Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073468 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073468
Unique NameTCONS_00073468
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2644

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073468 ID=TCONS_00073468|Name=TCONS_00073468|organism=Clytia hemisphaerica|type=transcript|length=2644bp
TGAAGGAGGTCAATCATTTTACCATTATTTTGCACCACCTCTTCCAAAGA
ATGTTATCATGTTTGCAACAAACAACAATTCAATCCAAGAACAGTTTGAA
GTGAGAGTTAGTATTGATCCCAGTGTAGAGGATAAGAAAATCGGCGAATT
CTCAAGAGATAAAGATTGTTTTGTATGGAAAGTTGACTTGACAGAGGAAG
AAGTGGATGCAacaaataaagttttaaaaatggATCGATTACTTAAAATT
AGTGTGACCAAACAAGGAGCTGATGAAGGATTCTCTTCTCAAGACAAAGA
TGAAGAAGATTTAGTTTTTGATAACGACAATGATGATATcacagaatttg
aaaaaagtttagaaaaattTGAAGACGACTTCAAGGAAAACCAATCAGCC
ATCAAAACACTTCATAAAAAGGTTGCTTCTCTACCAACCAAATCATCAAC
TAAAAAGAAAGTATCCGATTTCTTCAAACCtaaacaacagaaaaaaaatt
ctgatttcaaagctaaaacaataaCCAGTAAAGAAACTGTTCTGACAGAA
ACTAAAGATAAAGTCAATGACTCTGATGGTGATAAAGAACAAAAGGGAAA
AAGACCACACCCATTTGTCGACTCCCCTGAATCTAAACCAAAGAAAGCAA
TGATGCAAGCCAAACCTTCCAAAACACCAGAGATGGCTAAGAGAAGAGTC
ATAAGGAAATCTGGGAAGTCACCAGCAGCTAAATTTTCTGATCTCATTTC
TCATGAAAATCCTACAGGACGGTGGGGTCATGGATGCTGCAAGATTTGTC
ATGATAAAGCAATAGTCATTGGTGGTCAAACCAAACAACAGATGAATACT
GATTCTATGTGGCTTCTTGACTTGAAAACCCGAAAATGGGAGTTACAAAA
GTCCGATAATTCTACAATTGATCGTCGTGTCGGACATAGTGTCGTATATG
ACGAAAAAAGAAACCTCGTTTTTGTTTATGGTGGATCAAAACCGAAGAAA
TGGTATAGTGATGTTTATTCACTGAATCTTGCCACTTTCGAATGGGAAAA
ATCAGAGACCATTGGTAAAGCCCCAACAAGAGCTTATCACTCATGCAACA
AATTTCACGACGAACTTTTTGTATTTGGGGGTGTTTACCCAAACCCTGAC
CCTGACCCTGATGGTTGCAGCAATGAACTCGTCATTTATGATATTGCAAA
TAAAAGTTGGTACACACCTATCATTAGCGGTGATATTCCGAATCCTCGAT
CGGAGTAAGTTCCTCACTCTAGATTTGACAGCATCTCGTCGATCTTTTAA
TAACACTCCTGTACTGTCATTCAGCAGTGATGATTGGTTCCAAATTGTAC
ATTTTCGGTGGCTGGGATGCGCCGACCTGTCATGATGATATCTATTGTCT
CGATATAGTCATAATGAAGTATACGAGATTGAAACCTATTGGTGAAGGTC
CGTCTGCCCGTACTTGGCATTCCACCTCTGTTCTATCAAATCCAAATCAA
TTTTGTATTTATGGTGGCTTCGATGGCAACGACAGTTTGAATGATCTTTT
TGTTTTCGATTCAGTCAAAACGTGTTGGAGCAAGATACATAACGAGCATA
ATTCCATTTTACGTGCTGGTCATACATCACTGTTGATGACGTCACCATAT
AgtgatgatgacgtcacaaaagcCAACAACAAAAGTCAGGTGTTAATTTT
CGGAGGCGGTGATAACGCCGGACAATTTTATAACGATGTCATTCTACTGG
ATGTGAAATAGCAAAAGTGTCGTTTACTATATTTCgtgttttttaatatt
ttttttttggtatttttatttaGTATGATTCTTATGTTTATCTCTTTTAG
GCGAGATTAGGTAAAGAATATTATCATTTAAGATTCTCCATATTTGTGGT
AGTGTATATAgaattaaagggacataaaagtactgacgaaattagtaaac
