Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073486-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00073486-protein
Unique NameTCONS_00073486-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length459

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00073486-protein ID=TCONS_00073486-protein|Name=TCONS_00073486-protein|organism=Clytia hemisphaerica|type=polypeptide|length=459bp
MSSESQLNDWTVKQLQEELKKRKLSIYGRKSVLVERLFDLAKTEEVRNRN
SEMMSTDNENTVKHTQSSEELKEQRHQDREQRKKIVIWRKPLLTIHYFIL
ELFELIKQEKESISKHRKTCSILAIISFLVLSVYTWDGPHQSYVSGIEKY
LLWCGYWVGLGILSSVGLGTGLHTFLLYLGPHIAKVTLAAWECGSLNFPE
PPYPETILCPDSVADDSSTPINMFSIMSKVRLEAVMWGAGTAIGELPPYF
MARAARLSGEDDVDNEDLEELEDLISSDDQGLFTRLKKAVPQIVERVGFF
GILAFASIPNPLFDLAGITCGHCLVPFWTFFGATLIGKSIIKMHIQQTFV
ILCFSKRYVEQLLEFLSGVPYVGSYIQYPLERAVRAQKSKLHGASSGKAG
EDGNILGFIFEKFVTIMVVYFIISIVNSLAQSYAKKVDETKRQLNNGVGV
VPPKADKAD
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_045612XLOC_045612Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00073486TCONS_00073486Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003034SAP_dom
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003034SAP domainSMARTSM00513sap_9coord: 7..41
e-value: 2.5E-6
score: 37.0
IPR003034SAP domainGENE3D1.10.720.30coord: 5..84
e-value: 8.8E-10
score: 38.0
IPR003034SAP domainPFAMPF02037SAPcoord: 7..37
e-value: 2.0E-8
score: 33.7
IPR003034SAP domainPROSITEPS50800SAPcoord: 7..41
score: 8.568
IPR003034SAP domainSUPERFAMILY68906SAP domaincoord: 6..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..77

Blast
BLAST of TCONS_00073486-protein vs. Swiss-Prot (Human)
Match: VMP1 (Vacuole membrane protein 1 OS=Homo sapiens GN=VMP1 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.095e-144
Identity = 208/361 (57.62%), Postives = 270/361 (74.79%), Query Frame = 0
Query:   83 KKIVIWRKPLLTIHYFILELFELIKQEKESISKHRKT--CSILAIISFLVLSVYTWDGPHQSYVSGIEKYLLWCGYWVGLGILSSVGLGTGLHTFLLYLGPHIAKVTLAAWECGSLNFPEPPYPETILCPDSVADDSSTPINMFSIMSKVRLEAVMWGAGTAIGELPPYFMARAARLSGEDDVDNEDLEELEDLI--SSDDQGLFTRLKKAVPQIVERVGFFGILAFASIPNPLFDLAGITCGHCLVPFWTFFGATLIGKSIIKMHIQQTFVILCFSKRYVEQLLEFLSGVPYVGSYIQYPLERAVRAQKSKLHGASSGKAGEDGNILGFIFEKFVTIMVVYFIISIVNSLAQSYAKKVDE 439
            + IV+WR+PL+T+ YF LE+  ++K E  S   HR++   S L +++ L+ + Y  +G HQ YV  IEK  L   YW+GLGILSSVGLGTGLHTFLLYLGPHIA VTLAA+EC S+NFPEPPYP+ I+CPD    + +  I+++SI+SKVR+EA MWG GTAIGELPPYFMARAARLSG +  D+E+ +E E+++  +   Q   +R K AV ++V++VGFFGILA ASIPNPLFDLAGITCGH LVPFWTFFGATLIGK+IIKMHIQ+ FVI+ FSK  VEQ++ F+  VP +G  +Q P +  + AQ+ KLH  S     +  N L ++FEK V +MV YFI+SI+NS+AQSYAK++ +
Sbjct:   42 QNIVLWRQPLITLQYFSLEILVILK-EWTSKLWHRQSIVVSFLLLLAVLIATYYV-EGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGT--ISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEP-DDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQ 397          
The following BLAST results are available for this feature:
BLAST of TCONS_00073486-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
VMP12.095e-14457.62Vacuole membrane protein 1 OS=Homo sapiens GN=VMP1... [more]
back to top