONS_00073495-exon-scaffold_93-1510915933:199540..199660Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:199540..199660TCONS_00073495-exon-scaffold_93-1575043694:199540..199660Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:199941..199963TCONS_00073495-exon-scaffold_93-1491911889:199941..199963Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:199941..199963TCONS_00073495-exon-scaffold_93-1510915933:199941..199963Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:199941..199963TCONS_00073495-exon-scaffold_93-1575043694:199941..199963Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:200281..200366TCONS_00073495-exon-scaffold_93-1491911889:200281..200366Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:200281..200366TCONS_00073495-exon-scaffold_93-1510915933:200281..200366Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:200281..200366TCONS_00073495-exon-scaffold_93-1575043694:200281..200366Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:200738..200810TCONS_00073495-exon-scaffold_93-1491911889:200738..200810Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:200738..200810TCONS_00073495-exon-scaffold_93-1510915933:200738..200810Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:200738..200810TCONS_00073495-exon-scaffold_93-1575043694:200738..200810Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:200937..201019TCONS_00073495-exon-scaffold_93-1491911889:200937..201019Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:200937..201019TCONS_00073495-exon-scaffold_93-1510915933:200937..201019Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:200937..201019TCONS_00073495-exon-scaffold_93-1575043694:200937..201019Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:201718..201750TCONS_00073495-exon-scaffold_93-1491911889:201718..201750Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:201718..201750TCONS_00073495-exon-scaffold_93-1510915933:201718..201750Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:201718..201750TCONS_00073495-exon-scaffold_93-1575043694:201718..201750Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:202096..202196TCONS_00073495-exon-scaffold_93-1491911889:202096..202196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:202096..202196TCONS_00073495-exon-scaffold_93-1510915933:202096..202196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:202096..202196TCONS_00073495-exon-scaffold_93-1575043694:202096..202196Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:202784..202898TCONS_00073495-exon-scaffold_93-1491911889:202784..202898Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:202784..202898TCONS_00073495-exon-scaffold_93-1510915933:202784..202898Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:202784..202898TCONS_00073495-exon-scaffold_93-1575043694:202784..202898Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:203680..203817TCONS_00073495-exon-scaffold_93-1491911889:203680..203817Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:203680..203817TCONS_00073495-exon-scaffold_93-1510915933:203680..203817Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:203680..203817TCONS_00073495-exon-scaffold_93-1575043694:203680..203817Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:204211..204347TCONS_00073495-exon-scaffold_93-1491911889:204211..204347Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:204211..204347TCONS_00073495-exon-scaffold_93-1510915933:204211..204347Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:204211..204347TCONS_00073495-exon-scaffold_93-1575043694:204211..204347Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:204800..204902TCONS_00073495-exon-scaffold_93-1491911889:204800..204902Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:204800..204902TCONS_00073495-exon-scaffold_93-1510915933:204800..204902Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:204800..204902TCONS_00073495-exon-scaffold_93-1575043694:204800..204902Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1491911889:205151..206905TCONS_00073495-exon-scaffold_93-1491911889:205151..206905Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1510915933:205151..206905TCONS_00073495-exon-scaffold_93-1510915933:205151..206905Clytia hemisphaericaexon
TCONS_00073495-exon-scaffold_93-1575043694:205151..206905TCONS_00073495-exon-scaffold_93-1575043694:205151..206905Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073495-proteinTCONS_00073495-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:193950..206905 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
18.612 20.6394 12.091 11.075 5.17133 2.11615 2.80978 6.25482 10.6474 11.9909 14.5341 8.05256 8.69609 10.751 12.2563 11.6564 9.85271 10.4695 7.96346 12.2247 12.4193 13.2511 14.9545 16.8764 5.93501 6.62008 8.56525 11.2337 17.9366 13.957
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00073495 vs. Swiss-Prot (Human)
Match: MFSD1 (Major facilitator superfamily domain-containing protein 1 OS=Homo sapiens GN=MFSD1 PE=2 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 8.558e-56
Identity = 137/392 (34.95%), Postives = 199/392 (50.77%), Query Frame = 2
Query:  170 CLLTFGSYFCFDMPSVLQDSFTGTYGINCTTNSHNVTKCEEHLGMTETEYNLLYTVYAWMNALVVIGSGIFIDKV-GQRVGAVFFSALCVVGSAIFASGYFLKGRGSMLVLFLTGRLLFGAGNGSLTIAQNRISAYWFEGKELAFAFGATLSFSRLGSILNF----FLTKDFSQTYG------LKWTLWGGVFLCILGFGGALVLYVLDKNGMEQIAQREPGAKKSRKMKVGDIRHLSLQFVLLAVTTMSFYNTVFPFVADASQFIREKYHYSDDSEMPSYYAGSVYDVSLVATPILGIIVDYLGYRGLLAFVCAIF-TIPVYLILAFTTWHPLYGTVLLGLTYSAAATSLWPSAPLVVNPGVLGTALGLMTSLQMIGIGVCSLVVGAILDK 1309
            C L FGSYFC+D P+ LQ                  T+ +  + +  T++ LLY  Y+W N ++    G  ID+V G R G + FS    +G  +FA G    G  +   L   GR +FG G  SL +AQN  +  WF+GKEL   FG  LS +R+GS +N     +L        G      L  TL  G   CIL    AL L  LD+   E+I  +E G K    +K+ D++  SL   L+ +  + +Y  VFPF+     F  EK+ +S  S+  S     VY +S   +P+ G++VD  G + ++  +CA+  T+  +++LAFT W+P     LLGL+YS  A +LWP    VV    LGTA G M S+Q +G+ + S++ G ILD 
Sbjct:   50 CFLGFGSYFCYDNPAALQ------------------TQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALG----GIFNAFWLMEFGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALAYLDQRA-ERILHKEQG-KTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFS--SQAASAINSVVYVISAPMSPVFGLLVDKTG-KNIIWVLCAVAATLVSHMMLAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDS 414          
The following BLAST results are available for this feature:
BLAST of TCONS_00073495 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MFSD18.558e-5634.95Major facilitator superfamily domain-containing pr... [more]
back to top