aaaccatatgtggcgggatacaaaatcaaaacaaatgtcacatgtcaaaa
tcaaaaatcaaaaNNNNNNNNNNNNNNNNNNNaaaatcaaaacaaatgtc
acatgtcaaaatcaaaaatcaaaacaaatatggctgattttgattgtttc
aattgttttacaagtttgttttggacacgtgattttaattgttttcttta
atgacacgtggtttgtgcaatgtttacattttactacttttatgtccctt
taagcagGCAGCAATTATGTGTGATTTCAGGAGTTCTATATGTGCTTTAA
CCTCCTTTCAGAGAGATGAGTTAAATAccgaaattcatgatattcatgac
gtaatgttttctacggaaagaccccggtttttgccagtagtggcactttt
ttacaccttttgtctagtttataagtgccactactggctaaaaccgaggt
atttccgtagaaaacattacgtcatgactATCAAGAAATTAATTCGTAAA
TGCATGCTCCTCCCATGCTCCTCTGATCTTACGCGAATTGTATTCACGAA
TTTTGAATTGAATGAACATTACttgcaaatttcttttcatatttTAATAT
ATATTAAAACTTTAAATCCGAATGTGGTTTTAGAATGATCCAAAATTACT
TATACTTTGTATGACGTCCTGTTGTTATCTATTCATTATTTAAT
Run BLAST on NCBI

transcript from alignment at scaffold_92:259747..269889-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073468 ID=TCONS_00073468|Name=TCONS_00073468|organism=Clytia hemisphaerica|type=transcript|length=10143bp|location=Sequence derived from alignment at scaffold_92:259747..269889- (Clytia hemisphaerica)
TGAAGGAGGTCAATCATTTTACCATTATTTTGCACCACCTCTTCCAAAGA ATGTTATCATGTTTGCAACAAACAACAATTCAATCCAAGAACAGTTTGAA GTGAGAGTTAGTATTGATCCCAGTGTAGAGGATAAGAAAATCGGCGAATT CTCAAGAGATAAAGATTGTTTTGTATGGAAAGTTGACTTGACAGAGGAAG AAGTGGATGCAACAAATAAAGTTTTAAAAATGGTATGGAAGGGTTTTTGT TCAAAGAAAGTCTTATAATTACTCCCTCAAGCAGCTTTAGAAGTTTTATA AACAAAAAAGGAACCTTGTACATTCACACAAAATTTTTACATACTGCTTT TTGTTAACCTGTTTTTGTTGGACTGTAATAAGGGTTTTCAGAAAACCTGA ACAAGGATCTATATTTCCTCCCATCTTAGCTTACAAAGTATAGTTACAAT AAAAAGTTTGCAATTTCTTCCTTTGATAACTTATTAACAATTTATTTTTT CTTAGGATCGATTACTTAAAATTAGTGTGACCAAACAAGGAGCTGATGAA GGATTCTCTTCTCAAGACAAAGATGAAGAAGATTTAGTTTTTGATAACGA CAATGATGATATCACAGAATTTGAAAAAAGTTTAGAAAAATTTGAAGACG ACTTCAAGGAAAACCAATCAGCCATCAAAACACTTCATAAAAAGGTTGCT TCTCTACCAACCAAATCATCAACTAAAAAGAAAGTATCCGATTTCTTCAA ACCTAAACAACAGAAAAAAAATTCTGATTTCAAAGCTAAAACAATAACCA GTAAAGAAACTGTTCTGACAGAAACTAAAGATAAAGTCAATGACTCTGAT GGTGATAAAGAACAAAAGGGAAAAAGACCACACCCATTTGTCGAGTTAGT ACACTCTATATTCTTTTATGTTTCCATTAGACAACAGTCAGTTGACTTGG GTATCAATGAACTGAGAAGAGAGTAGAGAACTCAATATTATCCAAAAGTT ACTTTAGGCATACAAACTTTCGCGGGCAGAAACTTTCGCGATGTCGAAAA ATCGCGAAATGTTATTCGCGAGCATAAACTTTCGCAAATCGTTAGATAAA AATGAGAATTTTCGAATAAAAATTGCCTTAAATTGAAAAATATTCATTAA ATCCACTAAAGACGATTGCTCTTCGATTTTAAAATGGCATTAAAGGATAA TAATATGCCTAAAATTTGATTTCTATTACGATTTCGAGGTTTTTTGATTT