Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073482 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073482
Unique NameTCONS_00073482
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1195

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073482 ID=TCONS_00073482|Name=TCONS_00073482|organism=Clytia hemisphaerica|type=transcript|length=1195bp
TGTAAAACGAAATTTTAACCCTCTTCACATCATTACTCACAAATTgtaaa
gaacaatttttttcaaagcacCTGTCTCACTAGGAGTCTAGGAGCCCATT
CAAACCCTTCCTGAAATCCTAAAAGATAACAAATCTAACattgtttttta
ataataatcttgatttttaaataatttgaataaatccTATAAAATATAAC
AGCTAAAGACAAATACTCCTTTAAGATATTCATAATATCTTACTTAATAG
CAAAGCAGAGAGATCTACTTAAATAAAATccaaaatatcattaaaaattc
tAGATCTACAAGGGTCccgtataacaaaataaattataGCTAGAAAGCCT
TTTGAGCTAGGGCAATCATGTTAAAATTATAATTGCCAGGGTCTCTTTCC
ATAAATTTCTTACAAACCACTGCAGTATCTTCGAGTAGAGTATCAGCACT
TGTTTTCCCATGGTTGATGGGGAAGGGTTTGCGACCATCAAGCTCATACA
AGAAACCATCTTTCTCAACAAAAGCAATGAAGTGAAGATCAACTTTCTCA
TCGATGGAAGGGGCTTTTGTTTGTCCCTCCTGCGCACTGTCGCCATGACA
ACGTGTTACACCTTCATGTTTTTCCAAAGCAACAGCCCTTTCGTCTGGTG
TCATCGACTTTGTGCTATCCAAGTAGTCTTTAACGACGCTACCATCTTTG
AAAGTCAGCTTTTCTACATTATTAGCTATAGCATGAATAATTCCAACAGT
TCCACAAGCATTACCTACAGTTTGCTTTGTGAAATACACATTATCGCTCA
CTGTTTGCCCTTCTTTTGTTATCTTTTCTTCTTCCTCTTTGCGAaagttt
tcataattttcagtGATTGGGAAAAGCAAAACTAAAGATACCACAGGCCT
TGGAACCATCATTAAAAGATCAGGTTCAAAACCATAGACATCACTGTATG
CCAAAACAGACATGTCCACACCAAGGTTTTCTGTGTATTTGTTCATCACA
TCTGGATTGGACTCTAATGGCAGCCATCTTGGTTTagacatgttgttttt
tttttccttttggaATTAACTAAAcacaaacatcaaaatttcagctttta
gGATTATCATATTATGGAGTATAACAGAGTATAAAACAATAATATGTCAG
CAAAATGAttaagttttttatgaaataaaataattttgttactCT
Run BLAST on NCBI

protein sequence of TCONS_00073482-protein

>TCONS_00073482-protein ID=TCONS_00073482-protein|Name=TCONS_00073482-protein|organism=Clytia hemisphaerica|type=polypeptide|length=233bp
MSKPRWLPLESNPDVMNKYTENLGVDMSVLAYSDVYGFEPDLLMMVPRPV
VSLVLLFPITENYENFRKEEEEKITKEGQTVSDNVYFTKQTVGNACGTVG
IIHAIANNVEKLTFKDGSVVKDYLDSTKSMTPDERAVALEKHEGVTRCHG
DSAQEGQTKAPSIDEKVDLHFIAFVEKDGFLYELDGRKPFPINHGKTSAD
TLLEDTAVVCKKFMERDPGNYNFNMIALAQKAF
Run BLAST on NCBI

transcript from alignment at scaffold_92:235301..236495

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073482 ID=TCONS_00073482|Name=TCONS_00073482|organism=Clytia hemisphaerica|type=transcript|length=1195bp|location=Sequence derived from alignment at scaffold_92:235301..236495 (Clytia hemisphaerica)
AGagtaacaaaattattttatttcataaaaaacttaaTCATTTTGCTGAC ATATTATTGTTTTATACTCTGTTATACTCCATAATATGATAATCctaaaa gctgaaattttgatgtttgtgTTTAGTTAATtccaaaaggaaaaaaaaaa caacatgtctAAACCAAGATGGCTGCCATTAGAGTCCAATCCAGATGTGA TGAACAAATACACAGAAAACCTTGGTGTGGACATGTCTGTTTTGGCATAC AGTGATGTCTATGGTTTTGAACCTGATCTTTTAATGATGGTTCCAAGGCC TGTGGTATCTTTAGTTTTGCTTTTCCCAATCactgaaaattatgaaaact tTCGCAAAGAGGAAGAAGAAAAGATAACAAAAGAAGGGCAAACAGTGAGC GATAATGTGTATTTCACAAAGCAAACTGTAGGTAATGCTTGTGGAACTGT TGGAATTATTCATGCTATAGCTAATAATGTAGAAAAGCTGACTTTCAAAG ATGGTAGCGTCGTTAAAGACTACTTGGATAGCACAAAGTCGATGACACCA GACGAAAGGGCTGTTGCTTTGGAAAAACATGAAGGTGTAACACGTTGTCA TGGCGACAGTGCGCAGGAGGGACAAACAAAAGCCCCTTCCATCGATGAGA AAGTTGATCTTCACTTCATTGCTTTTGTTGAGAAAGATGGTTTCTTGTAT GAGCTTGATGGTCGCAAACCCTTCCCCATCAACCATGGGAAAACAAGTGC TGATACTCTACTCGAAGATACTGCAGTGGTTTGTAAGAAATTTATGGAAA GAGACCCTGGCAATTATAATTTTAACATGATTGCCCTAGCTCAAAAGGCT TTCTAGCtataatttattttgttatacggGACCCTTGTAGATCTagaatt tttaatgatattttggATTTTATTTAAGTAGATCTCTCTGCTTTGCTATT AAGTAAGATATTATGAATATCTTAAAGGAGTATTTGTCTTTAGCTGTTAT ATTTTATAggatttattcaaattatttaaaaatcaagattattattaaaa aacaatGTTAGATTTGTTATCTTTTAGGATTTCAGGAAGGGTTTGAATGG GCTCCTAGACTCCTAGTGAGACAGgtgctttgaaaaaaattgttctttac AATTTGTGAGTAATGATGTGAAGAGGGTTAAAATTTCGTTTTACA

