Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073486 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073486
Unique NameTCONS_00073486
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2391

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073486 ID=TCONS_00073486|Name=TCONS_00073486|organism=Clytia hemisphaerica|type=transcript|length=2391bp
AGACAAATTACTTTTTACAGcttcaaaactaaaaacaaatGTCAAGTGAA
AGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAGAA
AAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCTTT
TTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGATG
TCAACAGACAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAATT
GAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCATTT
GGAGAAAACCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTGAG
CTtataaaacaagaaaaagaaagCATCAGCAAACATAGGAAGACATGTTC
AATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGATG
GCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGTGT
GGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACAGG
ACTACACACATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGACAT
TAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATCCT
GAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCCAT
CAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTGGG
GAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAGCA
GCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAATT
AGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAAAA
AAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGGCT
TTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGTGG
ACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGGAA
AATCCATCATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCTTC
AGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCTTA
TGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctcaaa
aaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTAAT
ATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATATTT
CATCATCTCTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGTCG
ATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAAAA
GCTGACAAAGCTGATTAGATTTGTGTTGAAGGATAGTATTTTATGACTTG
TTATCTAGTCATCATAATGTGGCTTATAGAGTGACCCCACTTTTAAGCGA
TAGTTGTAGCTATCTATGATATGCCCGCTGCAATTACTAGAACCTGGAAC
CTCCGGACCTACAATCAGCGCCGAATTATATTGGCAATTTGGGGTATatt
aacgtttttcaaaatttctcgggcaaaaattgtaatttcagtacttccac
tttgtttcagGGGATTTTTCGATTGAGGAGGGGTTACAGTGGCTTCCAAG
CTATGTTCTCTGCCATATTGGAACATATTTGAGCTTTTAGaccctgagat
cctaaggtcttaagtattaagtctaatgttaaaactcagagttaaaactc
tactttctaactcTACTTTAAAGggcttaaaaatcacttgcggttttaaa
gttttgagggaattccccttttgtgccaattATTTCGGCGCTGATCGTAG
GTCAAAAGACTACCGGAATAATGCAACTTACGACTTTCTAGCCACGTCTA
TTGNaaaagtctctcaaagggtcccaaagtcaccaaaattttgtctctca
aagggtcgattttcgattttcggctcggacatacccgtcacctcgcaaac
ctagtacccccccgggtttCGATCTCAAGTTTGAATTGTTTTACCTTAAT
TAGTGAGACGTTTTGGCTGAAGAAAACCTGGCGGATTCTCCAAGATCATT
TATTTTTCCAGCATTTGCCAATTTGCAATtcccatcaaaatttttttatt
cgatTCGGATTGCATTATAATTATATTCATATattttttctcttgttttt
cATCATTTAGAATATTAGGAACAAGTTAATAATAATTattggattttttc
aaattttagaataCTGAAAAATTGAGTTCGTAATGCTATCTTTGTTTGCA
AATTCACAAGTTAATTTGTAAACAAGAGAATCCCCCTCCCG
Run BLAST on NCBI

protein sequence of TCONS_00073486-protein

>TCONS_00073486-protein ID=TCONS_00073486-protein|Name=TCONS_00073486-protein|organism=Clytia hemisphaerica|type=polypeptide|length=459bp
MSSESQLNDWTVKQLQEELKKRKLSIYGRKSVLVERLFDLAKTEEVRNRN
SEMMSTDNENTVKHTQSSEELKEQRHQDREQRKKIVIWRKPLLTIHYFIL
ELFELIKQEKESISKHRKTCSILAIISFLVLSVYTWDGPHQSYVSGIEKY
LLWCGYWVGLGILSSVGLGTGLHTFLLYLGPHIAKVTLAAWECGSLNFPE
PPYPETILCPDSVADDSSTPINMFSIMSKVRLEAVMWGAGTAIGELPPYF
MARAARLSGEDDVDNEDLEELEDLISSDDQGLFTRLKKAVPQIVERVGFF
GILAFASIPNPLFDLAGITCGHCLVPFWTFFGATLIGKSIIKMHIQQTFV
ILCFSKRYVEQLLEFLSGVPYVGSYIQYPLERAVRAQKSKLHGASSGKAG
EDGNILGFIFEKFVTIMVVYFIISIVNSLAQSYAKKVDETKRQLNNGVGV
VPPKADKAD
Run BLAST on NCBI

transcript from alignment at scaffold_93:43447..50280+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073486 ID=TCONS_00073486|Name=TCONS_00073486|organism=Clytia hemisphaerica|type=transcript|length=6834bp|location=Sequence derived from alignment at scaffold_93:43447..50280+ (Clytia hemisphaerica)
AGACAAATTACTTTTTACAGcttcaaaactaaaaacaaatGTCAAGTGAA AGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAGAA AAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGGTATAAACTAtag atttttcatcatttttatgatttcattctattataattttttatgtTTGG TGTATGTCTTCTCAGTGAAATGGTTTTTTTaaggaaagttttttaaaatc taTAAAGTTTGTTTTACGACATGATTATATTAGTCATTGAACGCTCGATT ATTTCTTATTCTTCTTTGTATATTAGGTCAAAAAAAAgtagtcttgtttc cggaaatcggcATTTATTCCACGTGTGTTTGATCGCAGACATTTTTATAC AATTTAGATagataaattctgaaaatgtgaaaaaaaaatttgtggcCGGC CGGGTGAGTTTTTTTCGTAACCTGCACTTCCAGAAAcaagactacttttt ttttttggccttatATCTTATTGTTATATATTTGCTATCATCATTATGCC TCAAACTAATTTCATACCGACAACAATTTCCTTTGTAAACGATTattcct ttttgttttgttaattttattGTTAAAATGAATAGTAACAGATAGTAACA TTGTTAATTCTGAACTTGCAGGTTCTTGGCTGAAACTCTAGGCGttcttt tttttatctcctggtggacaagaaacaaaaaatatttaccatttgtttat ttttcaggtTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcggt aaaaatgatttttataatATATTGAATTGGATTTTACTGACAAATATCAC GCCTAATCtatttctttctgttttgtGAAAATAGGATTATTAAGATATTA CTGGCCTTTGAAAGATTGTATTAACTGtttatttgatttaatttttgttc TTCTAGCAATCGGAATTCTGAGATGATGTCAACAGGTAAAAATATTtgtt aagattttcaaagtTATAGCAAATGTATGGCATAGTCAAGAAAAACCCTA TTATGAATATTTAGGCCAAAACTGACCTTTTTCAAcataaaccaaaccaa