TAAATTTTTTAAGAATATTTCGTGAGCATAAACTTTCGCGAATTGCCCTG TTAATAATTTTCAAAGACATTTACTTTCGCGAAAAAGGCCAAAGTTCGCG AAATTCGCGAAAGTTTCTGCTTGCGAAACTTTTTACGCCTAAAGTAATGG CGATCTTGACACTTGTCAACATCCATGAATTATACGTTGTTAATCACGCC TTAATTCATTCAGCTAAGTTTTTGTCTCGACAGCTCAAATTTAAAAAGTG TAATTATTTCACTAAAGACTGGTCTTAATGATGATTTGTTCTAGCTCCCC TGAATCTAAACCAAAGAAAGCAATGATGCAAGCCAAACCTTCCAAAACAC CAGAGATGGCTAAGAGAAGAGTCATAAGGAAATCTGGGAAGTCACCAGCA GCTAAATTTTCTGATCTCATTTCTCATGAAAGTAAGCATTTGAGAAATTG CAATTATTGTTTTTGTTAACTGGTTGTTGTTTTTTTTATGCGGTCTGTAC GAGATTTTTTTAAGCAATGGAATTGGATCTTTTCGCACGAGGACAGGCTT ACACAGCCTGTCTGACAAAAAATCGACAGGAAAATGACACTTTCAAATTT CTGCTTGATTGATTTAAAGAAGTTATTACATGTGCGTCAAAAGAAGGTAA ATTGCATTGTCTTTAAATTGTCGACTTTCTGTCGTCTTTTGTCTAAAATA AGGGAAGACTAAAAAATGCTTTCAAAACTTTGTATTCAACCTTACAGATC CTACAGGACGGTGGGGTCATGGATGCTGCAAGATTTGTCATGATAAAGCA ATAGTCATTGGTGGTCAAACCAAACAACAGATGAATACTGATTCTATGTG GCTTCTTGACTTGAGTAAGTAGCATGAAGCAATAATTCAAAATATTGTTG TGGATCAATAGATTATTGTATTTTTTTGCTTGCCTTGATTCATCCCTGAG GTGATTTATTACCATGACAATTTCGTTTCCTCTTCTAAATTCCCTCGATT AGATAAGGCTGTAACAATAACAAAGGTGCTTGAATTTGACTGAAAAAAGC AATTATAAAAAATTAAAAGTTCTTTTGGGGTTTTAATTATTTAAGTCAGG AGATAATATTATAAAGAAGTGGTATTTTATATTCATTATAGCCTTGTTTT TCACCGATAGACACATCAAAATCTCTAAAAATCGAGTAGTCTTCTATTTA AAACCTTTTCAGAAACCCGAAAATGGGAGTTACAAAAGTCCGATAATTCT ACAATTGATCGTCGTGTCGGACATAGTGTCGTATATGACGAAAAAAGAAA CCTCGTTTTTGTTTATGGTGGATCAAAACCGAAGAAATGGTATAGTGATG TTTATTCACTGAATCTTGCCACTTTCGAATGGGAAAAATCAGAGGTATAT CTCTTTTTGATTCGAATCTATTATCAGCTCTTAAAAGCAGAACAAATTAA GTATTGAATGGAGAGCTTCAGCTTAGGAGCTGTTTTAAAAATGGAGGCAA GCTGGCCCAGGTGAGATGGGATGGATAGCTAAAAAAATCATATTGTATCA TATTTCAATTTGATTTAGCATAAAGACATAATCCTGAAAATTTGAAGTCA TTTTGTTAAAAATAAATCAAAGGATATTTCACTTTCATTTTCGGTCAGAG TGTGCAAACAGTACTTTTAAAAATCGTTTTGTGTGAAAACAAAATAGTTT TTTATTTGAAATTTTCACAGGTTTGCTTACGCACATTTCTACGTCACAAA TATCAATTTCGTAATTTTTCTAGAGATTTAATGTAGGTACTATTATATTT CTAGACCATTGGTAAAGCCCCAACAAGAGCTTATCACTCATGCAACAAAT TTCACGACGAACTTTTTGTATTTGGGGGTGTTTACCCAAACCCTGACCCT GACCCTGATGGTTGCAGCAATGAACTCGTCATTTATGATATTGGTATGTT TTTATATTTCATTAATACAAATTCATCATGTTTTCTGTTGTCATTCCCAA GGAAAATAAAAGATAAAAGAGGCTCTTCTATTGAGCCAAGGGCGGGTATT TTAAGGTATCCTCAGAACATTTATATCGTGTACATCCTTAAAGTTTTTCG AGATAATTCGCAGAATACGGGCAAATAAAAAAAACCGTGTGTCTGATTTT CAATCACTTCTTGTTTCTTACATTTTCCTACGAAAATTCACAAACTATTT CCACAAAAATTTTCTTCTTGACATTTCAGCAAATAAAAGTTGGTACACAC CTATCATTAGCGGTGATATTCCGAATCCTCGATCGGAGTAAGTTCCTCAC