Coding sequence (CDS) from alignment at scaffold_92:235301..236495

>TCONS_00073482 ID=TCONS_00073482|Name=TCONS_00073482|organism=Clytia hemisphaerica|type=CDS|length=702bp|location=Sequence derived from alignment at scaffold_92:235301..236495 (Clytia hemisphaerica)
atgtctAAACCAAGATGGCTGCCATTAGAGTCCAATCCAGATGTGATGAA
CAAATACACAGAAAACCTTGGTGTGGACATGTCTGTTTTGGCATACAGTG
ATGTCTATGGTTTTGAACCTGATCTTTTAATGATGGTTCCAAGGCCTGTG
GTATCTTTAGTTTTGCTTTTCCCAATCactgaaaattatgaaaacttTCG
CAAAGAGGAAGAAGAAAAGATAACAAAAGAAGGGCAAACAGTGAGCGATA
ATGTGTATTTCACAAAGCAAACTGTAGGTAATGCTTGTGGAACTGTTGGA
ATTATTCATGCTATAGCTAATAATGTAGAAAAGCTGACTTTCAAAGATGG
TAGCGTCGTTAAAGACTACTTGGATAGCACAAAGTCGATGACACCAGACG
AAAGGGCTGTTGCTTTGGAAAAACATGAAGGTGTAACACGTTGTCATGGC
GACAGTGCGCAGGAGGGACAAACAAAAGCCCCTTCCATCGATGAGAAAGT
TGATCTTCACTTCATTGCTTTTGTTGAGAAAGATGGTTTCTTGTATGAGC
TTGATGGTCGCAAACCCTTCCCCATCAACCATGGGAAAACAAGTGCTGAT
ACTCTACTCGAAGATACTGCAGTGGTTTGTAAGAAATTTATGGAAAGAGA
CCCTGGCAATTATAATTTTAACATGATTGCCCTAGCTCAAAAGGCTTTCT
AG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045610XLOC_045610Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073482-proteinTCONS_00073482-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073482-exon-scaffold_92-1491911889:235301..236495TCONS_00073482-exon-scaffold_92-1491911889:235301..236495Clytia hemisphaericaexon
TCONS_00073482-exon-scaffold_92-1510915933:235301..236495TCONS_00073482-exon-scaffold_92-1510915933:235301..236495Clytia hemisphaericaexon
TCONS_00073482-exon-scaffold_92-1575043694:235301..236495TCONS_00073482-exon-scaffold_92-1575043694:235301..236495Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:235301..236495 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
157.455 163.052 26.3181 17.2584 46.3395 34.5092 51.1172 54.4381 38.9017 38.6465 30.4756 23.9874 23.3319 18.5145 29.1353 33.7443 57.1016 44.8506 11.1687 15.8099 32.7016 29.373 86.8844 74.3396 55.8228 52.5788 36.0166 23.7472 40.7354 41.0553
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001578Peptidase_C12_UCH
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Molecular Function
TermDefinition
GO:0004843thiol-dependent ubiquitin-specific protease activity
Vocabulary: Biological Process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
cellular_component GO:0005622 intracellular
molecular_function GO:0004843 thiol-dependent ubiquitin-specific protease activity
Blast
BLAST of TCONS_00073482 vs. Swiss-Prot (Human)
Match: UCHL3 (Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens GN=UCHL3 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 7.555e-90
Identity = 140/229 (61.14%), Postives = 175/229 (76.42%), Query Frame = -2
Query:  355 MSKPRWLPLESNPDVMNKYTENLGVDMSVLAYSDVYGFEPDLLMMVPRPVVSLVLLFPITXXXXXXXXXXXXKITKEGQTVSDNVYFTKQTVGNACGTVGIIHAIANNVEKLTFKDGSVVKDYLDSTKSMTPDERAVALEKHEGVTRCHGDSAQEGQTKAPSIDEKVDLHFIAFVEKDGFLYELDGRKPFPINHGKTSADTLLEDTAVVCKKFMERDPGNYNFNMIALA 1041
            M   RWLPLE+NP+V N++ + LG+  +   + DVYG +P+LL MVPRPV +++LLFPITE YE FR EEEEKI  +GQ V+ +VYF KQT+ NACGT+G+IHAIANN +K+ F+ GS +K +L+ + SM+P+ERA  LE ++ +   H  SA EGQT+APSIDEKVDLHFIA V  DG LYELDGRKPFPINHG+TS +TLLED   VCKKFMERDP    FN IAL+
Sbjct:    1 MEGQRWLPLEANPEVTNQFLKQLGLHPN-WQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALS 228          
The following BLAST results are available for this feature:
BLAST of TCONS_00073482 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
UCHL37.555e-9061.14Ubiquitin carboxyl-terminal hydrolase isozyme L3 O... [more]
back to top