tgtaaCAATGTATGTATGTTTTCCtatggaatagcccattatgGTAATCA ACCTAGTCCTCGTGTATCACTACACACTAGCGTTGAAAGATGTATTGGAT CCAAACAAGTttaattcaaaaagattttttttcgcaGACAATGAAAATAC AGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCAAG ATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCACG ATACATTATTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaaga aaggtAACATTTCCGCTCACAGTTACTATTCCAACAGTTTAGTATTTGTT CAATCTAGAGAGATTAAAATATTTACTCATAATTTCTGTAAAGTAACGTG TGCTAGGACTCTTTTATTTTCataggttttttttctttttactccTTTCA CCTatgaaaaacatgaaacaaAAAGTACATCTAGTACATAATACAATTTT TACACTTTATCCCTCTTAGCATCAGCAAACATAGGAAGACATGTTCAATT CTGGCTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGATGGCCC TCACCAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGAT ATTGGGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACAGGACTA CACACATTCTTATTGTATCTGGTAAGTAATAATCTTTTGTTTacactttt tttggattttaaaggCCATAAAAACTTTGGCTATGAATCCAAAAAGCTAA ACACTTCAAAGagaacataaaacttactgTCCGCTTCTGTAGTAATATCG GATGGTTTATTATAACACAATCTCTGACTGAAACTTGAGAAGGGATTAGT ACTTGCAACTATTTTTTATTACCAAGGataaataaagaacaaataaaaaa aagattaaaaacaaACTAGTTAGTACCAGGTACTAATCGACACATTTTCC TGAAAATCAGGATTAGTACTCCCTCTAGTCTGTCTCAGATTGTCTTGGAT TGATTCCTGATCTTTTCTGTTTTACCTGCCACAGTTTAATTCTATTTGTG CAAGGTATTCAAATAAGAATTTTACTCATACAGTATATTCTATATTTCTT TCAGGGCCCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTGGAT CACTTAATTTCCCTGAACCACCCTATCCTGAAACGTATGTTATCCTCCTC ACTTTTTACATCTGCAAAATGTTTcaacttttattctttattgaaAACAT CTTCAATATCCTATCCTCCTAGAAGCAATTTTGATTAATGAAATTTGATT ACCAAATCCAAATGAACTACgaaaaacgtggaaaacttggGAAAACTAAC TATATGATTTTTATATTCCCAAATTTAAAATTCCAactattttgggaccc ttgctCAGCCTAAAGTTGTTAGAGCCGTTAGAAGTTTCCCCTGGGCCACC AAGATAAGATTGAATATTTCCTGTACATTTTTAAGATagttttaaaactt tgttttgatatctCTTTTAGGATCTTGTGCCCAGACTCTGTTGCTGATGA TTCTTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAG AAGCTGTCATGTGGGTATggcatttgttttttttcatgatatttcctATC TGTTGACAAGAGCAAGCTTTGCACAATGTTGAATACACTCTTTTACATAT AAACACAAATTTCAGTTTAGAAtaagcttttttatttatttttctaggTA CTCTGAGCTTCAAGTTAATCTTATCCTATTCTTATTCTCTGAGTAAAATT GAGTTATTTTAAGGCTTTAGCTTATTTTTACCACATTGACCCTTTTTGAA TGGATTCAGGGATTTTAGGCTCAGCTTTAATTTTGAATTGTTTGTTTATT GTTTTGAGTCGCATTGTCTTGAAGAATGCTGAGTACACCAAAGTGTTTCC TGTATTGTTAAAGGAAAGTTTCATTtgattaatttatttttctctcATCT CTACTATTGGTGGATCACACTGAAGTTTTCTTTGACGTTTTCTTTCTTAA ATCTTTGACGTTTTCTATACAGGGAGCAGGCACAGCTATCGGAGAACTTC CACCTTACTTCATGGCAAGAGCAGGTAAGTTGTAGAGATCTTAGTTCACA TATTGATGCAATCCAATATGTATTTTGCGATTGAATAGCCCTGTTAAGAA AGTAAGCCTTCATCAACACTTATCCAGTGTGACTTCTATTGAtaatattt catgttttttttcatcCACAGCCAGGTTATCAGGGGAGGACGATGTGGAT AACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAGGT ATTATTACAAATACacttctttaatttttaaagattatcaTCCGATCTCA TTGGGTTTTGAATGGCTTTTTAAAACTCTTGCAGTACTGCTGAATCACTA TTCTGCATAGTAATAAAAATATTCTAATTACAGTAATTCTGTGTTAATGT CATCACACACATGATAAAAGTCACTATCGGCCAATGGTATTATACTATTT TATACCAATACAGTCCCCAAACAAACTAACTTTCTATTGATTTCTTGATT TATCTTTCTTCTCTAGGGACTTTTCACGAGGCTGAAAAAAGCTGTGCCAC AAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTCTGTA AGAATactgttatttttttttgtgtggGGGAGCGCAAAATCTTCCATCAA ACCATGGtcatattcatgatatacaccattgcaatgtcttccgttccacc caatagctgattggttgaaagtgacgtattgactgcttttacgtcacttc caaccaatgcgctattggttccgtgacgtaatgtcagaagacattgcagt ggtgcatatcataaatacaTGTGTTCAATTGAAAACTGATGACTATATGC TCACTTAGCAATATTAACAAAATAGGTGAAAGAAATTCGATTatcaattt ctgaaatttcaagCGAATATGAATTTAATCTTATCTCATGGTTTCCGTTT CCTTTCCAGATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGTGG ACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGGAA AATCCATCATCAAAATGCATATCCAAGTAACTTTTTTTATGGTTGATAGC TCCATACATTGTTTCATTGAacttactttcaattttttaaattaattgcA AGTTTTATTAGCCATCTTGCCGGAcgtgattttgaaaattctaattttct aacgaattttttctcattttcttatCAGCAAACATTTGTTATATTGTGCT TCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAGGTAGGGAATG GTTTGTTTGCATAGGTTTGaatcttttactttttgttTAGCAACCCGAAG CTTACCTTTTCTTTTGGATACTAAGAAATCGAAAACTATTAGTTAATCAA GTCAGGGTTTTATTCCTTCTTCAATCCgggtcaaaatatatttcctcgtt tttagaCGTTtagagttcgggcgagaaagtcacttttgggctatttgtta aatgtaatcgaatatttcagGGGCTTATATCCTTCCAgactatattctga gccctattggaccttTCTTGAACTTTATTTGGATcgtcagatcctaaggt cctaagtcttaagccTAGCGTCTTAACTCTACCTTTCTAACCTTAGTTAG AGCGCTTTAAATCGTTTCTGgctaagatttcgtgggaacttttctcaaat attatgaccttgattgttgGTCTAAGCTTGTGTTGATAGTATATCAACAA AATATGCTTTTAAACTTGGTCAGTGGGGattaaaatgtttaaatttcttt ttcactacAGTGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTA GAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGG AAAAGCCGGCGAGGTATAATATTTCTGACTTGTTCTATTGTTTTAGAGAT TTAGTTTATTTTAAAAGGTGAATGAAACTTCGTCCGGGTCAACctatgcc atgtgaggggaattgggtagtcagtccaaggtgctgacctGACGGGgtgc tcattgaaagcgtctgtagttgcgaaaataggcctgaaagcctcctgcaa ctcaaccaaatagaagtCATGAGTTTCTTGCTGAGACCCTTAGCTTATAC TTCCATCCAGGTGAAATGCAATTACATTTTTGCTCGTgaaatttcggcca aatttCCCTCCACAAAGATAACACTGGTTCCNTGCTCGTgaaatttcggc caaatttCCCTCCACAAAGATGACCCTGGTTCTAATACTAGTTTTGGTCC GTTGGTTTTGATTAAAAaaccttttcttttcattttcaaaaaacaatgaa aataaagcGTTTGTAGAAAATTATTATCCAGATGAAAGTGGACGGATGGA CTTATAGTATGATAATTTTTATTCCATTTTTTAGGACGGTAATATCCTTG GGTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATC TCTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAAC TAAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACA AAGCTGATTAGATTTGTGTTGAAGGATAGTATTTTATGACTTGTTATCTA GTCATCATAATGTGGCTTATAGAGTGACCCCACTTTTAAGCGATAGTTGT AGCTATCTATGATATGCCCGCTGCAATTACTAGAACCTGGAACCTCCGGA CCTACAATCAGCGCCGAATTATATTGGCAATTTGGGGTATattaacgttt