TCTAGATTTGACAGCATCTCGTCGATCTTTTAATAACACTCCTGTACTGG TAAGAATGGAATTGTCTTTCATATGTGGGAATTCAGATTCTACCGTGGTT GATCTGGTATTTCGAGGTTTTTGGTTATTTTGCTTTCGGCAGCCGCCTTT TTAAGAGGCGGCCGCCAGTTATAATCCGCGGCCGCCTTTTACAAAGAGCG GCCGCCTTTTATGATAAGCGGCCACCTTTTTCCTTCGAAAAAGGAGACCG CCCTTTATAACTGGCGCCCACTCTTTATAACAGGCGGCCGCCCTTTAAAA ACGCGGCCGCTATTTATAAAGGGCGGCCACGTTTTTTAAAAGGCGGCCGC TTCTTTTACCGCCTTTTTCATAATCTGGTCTGTGAAATACAAGAGTCGTC AAAGTTAATCGCGTGGTAAGGATAGGATTAGAGTGTAAATATATATACAC AGTATAATATAATATACAATATACAGTACTGTACAGTACTGTAATCGAGA TAATGTTTTTAGAGCCGAACATCAACTTGGGTGTGATTGACCTAGTCAAA TCCTTCTCACCACACTCACCACATACATAAAATCACATGGGTAGCTACCA TGTTTGTTTATGTTTAGCCAATACATTTCACAGACCAGATTATGAAAAAC GCGGTAAAAAACGCGGCCACCTTTTATAAAACGTGGCCGCCCTTTATAAC TGACGGCCGTCCTTTATAAATAGCGGCCGCGTTTTTAAAGGGCGGCCGCC TGTTATAAAGAGTGGCCGCCTTTTTCGAAGGAAAAGGGTGGCCGCTTATT ATAAAAGGCGGCCGCCAGTATTATAGGCGGTCGCTCTTTGTAAAAGGCGG CCGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGAAATACCAGATC AGCCACGGTAAGATTCTATTGCTTACCCAAAAGATTCAGTTGGGATTCTC AAAGCTTTAGGGTCAGTGAAGAGTAGCTTTCTAATGAAAGAGGGAGATGG AATTTCAGGGTGTTTCTTAACGCCTGGGATTATTTCTTGAACTGTCCTGA ACAGTAATTTTTCCGATAGGTAAATGTAAATGGTTCTGTGACATAGGGGT GTTGAATATTTTGGAGAATTATTTGCTGAATCTAAAAATGCTTTTTGGCA TTAGCTGCTTTTCAGTCGTTTATTCATCTATCCAACGATGTAAAAATAAT AGANATTGAGCCAAGGGCGGGTATTTTAAGGTATCCTCAGAACATTTATA TCGTGTACATCCTTAAAGTTTTTCGAGATAATTCGCAGAATACGGACAAA TAAAAAAAACCGTGTGTCTGATTTTCAATCACTTCTTGTTTCTTACATTT TCCTCCGAAAATTCACAAACTATTTTCCACAAAAATTTTCTTCTTGACAT TTCAGCAAATAAAAGTTGGTACACACCTATCATTAGCGGTGATATTCCGA ATCCTCGATCGGGGTAAGTTCCTCACTCTAGATTTGACAACATCTCGTCG ATCTTTTAATAACACTCCTGTACTGGTAAGAATGGAATTGTCTTTCATAT GTGGGAATTCAGATTCTACCGTGGCTGATCTGGTATTTCGAGGTTTTTGG TTATTTTGCTTTCGGCAGCCGCCTTTTTAAGAGGCGACCGCCAGTTTTAA TCCGCGGCCGCCTTTTACAAAGAGCGGCTGCCTATAATACTGGCGGCCGC CTTTTATGATAAGCGGCCACCTTTTTCCTTCGAAGAAGGAGGCCGCCCTT TATTACGATGGCCCCTAAGGCTCACCACGCACTTCCAGTTCTTATAAAAT TTGTGAACTAGAACTGTCTAGGGTCATGGCCCAGAAGGCTCACAAGACAC TGCGCACTTCCGAGTTTTTTTGTGACGACATTGCACACTTCTAAAAATAT TTTAGAAACGTAAAAGTCCCCCTCGAAAGATAGCCGTTCTGGTCAGCAAA ATAGATACCGAGTTGTAATAAGTGAGTTGATGATAATAGCGAAGAGGCTC GGAAATCCCGAGTTATTTTCTTGAGTTCAAAAGCCGAGTTAGTTACGAAA AACCGAGTTATGACGTTATTTTTCGGAAATTTCGACGTCATTTTGTACCT TCTATATGACGTCATTCTCAATTCTGTAGCTCGTTTTTTTTCCTTGCCTT TAAAATTTCGAGTTATCTCTGATGGTATCTAAACTCAAGTAAGTCCTGCC TTTAAATTTTCGAGTCATTTCTCGTTTTTTAACTCGGTTTTGTTTCTTTT AAATTTTCGAGTTATTTTCCTTCCTGTACATTCTCGGATTCTCGAATTAT TTTCACAGCAGAAGGCTCAAAACACACACACACACACACACTTCTAGTTT TCATGCACTTAGGGTGGTCCTATGGCGGAAAATACCAGCGGCGTGGAGGC AAAAAAACAAAGTTGATATTTGCTCACTTTTTGCTTCCCAGATTTTTGCC ACTGGGGGGAATTTTGCAGACCAGGACTTAACTCAGAAATTTTAACCTGT AACTCTTGATATGAGCAACTCGGAAATTTTAACTCATTTTGCGTAACTCG ACATTCATTTTATAGACCAAAAAAAAAATTGATCGCGCGGGCCGCTCGCT TGGAAATTTCCCGCCCTGACAAAAAGTCAGAAGTGCGCAGTGTCACTTGA GCCTTCTGGGCCATTGACCATAGGCAGTTCTAGTTCACAAATTTTATAAG AACTGGAAGTGCGTAAAAACTAGAAGTGCGTGTTTTGAGCCTTCTGGGCC ATCGTACTAACGGATATAAGGTTGGTTCTTTCCGGACATCTCAGCAAACC TTTGATAGCTGGTTTGCTATGAAGCCGCTGATATCGTTGTGCCTCATTGA TACGAAACCACCTTTTTTGCACGTCAGGGCATATTCGAGCGAGAACGGAG TTCCACATTTGCAATGGGAAGGTGTACGCTGTGTAATGCCCACCCGTAAC GGATTCTGATTAGGTCAACGAAACATTGCTTGTTGAGAATGTATCCTTCG TTTTGAACAGGCAAAGTCGTGAGCCATGCTTAGGCTCTGTGTTGTCGATT GAGCTCCATCAGCTGGACTTGATTTCTTTGGAGAGTCAGGTCGTTGTGAG GTGAAGAACGATGTTGCTATTTCGTTCCCTCTTTTCATTCTTGATTTTCT TTGTAGGCAGGCGAGGATCAAGTTTATATGCATATTCTTGGCTTACGATT GTCTCGGATAGATTGGATGTGATGAGTAGTAGTAGTNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGTCAAAAAGTG TGTCAAAATCTAGCTAAAAGCATAACACGCACTGCACACAGAGCTTTTTA ATAGAGTGCTCATTTCAATAGGAAAACAATGGTTGTTCTCTTGAGAGAAG TGCCTTCTAGAGGTAGTTGGTTATCTATTATTTTTACATCGTTGATCTAT CTTTGTAGTCATTCAGCAGTGATGATTGGTTCCAAATTGTACATTTTCGG TGGCTGGGATGCGCCGACCTGTCATGATGATATCTATTGTCTCGATATAG GTAAATTACAACATTTGTATATCCTTTCAACTCGTATCATTGTTTTCCTT CGGAGACAAATTTCCATTCATTTTCACCGCCTATGGAATAACAATAGGAT CCCAAAAGAAAATCATCTCAACTGAAAAGACAACTAAAAAAACTTGTCTT TTAAACTTGTTGGCTATCGAAAAAGATCTTCAATTCATTATATGCACCAC TGCAATGACTTCACGAAATTATGCAACTTTTCTGTTTTTGTTCCACCCAA TACGTCACTTTTTCTATTCTTAAAGTGACATATTGGATGGAAAATCTTAA AAGTTCTCAGAAGACTCTTCAGTGGTGCAAATCATGAATATTTTAATAGA GTAGATATTCAATACTTTTATGCAATAAGTTCCATATTTTAATGCAAGAT CATTTTAAAGCCAAGTATTTCTTCCCAGCGACGACTTTACTAAACAACCA CTTTAGTTTGGTCAAATTTAATCGTTTTAACTTTAACTTTCTCTTCATAG TCATAATGAAGTATACGAGATTGAAACCTATTGGTGAAGGTCCGTCTGCC CGTACTTGGCATTCCACCTCTGTTCTATCAAATCCAAATCAATTTTGTAT TTATGGTGGCTTCGATGGCAACGACAGTTTGAATGATCTTTTTGTTTTCG ATTCAGGTAAACCGTGCCAAAAAAAGGCTAGGAAATTGAGCTTTTTTTTG ACAGGAACTCGTCTTTTTTTACAAGGGAAAACACGTACTCAGGACTCGGG GTTCTGAGGCTGTTTGACTTTAGTCTTCTTTACCTGACTATACCAAATTT ATTTTGTGTTATTAATTTCGCATTGCGAAAGTATTACGATAGCCTTTCGC GGCGGCGGTGTCCTCGGAAAAAAAATTAGAAAACGAAAGTGCTTGATACG GTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNTTGTTTTGTTTTGAGATTACTTCTTT TCTTCTGTTTTAGTCAAAACGTGTTGGAGCAAGATACATAACGAGCATAA