ttcaaaatttctcgggcaaaaattgtaatttcagtacttccactttgttt cagGGGATTTTTCGATTGAGGAGGGGTTACAGTGGCTTCCAAGCTATGTT CTCTGCCATATTGGAACATATTTGAGCTTTTAGaccctgagatcctaagg tcttaagtattaagtctaatgttaaaactcagagttaaaactctactttc taactcTACTTTAAAGggcttaaaaatcacttgcggttttaaagttttga gggaattccccttttgtgccaattATTTCGGCGCTGATCGTAGGTCAAAA GACTACCGGAATAATGCAACTTACGACTTTCTAGCCACGTCTATTGNaaa agtctctcaaagggtcccaaagtcaccaaaattttgtctctcaaagggtc gattttcgattttcggctcggacatacccgtcacctcgcaaacctagtac ccccccgggtttCGATCTCAAGTTTGAATTGTTTTACCTTAATTAGTGAG ACGTTTTGGCTGAAGAAAACCTGGCGGATTCTCCAAGATCATTTATTTTT CCAGCATTTGCCAATTTGCAATtcccatcaaaatttttttattcgatTCG GATTGCATTATAATTATATTCATATattttttctcttgtttttcATCATT TAGAATATTAGGAACAAGTTAATAATAATTattggattttttcaaatttt agaataCTGAAAAATTGAGTTCGTAATGCTATCTTTGTTTGCAAATTCAC AAGTTAATTTGTAAACAAGAGAATCCCCCTCCCG

Coding sequence (CDS) from alignment at scaffold_93:43447..50280+

>TCONS_00073486 ID=TCONS_00073486|Name=TCONS_00073486|organism=Clytia hemisphaerica|type=CDS|length=19320bp|location=Sequence derived from alignment at scaffold_93:43447..50280+ (Clytia hemisphaerica)
atGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGA
GGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGg
tTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAAT
TCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTC
CTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGA
AAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTG
GAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCAGCAAACATAG
GAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGT
ACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTAT
CTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGG
CCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGCCCACACATTG
CAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAA
CCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTC
TTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAG
CTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTC
ATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGA
TCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCA
CGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTT
GGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGG
CATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAA
CCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACAAACATTTGTT
ATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAG
TGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTG
TCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGC
GAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCAT
GGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACG
CTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTT
GTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTGAAAGTCAATT
AAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAGAAAAGGAAAT
TATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCTTTTTGATCTA
GCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGATGTCAACAGA
CAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAAC
AAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAA
CCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTGAGCTtataaa
acaagaaaaagaaagCATCAGCAAACATAGGAAGACATGTTCAATTCTGG
CTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGATGGCCCTCAC
CAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGATATTG
GGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACAGGACTACACA
CATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGACATTAGCAGCA
TGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATCCTGAAACGAT
CTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCCATCAATATGT
TTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTGGGGAGCAGGC
ACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAGCAGCCAGGTT
ATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAATTAGAAGACC
TCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAAAAAAGCTGTG
CCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTC
TATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGTGGACATTGCT
TGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGGAAAATCCATC
ATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCTTCAGTAAAAG
ATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCTTATGTTGGTT
CATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctcaaaaaagtaaa
ttacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTAATATCCTTGG
GTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATCT
CTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAACT
AAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACAA
AGCTGATTAGatGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAAC
AACTGCAGGAGGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAA
TCAGTCCTGgtTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcg
CAATCGGAATTCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAAC
ATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAA
CAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTA
TTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCA
GCAAACATAGGAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTA
TTATCAGTGTACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAAT
CGAAAAGTATCTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTAT
CATCTGTTGGCCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGC
CCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAA
TTTCCCTGAACCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTG
CTGATGATTCTTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTT
CGCTTAGAAGCTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCC
ACCTTACTTCATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGG
ATAACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAG
GGACTTTTCACGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGT
TGGATTCTTTGGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCG
ACTTGGCTGGCATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTC
TTTGGAGCAACCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACA
AACATTTGTTATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCG
AATTTTTAAGTGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTA
GAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGG
AAAAGCCGGCGAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTG
TCACCATCATGGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCA
CAATCCTACGCTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGG
TGTCGGTGTTGTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTG
AAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAG
AAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCT
TTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGA
TGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAA
TTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCAT
TTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTG
AGCTtataaaacaagaaaaagaaagCATCAGCAAACATAGGAAGACATGT
TCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGA
TGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGT
GTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACA
GGACTACACACATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGAC
ATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATC
CTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCC
ATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTG
GGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAG
CAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAA
TTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAA
AAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGG
CTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGT
GGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGG
AAAATCCATCATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCT
TCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCT
TATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctca
aaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTA
ATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATAT
TTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGT
CGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAA
AAGCTGACAAAGCTGATTAGatGTCAAGTGAAAGTCAATTAAATGATTGG
ACAGTCAAACAACTGCAGGAGGAATTAAAGAAAAGGAAATTATCAATCTA
TGGCCGTAAATCAGTCCTGgtTGAAAGGCTTTTTGATCTAGCCAAAACTG
AAGAAGTTcgCAATCGGAATTCTGAGATGATGTCAACAGACAATGAAAAT
ACAGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCA
AGATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCA
CGATACATTATTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaa
gaaagCATCAGCAAACATAGGAAGACATGTTCAATTCTGGCTATCATCAG
TTTTTTGGTATTATCAGTGTACACGTGGGATGGCCCTCACCAATCATATG
TCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGATATTGGGTTGGCTTA
GGTATCTTATCATCTGTTGGCCTTGGTACAGGACTACACACATTCTTATT
GTATCTGGGCCCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTG
GATCACTTAATTTCCCTGAACCACCCTATCCTGAAACGATCTTGTGCCCA
GACTCTGTTGCTGATGATTCTTCCACACCCATCAATATGTTTTCCATCAT
GTCAAAAGTTCGCTTAGAAGCTGTCATGTGGGGAGCAGGCACAGCTATCG
GAGAACTTCCACCTTACTTCATGGCAAGAGCAGCCAGGTTATCAGGGGAG
GACGATGTGGATAACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAG
TGATGACCAGGGACTTTTCACGAGGCTGAAAAAAGCTGTGCCACAAATTG
TCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTCTATACCGAAC
CCTCTTTTCGACTTGGCTGGCATAACATGTGGACATTGCTTGGTCCCATT
TTGGACTTTCTTTGGAGCAACCTTAATCGGAAAATCCATCATCAAAATGC
ATATCCAACAAACATTTGTTATATTGTGCTTCAGTAAAAGATACGTCGAA
CAACTACTCGAATTTTTAAGTGGTGTGCCTTATGTTGGTTCATATATTCA
ATATCCGTTAGAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAG
CTTCTTCAGGAAAAGCCGGCGAGGACGGTAATATCCTTGGGTTTATCTTC
GAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATCTCTATCGTGAA
CTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAACTAAAAGACAAT
TAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACAAAGCTGATTAG
atGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGA
GGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGg
tTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAAT
TCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTC
CTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGA
AAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTG
GAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCAGCAAACATAG
GAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGT
ACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTAT
CTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGG
CCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGCCCACACATTG
CAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAA
CCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTC
TTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAG
CTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTC
ATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGA
TCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCA
CGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTT
GGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGG
CATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAA
CCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACAAACATTTGTT
ATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAG
TGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTG
TCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGC
GAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCAT
GGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACG
CTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTT
GTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTGAAAGTCAATT
AAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAGAAAAGGAAAT
TATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCTTTTTGATCTA
GCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGATGTCAACAGA
CAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAAC
AAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAA
CCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTGAGCTtataaa
acaagaaaaagaaagCATCAGCAAACATAGGAAGACATGTTCAATTCTGG
CTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGATGGCCCTCAC
CAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGATATTG
GGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACAGGACTACACA
CATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGACATTAGCAGCA
TGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATCCTGAAACGAT
CTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCCATCAATATGT
TTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTGGGGAGCAGGC
ACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAGCAGCCAGGTT
ATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAATTAGAAGACC
TCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAAAAAAGCTGTG
CCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTC
TATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGTGGACATTGCT
TGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGGAAAATCCATC
ATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCTTCAGTAAAAG
ATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCTTATGTTGGTT
CATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctcaaaaaagtaaa
ttacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTAATATCCTTGG
GTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATCT
CTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAACT
AAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACAA
AGCTGATTAGatGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAAC
AACTGCAGGAGGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAA
TCAGTCCTGgtTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcg
CAATCGGAATTCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAAC
ATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAA
CAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTA
TTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCA
GCAAACATAGGAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTA
TTATCAGTGTACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAAT
CGAAAAGTATCTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTAT
CATCTGTTGGCCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGC
CCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAA
TTTCCCTGAACCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTG
CTGATGATTCTTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTT
CGCTTAGAAGCTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCC
ACCTTACTTCATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGG
ATAACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAG
GGACTTTTCACGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGT
TGGATTCTTTGGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCG
ACTTGGCTGGCATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTC
TTTGGAGCAACCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACA
AACATTTGTTATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCG
AATTTTTAAGTGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTA
GAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGG
AAAAGCCGGCGAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTG
TCACCATCATGGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCA
CAATCCTACGCTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGG
TGTCGGTGTTGTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTG
AAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAG
AAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCT
TTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGA
TGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAA
TTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCAT
TTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTG
AGCTtataaaacaagaaaaagaaagCATCAGCAAACATAGGAAGACATGT
TCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGA
TGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGT
GTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACA
GGACTACACACATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGAC
ATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATC
CTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCC
ATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTG
GGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAG
CAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAA
TTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAA
AAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGG
CTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGT
GGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGG
AAAATCCATCATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCT
TCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCT
TATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctca
aaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTA
ATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATAT
TTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGT
CGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAA
AAGCTGACAAAGCTGATTAGatGTCAAGTGAAAGTCAATTAAATGATTGG
ACAGTCAAACAACTGCAGGAGGAATTAAAGAAAAGGAAATTATCAATCTA
TGGCCGTAAATCAGTCCTGgtTGAAAGGCTTTTTGATCTAGCCAAAACTG
AAGAAGTTcgCAATCGGAATTCTGAGATGATGTCAACAGACAATGAAAAT
ACAGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCA
AGATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCA
CGATACATTATTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaa
gaaagCATCAGCAAACATAGGAAGACATGTTCAATTCTGGCTATCATCAG
TTTTTTGGTATTATCAGTGTACACGTGGGATGGCCCTCACCAATCATATG
TCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGATATTGGGTTGGCTTA
GGTATCTTATCATCTGTTGGCCTTGGTACAGGACTACACACATTCTTATT
GTATCTGGGCCCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTG
GATCACTTAATTTCCCTGAACCACCCTATCCTGAAACGATCTTGTGCCCA
GACTCTGTTGCTGATGATTCTTCCACACCCATCAATATGTTTTCCATCAT
GTCAAAAGTTCGCTTAGAAGCTGTCATGTGGGGAGCAGGCACAGCTATCG
GAGAACTTCCACCTTACTTCATGGCAAGAGCAGCCAGGTTATCAGGGGAG
GACGATGTGGATAACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAG
TGATGACCAGGGACTTTTCACGAGGCTGAAAAAAGCTGTGCCACAAATTG
TCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTCTATACCGAAC
CCTCTTTTCGACTTGGCTGGCATAACATGTGGACATTGCTTGGTCCCATT
TTGGACTTTCTTTGGAGCAACCTTAATCGGAAAATCCATCATCAAAATGC
ATATCCAACAAACATTTGTTATATTGTGCTTCAGTAAAAGATACGTCGAA
CAACTACTCGAATTTTTAAGTGGTGTGCCTTATGTTGGTTCATATATTCA
ATATCCGTTAGAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAG
CTTCTTCAGGAAAAGCCGGCGAGGACGGTAATATCCTTGGGTTTATCTTC
GAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATCTCTATCGTGAA
CTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAACTAAAAGACAAT
TAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACAAAGCTGATTAG
atGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGA
GGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGg
tTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAAT
TCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTC
CTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGA
AAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTG
GAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCAGCAAACATAG
GAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGT
ACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTAT
CTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGG
CCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGCCCACACATTG
CAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAA
CCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTC
TTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAG
CTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTC
ATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGA
TCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCA
CGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTT
GGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGG
CATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAA
CCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACAAACATTTGTT
ATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAG
TGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTG
TCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGC
GAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCAT
GGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACG
CTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTT
GTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTGAAAGTCAATT
AAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAGAAAAGGAAAT
TATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCTTTTTGATCTA
GCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGATGTCAACAGA
CAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAATTGAAAGAAC
AAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCATTTGGAGAAAA
CCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTGAGCTtataaa
acaagaaaaagaaagCATCAGCAAACATAGGAAGACATGTTCAATTCTGG
CTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGATGGCCCTCAC
CAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGTGTGGATATTG
GGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACAGGACTACACA
CATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGACATTAGCAGCA
TGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATCCTGAAACGAT
CTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCCATCAATATGT
TTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTGGGGAGCAGGC
ACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAGCAGCCAGGTT
ATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAATTAGAAGACC
TCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAAAAAAGCTGTG
CCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGGCTTTTGCTTC
TATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGTGGACATTGCT
TGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGGAAAATCCATC
ATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCTTCAGTAAAAG
ATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCTTATGTTGGTT
CATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctcaaaaaagtaaa
ttacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTAATATCCTTGG
GTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATATTTCATCATCT
CTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGTCGATGAAACT
AAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAAAAGCTGACAA
AGCTGATTAGatGTCAAGTGAAAGTCAATTAAATGATTGGACAGTCAAAC
AACTGCAGGAGGAATTAAAGAAAAGGAAATTATCAATCTATGGCCGTAAA
TCAGTCCTGgtTGAAAGGCTTTTTGATCTAGCCAAAACTGAAGAAGTTcg
CAATCGGAATTCTGAGATGATGTCAACAGACAATGAAAATACAGTGAAAC
ATACCCAGTCCTCAGAAGAATTGAAAGAACAAAGACACCAAGATAGAGAA
CAGCGAAAGAAAATTGTCATTTGGAGAAAACCTTTGCTCACGATACATTA
TTTCATATTGGAACTCTTTGAGCTtataaaacaagaaaaagaaagCATCA
GCAAACATAGGAAGACATGTTCAATTCTGGCTATCATCAGTTTTTTGGTA
TTATCAGTGTACACGTGGGATGGCCCTCACCAATCATATGTCAGTGGAAT
CGAAAAGTATCTGTTATGGTGTGGATATTGGGTTGGCTTAGGTATCTTAT
CATCTGTTGGCCTTGGTACAGGACTACACACATTCTTATTGTATCTGGGC
CCACACATTGCAAAAGTGACATTAGCAGCATGGGAATGTGGATCACTTAA
TTTCCCTGAACCACCCTATCCTGAAACGATCTTGTGCCCAGACTCTGTTG
CTGATGATTCTTCCACACCCATCAATATGTTTTCCATCATGTCAAAAGTT
CGCTTAGAAGCTGTCATGTGGGGAGCAGGCACAGCTATCGGAGAACTTCC
ACCTTACTTCATGGCAAGAGCAGCCAGGTTATCAGGGGAGGACGATGTGG
ATAACGAAGATCTCGAAGAATTAGAAGACCTCATCTCCAGTGATGACCAG
GGACTTTTCACGAGGCTGAAAAAAGCTGTGCCACAAATTGTCGAACGAGT
TGGATTCTTTGGAATCCTGGCTTTTGCTTCTATACCGAACCCTCTTTTCG
ACTTGGCTGGCATAACATGTGGACATTGCTTGGTCCCATTTTGGACTTTC
TTTGGAGCAACCTTAATCGGAAAATCCATCATCAAAATGCATATCCAACA
AACATTTGTTATATTGTGCTTCAGTAAAAGATACGTCGAACAACTACTCG
AATTTTTAAGTGGTGTGCCTTATGTTGGTTCATATATTCAATATCCGTTA
GAAAGAGCTGTCCGAGctcaaaaaagtaaattacATGGAGCTTCTTCAGG
AAAAGCCGGCGAGGACGGTAATATCCTTGGGTTTATCTTCGAGAAGTTTG
TCACCATCATGGTTGTATATTTCATCATCTCTATCGTGAACTCGCTAGCA
CAATCCTACGCTAAGAAAGTCGATGAAACTAAAAGACAATTAAATAATGG
TGTCGGTGTTGTTCCACCAAAAGCTGACAAAGCTGATTAGatGTCAAGTG
AAAGTCAATTAAATGATTGGACAGTCAAACAACTGCAGGAGGAATTAAAG
AAAAGGAAATTATCAATCTATGGCCGTAAATCAGTCCTGgtTGAAAGGCT
TTTTGATCTAGCCAAAACTGAAGAAGTTcgCAATCGGAATTCTGAGATGA
TGTCAACAGACAATGAAAATACAGTGAAACATACCCAGTCCTCAGAAGAA
TTGAAAGAACAAAGACACCAAGATAGAGAACAGCGAAAGAAAATTGTCAT
TTGGAGAAAACCTTTGCTCACGATACATTATTTCATATTGGAACTCTTTG
AGCTtataaaacaagaaaaagaaagCATCAGCAAACATAGGAAGACATGT
TCAATTCTGGCTATCATCAGTTTTTTGGTATTATCAGTGTACACGTGGGA
TGGCCCTCACCAATCATATGTCAGTGGAATCGAAAAGTATCTGTTATGGT
GTGGATATTGGGTTGGCTTAGGTATCTTATCATCTGTTGGCCTTGGTACA
GGACTACACACATTCTTATTGTATCTGGGCCCACACATTGCAAAAGTGAC
ATTAGCAGCATGGGAATGTGGATCACTTAATTTCCCTGAACCACCCTATC
CTGAAACGATCTTGTGCCCAGACTCTGTTGCTGATGATTCTTCCACACCC
ATCAATATGTTTTCCATCATGTCAAAAGTTCGCTTAGAAGCTGTCATGTG
GGGAGCAGGCACAGCTATCGGAGAACTTCCACCTTACTTCATGGCAAGAG
CAGCCAGGTTATCAGGGGAGGACGATGTGGATAACGAAGATCTCGAAGAA
TTAGAAGACCTCATCTCCAGTGATGACCAGGGACTTTTCACGAGGCTGAA
AAAAGCTGTGCCACAAATTGTCGAACGAGTTGGATTCTTTGGAATCCTGG
CTTTTGCTTCTATACCGAACCCTCTTTTCGACTTGGCTGGCATAACATGT
GGACATTGCTTGGTCCCATTTTGGACTTTCTTTGGAGCAACCTTAATCGG
AAAATCCATCATCAAAATGCATATCCAACAAACATTTGTTATATTGTGCT
TCAGTAAAAGATACGTCGAACAACTACTCGAATTTTTAAGTGGTGTGCCT
TATGTTGGTTCATATATTCAATATCCGTTAGAAAGAGCTGTCCGAGctca
aaaaagtaaattacATGGAGCTTCTTCAGGAAAAGCCGGCGAGGACGGTA
ATATCCTTGGGTTTATCTTCGAGAAGTTTGTCACCATCATGGTTGTATAT
TTCATCATCTCTATCGTGAACTCGCTAGCACAATCCTACGCTAAGAAAGT
CGATGAAACTAAAAGACAATTAAATAATGGTGTCGGTGTTGTTCCACCAA
AAGCTGACAAAGCTGATTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045612XLOC_045612Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073486-proteinTCONS_00073486-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073486-exon-scaffold_93-1491911889:43447..43583TCONS_00073486-exon-scaffold_93-1491911889:43447..43583Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:43447..43583TCONS_00073486-exon-scaffold_93-1510915933:43447..43583Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:43447..43583TCONS_00073486-exon-scaffold_93-1575043694:43447..43583Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:44204..44244TCONS_00073486-exon-scaffold_93-1491911889:44204..44244Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:44204..44244TCONS_00073486-exon-scaffold_93-1510915933:44204..44244Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:44204..44244TCONS_00073486-exon-scaffold_93-1575043694:44204..44244Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:44403..44431TCONS_00073486-exon-scaffold_93-1491911889:44403..44431Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:44403..44431TCONS_00073486-exon-scaffold_93-1510915933:44403..44431Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:44403..44431TCONS_00073486-exon-scaffold_93-1575043694:44403..44431Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:44684..44849TCONS_00073486-exon-scaffold_93-1491911889:44684..44849Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:44684..44849TCONS_00073486-exon-scaffold_93-1510915933:44684..44849Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:44684..44849TCONS_00073486-exon-scaffold_93-1575043694:44684..44849Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:45066..45267TCONS_00073486-exon-scaffold_93-1491911889:45066..45267Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:45066..45267TCONS_00073486-exon-scaffold_93-1510915933:45066..45267Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:45066..45267TCONS_00073486-exon-scaffold_93-1575043694:45066..45267Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:45701..45780TCONS_00073486-exon-scaffold_93-1491911889:45701..45780Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:45701..45780TCONS_00073486-exon-scaffold_93-1510915933:45701..45780Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:45701..45780TCONS_00073486-exon-scaffold_93-1575043694:45701..45780Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:46117..46210TCONS_00073486-exon-scaffold_93-1491911889:46117..46210Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:46117..46210TCONS_00073486-exon-scaffold_93-1510915933:46117..46210Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:46117..46210TCONS_00073486-exon-scaffold_93-1575043694:46117..46210Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:46669..46720TCONS_00073486-exon-scaffold_93-1491911889:46669..46720Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:46669..46720TCONS_00073486-exon-scaffold_93-1510915933:46669..46720Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:46669..46720TCONS_00073486-exon-scaffold_93-1575043694:46669..46720Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:46868..46944TCONS_00073486-exon-scaffold_93-1491911889:46868..46944Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:46868..46944TCONS_00073486-exon-scaffold_93-1510915933:46868..46944Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:46868..46944TCONS_00073486-exon-scaffold_93-1575043694:46868..46944Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:47213..47293TCONS_00073486-exon-scaffold_93-1491911889:47213..47293Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:47213..47293TCONS_00073486-exon-scaffold_93-1510915933:47213..47293Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:47213..47293TCONS_00073486-exon-scaffold_93-1575043694:47213..47293Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:47656..47772TCONS_00073486-exon-scaffold_93-1491911889:47656..47772Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:47656..47772TCONS_00073486-exon-scaffold_93-1510915933:47656..47772Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:47656..47772TCONS_00073486-exon-scaffold_93-1575043694:47656..47772Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:47925..47986TCONS_00073486-exon-scaffold_93-1491911889:47925..47986Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:47925..47986TCONS_00073486-exon-scaffold_93-1510915933:47925..47986Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:47925..47986TCONS_00073486-exon-scaffold_93-1575043694:47925..47986Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:48507..48609TCONS_00073486-exon-scaffold_93-1491911889:48507..48609Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:48507..48609TCONS_00073486-exon-scaffold_93-1510915933:48507..48609Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:48507..48609TCONS_00073486-exon-scaffold_93-1575043694:48507..48609Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1491911889:49131..50280TCONS_00073486-exon-scaffold_93-1491911889:49131..50280Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1510915933:49131..50280TCONS_00073486-exon-scaffold_93-1510915933:49131..50280Clytia hemisphaericaexon
TCONS_00073486-exon-scaffold_93-1575043694:49131..50280TCONS_00073486-exon-scaffold_93-1575043694:49131..50280Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:43447..50280 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
57.96 58.7813 29.6423 25.9362 48.6788 38.762 44.2965 48.8615 34.6738 35.0251 29.3131 25.7266 26.5983 25.1674 26.2279 29.0337 35.4045 31.5505 13.6155 16.7658 24.4081 23.8971 41.4166 44.5414 45.658 41.7486 27.9359 20.8451 42.4149 37.9663
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003034SAP_dom
Blast
BLAST of TCONS_00073486 vs. Swiss-Prot (Human)
Match: VMP1 (Vacuole membrane protein 1 OS=Homo sapiens GN=VMP1 PE=1 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 2.099e-118
Identity = 206/360 (57.22%), Postives = 263/360 (73.06%), Query Frame = 3
Query:  285 KKIVIWRKPLLTIHYFILELFELIKQEKESISKHRKT--CSILAIISFLVLSVYTWDGPHQSYVSGIEKYLLWCGYWXXXXXXXXXXXXXXXHTFLLYLGPHIAKVTLAAWECGSLNFPEPPYPETILCPDSVADDSSTPINMFSIMSKVRLEAVMWGAGTAIGELPPYFMARAARLSGXX-XXXXXXXXXXXXXXXXXXQGLFTRLKKAVPQIVERVGFFGILAFASIPNPLFDLAGITCGHCLVPFWTFFGATLIGKSIIKMHIQQTFVILCFSKRYVEQLLEFLSGVPYVGSYIQYPLERAVRAQKSKLHGASSGKAGEDGNILGFIFEKFVTIMVVYFIISIVNSLAQSYAKKVDE 1355
            + IV+WR+PL+T+ YF LE+  ++K E  S   HR++   S L +++ L+ + Y  +G HQ YV  IEK  L   YW+GLGILSSVGLGTGLHTFLLYLGPHIA VTLAA+EC S+NFPEPPYP+ I+CPD    + +  I+++SI+SKVR+EA MWG GTAIGELPPYFMARAARLSG + D +     E     +   Q   +R K AV ++V++VGFFGILA ASIPNPLFDLAGITCGH LVPFWTFFGATLIGK+IIKMHIQ+ FVI+ FSK  VEQ++ F+  VP +G  +Q P +  + AQ+ KLH  S     +  N L ++FEK V +MV YFI+SI+NS+AQSYAK++ +
Sbjct:   42 QNIVLWRQPLITLQYFSLEILVILK-EWTSKLWHRQSIVVSFLLLLAVLIATYYV-EGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGT--ISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQ 397          
The following BLAST results are available for this feature:
BLAST of TCONS_00073486 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
VMP12.099e-11857.22Vacuole membrane protein 1 OS=Homo sapiens GN=VMP1... [more]
back to top