TTCCATTTTACGTGCTGGTCATACATCACTGTTGATGACGTCACCATATA GTGATGATGACGTCACAAAAGCCAACAACAAAAGTCAGGTGTTAATTTTC GGAGGCGGTGATAACGCCGGACAATTTTATAACGATGTCATTCTACTGGA TGTGAAATAGCAAAAGTGTCGTTTACTATATTTCGTGTTTTTTAATATTT TTTTTTTGGTATTTTTATTTAGTATGATTCTTATGTTTATCTCTTTTAGG CGAGATTAGGTAAAGAATATTATCATTTAAGATTCTCCATATTTGTGGTA GTGTATATAGAATTAAAGGGACATAAAAGTACTGACGAAATTAGTAAACA AACCATATGTGGCGGGATACAAAATCAAAACAAATGTCACATGTCAAAAT CAAAAATCAAAANNNNNNNNNNNNNNNNNNNAAAATCAAAACAAATGTCA CATGTCAAAATCAAAAATCAAAACAAATATGGCTGATTTTGATTGTTTCA ATTGTTTTACAAGTTTGTTTTGGACACGTGATTTTAATTGTTTTCTTTAA TGACACGTGGTTTGTGCAATGTTTACATTTTACTACTTTTATGTCCCTTT AAGCAGGCAGCAATTATGTGTGATTTCAGGAGTTCTATATGTGCTTTAAC CTCCTTTCAGAGAGATGAGTTAAATACCGAAATTCATGATATTCATGACG TAATGTTTTCTACGGAAAGACCCCGGTTTTTGCCAGTAGTGGCACTTTTT TACACCTTTTGTCTAGTTTATAAGTGCCACTACTGGCTAAAACCGAGGTA TTTCCGTAGAAAACATTACGTCATGACTATCAAGAAATTAATTCGTAAAT GCATGCTCCTCCCATGCTCCTCTGATCTTACGCGAATTGTATTCACGAAT TTTGAATTGAATGAACATTACTTGCAAATTTCTTTTCATATTTTAATATA TATTAAAACTTTAAATCCGAATGTGGTTTTAGAATGATCCAAAATTACTT ATACTTTGTATGACGTCCTGTTGTTATCTATTCATTATTTAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045598XLOC_045598Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073468-exon-scaffold_92-1575043694:269658..269889TCONS_00073468-exon-scaffold_92-1575043694:269658..269889Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:268996..269384TCONS_00073468-exon-scaffold_92-1575043694:268996..269384Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:268209..268345TCONS_00073468-exon-scaffold_92-1575043694:268209..268345Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:267776..267892TCONS_00073468-exon-scaffold_92-1575043694:267776..267892Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:267246..267427TCONS_00073468-exon-scaffold_92-1575043694:267246..267427Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:266697..266835TCONS_00073468-exon-scaffold_92-1575043694:266697..266835Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:266291..266410TCONS_00073468-exon-scaffold_92-1575043694:266291..266410Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:261840..261931TCONS_00073468-exon-scaffold_92-1575043694:261840..261931Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:261184..261339TCONS_00073468-exon-scaffold_92-1575043694:261184..261339Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1575043694:259747..260826TCONS_00073468-exon-scaffold_92-1575043694:259747..260826Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:269658..269889TCONS_00073468-exon-scaffold_92-1510915933:269658..269889Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:268996..269384TCONS_00073468-exon-scaffold_92-1510915933:268996..269384Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:268209..268345TCONS_00073468-exon-scaffold_92-1510915933:268209..268345Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:267776..267892TCONS_00073468-exon-scaffold_92-1510915933:267776..267892Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:267246..267427TCONS_00073468-exon-scaffold_92-1510915933:267246..267427Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:266697..266835TCONS_00073468-exon-scaffold_92-1510915933:266697..266835Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:266291..266410TCONS_00073468-exon-scaffold_92-1510915933:266291..266410Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:261840..261931TCONS_00073468-exon-scaffold_92-1510915933:261840..261931Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:261184..261339TCONS_00073468-exon-scaffold_92-1510915933:261184..261339Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1510915933:259747..260826TCONS_00073468-exon-scaffold_92-1510915933:259747..260826Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:269658..269889TCONS_00073468-exon-scaffold_92-1491911889:269658..269889Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:268996..269384TCONS_00073468-exon-scaffold_92-1491911889:268996..269384Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:268209..268345TCONS_00073468-exon-scaffold_92-1491911889:268209..268345Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:267776..267892TCONS_00073468-exon-scaffold_92-1491911889:267776..267892Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:267246..267427TCONS_00073468-exon-scaffold_92-1491911889:267246..267427Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:266697..266835TCONS_00073468-exon-scaffold_92-1491911889:266697..266835Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:266291..266410TCONS_00073468-exon-scaffold_92-1491911889:266291..266410Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:261840..261931TCONS_00073468-exon-scaffold_92-1491911889:261840..261931Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:261184..261339TCONS_00073468-exon-scaffold_92-1491911889:261184..261339Clytia hemisphaericaexon
TCONS_00073468-exon-scaffold_92-1491911889:259747..260826TCONS_00073468-exon-scaffold_92-1491911889:259747..260826Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:259747..269889 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 3.74239e-06 4.10747e-10 1.33527 0.792852 0 1.46005 0.365314 1.13913 0.677022 0.496088 0.580779 0.163983 0 0 0 0.196584 0 0 0 0 0 0 0.203102 1.65155 0 0 0 0
Blast
BLAST of TCONS_00073468 vs. Swiss-Prot (Human)
Match: RABEK (Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.998e-17
Identity = 43/180 (23.89%), Postives = 80/180 (44.44%), Query Frame = 1
Query: 1318 HSAVMIGSKLYIFGGWDAPTCHDDIYCLDIVIMKYTRLKPIGEGPSARTWHSTSVLSNPNQFCIYGGFDGNDSLNDLFVFDSVKTCWSKIHNEHNSILRAG---HTSLLMTSPYS-------------------DDDVTK-------ANNKSQV-----LIFGGGDNAGQFYNDVILLDV 1755
            H  V  G+KL+I GG      +DD++C+DI  MK+ +L P G  P+    HS   +       I+GG     +L+ ++ + + +  W+ +  + +++L  G   H+  ++  P +                   +D   K       ++ +SQ      L+FGG +  G+ Y+D I+  V
Sbjct:  196 HVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMG--KHVYIFGGMTPAGALDTMYQYHTEEQHWTLL--KFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVV 371          

HSP 2 Score: 52.373 bits (124), Expect = 3.998e-17
Identity = 49/204 (24.02%), Postives = 82/204 (40.20%), Query Frame = 2
Query:  644 KAMMQAKPSKTPEMAKRRVIRKSGKSPAAKFSDLISHENPTGRWGHGCCKICHDKAIVIGGQTKQQMNTDSMWLLDLKTRKWELQKSDNSTIDRRVGHSVVYDEKRNLVFVYGGSKPKKWYSDVYSLNLATFEWEKSETIGKAPT-RAYH-SCNKFHDELFVFGGVYPNPDPDPDGCSNELVIYDIANKSWYTPIISGDIPNPR 1249
            K +   +P   P  A    +   G SP A+     S+  P G    G       K  ++GG    +  +D +  +DL   +W+L       + R    S +     + ++V+GG+      + +  LN  T  W   E     P+ R +H S     ++L+VFGG      P  D    +L ++D    +W  P   G+ P+PR
Sbjct:    2 KQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRG-------KVFIVGGANPNRSFSD-VHTMDLGKHQWDLDTC-KGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQD---TKLHVFDANTLTWSQPETLGNPPSPR 193          
The following BLAST results are available for this feature:
BLAST of TCONS_00073468 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RABEK3.998e-1723.89Rab9 effector protein with kelch motifs OS=Homo sa... [more]
back to top