Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073465 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073465
Unique NameTCONS_00073465
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2320

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073465 ID=TCONS_00073465|Name=TCONS_00073465|organism=Clytia hemisphaerica|type=transcript|length=2320bp
TAAGAATTGAAAACAGTCAATATCATCAtttcaaacagaaaaaaaacatt
caatatcGTTTCCCGGTCCATGTGGAAAACGCGTGGGACTGATTATgaag
atggtggatatagcgTTTCTGAAACATTCAGATAAATTTGTTCCTATGGT
ATGTCCTTAATGTATCCTTTAGAAAAGTAGAGGCACGAGTATAAATAATg
gaatccaagctcaaaaataaattatcttTCTTATTGGGGAACACAAGAAG
AAACCATGAAGACGATATTTGGATTGACCATTCTCTTGACAGTGTGGTGT
TATATGGTCAATTGTGACAGTTCTCCTGCGTTTATTAAAGACCCGAACGT
TGATTTCTGTGGAACTGATGTCAATACTTGTGATGGAAAAACACCAGGCA
TACATGTCACCATGAGTTATATAGCAGTTGAATGTAGTGCAGGCTTCACA
CTGGAAAAATGTTATTATTGCGACTTCGACTACAAGATGGAAGGGAATCC
TAAATTAGGGTATGTTCCAAAGTGTTTGGCATTTTTTGAAGCACCTAGTC
TCAATGCCGGAGaagatttttgtaagaataaATATTGCGAGGGGAAATCG
GCAGGAGAATTCATTGTATCGgggaaagaagaagaagaagattctGAGTT
TCTGGTGAAGTGTACTGGCAATTGTGTTACTGAGCGCTGTTATTATTGCT
CCCTTGACGGATTCAAAGTTAACAAGAGCAAGGACGGACAACCCCCTGAA
TGTGTTTATGAACTTTAAGAAAATACCTTTGAAGTAAATTTAACGATATT
TattgttaaaatctttttaatcatgagatatttgtttttcttaactAAGA
ATTTGTTTGTAATTACAAGTTTGAATCTAAAATCAAGCCATATCAATCCC
CCTAATATTTCGAAGATATCTTTTCAAATTATTCTTTGATTAATTTATTc
taaatttctaattttctaaaaCTTCATTAGAATAATATTTTCATACAATT
CTCCATGTTTATTTTCTAACTTGACCACAAATTTCGAAATTAAAAGTTAC
AGTGCTCTAGAAATATGTCCAAGTTGGATAATATTTCATAATCAAATAAT
ATTACAATTTTCTCTATAAAATTACACCACaatacaaaatattttggtgT
AATTCGTCCAATACCGGTtgcaccaaaaaaaaagtagacaggtttgtcga
gacattgtgagcttcaggatttaaattttttgttcattctttttttattg
tatagaggatgctctaacttgaattttgagctatcatacattaagtttga
aaaagtatttcgaaagttatttccaaaaaactgactttttttccatgtcg
aaatttaaaaaaatcattaaaagtagcaatcacgctataaataagacaaa
atgacaaaaacacaatttcattgttttttttattcctttttctcttatct
tatattttgccaacagtttatCCTTCTTATTTGCAtgtcatgaacatttc
caacaccagcaaactcaatgcagacccaagttctttgagcaactagtcga
ggaatggtgatctattttttcaaaagttttctcacatagcacacacataa
catcaaaacctctcttggagattaccaaaaaaaaattttcagccttTCCA
AAAGTATTATCCCAagtgggaatagcttgttttaccatattcttaaattc
cgtaacgagttttgatgaGCACAGTtgtattttttggtatttttatgtgt
aaaggaGGTAAGTgtaaagagaaaagtttgctcgctgtttttaatgattt
tttgaaatttcgacatggaaaaaaagtcagctttttggaaataactttcg
aactactttttcaaatttaatgtatgtaCGATGGCTCAAagttcaagtta
gagcatcctctatacaataaagaggaatgaacaaaaaaaatttaaatcct
gaagctcacagtatctcgacaaagttgtatacttttttttggtgcacccg
gtataatgTTGAGTAATTAAGAGCCTAGAAAGGTCTCACCCTCACACAAA
ACTTAGATTCGCTCTTTTCggtattgaaatatttttttcaatcgtTCATT
TGATGAACATGGAACTCATTAATGACTCATTGACTCATTTGACGGAGAAT
ATTGAACGAAGCatgcaaaaacatcaaaaactttaaaatagaaaaacaaa
aaaattctaaacaaTGTAAAggttatttttaaaagaaaatttccgTCGCA
TTCGCAGGGTTTATGGTTTCACATCTTTGTTCAAAAACAGGAAAGCTATA
GTGACTAATTAATTAGCAAT
Run BLAST on NCBI

protein sequence of TCONS_00073465-protein

>TCONS_00073465-protein ID=TCONS_00073465-protein|Name=TCONS_00073465-protein|organism=Clytia hemisphaerica|type=polypeptide|length=170bp
MKTIFGLTILLTVWCYMVNCDSSPAFIKDPNVDFCGTDVNTCDGKTPGIH
VTMSYIAVECSAGFTLEKCYYCDFDYKMEGNPKLGYVPKCLAFFEAPSLN
AGEDFCKNKYCEGKSAGEFIVSGKEEEEDSEFLVKCTGNCVTERCYYCSL
DGFKVNKSKDGQPPECVYEL
Run BLAST on NCBI

transcript from alignment at scaffold_92:242684..246144-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073465 ID=TCONS_00073465|Name=TCONS_00073465|organism=Clytia hemisphaerica|type=transcript|length=3461bp|location=Sequence derived from alignment at scaffold_92:242684..246144- (Clytia hemisphaerica)
TAAGAATTGAAAACAGTCAATATCATCATTTCAAACAGAAAAAAAACATT CAATATCGTTTCCCGGTCCATGTGGAAAACGCGTGGGACTGATTATGAAG ATGGTGGATATAGCGTTTCTGAAACATTCAGATAAATTTGTTCCTATGGT ATGTCCTTAATGTATCCTTTAGAAAAGTAGAGGCACGAGTATAAATAATG GAATCCAAGCTCAAAAATAAATTATCTTTCTTATTGGGGAACACAAGAAG AAACCATGAAGACGATATTTGGATTGACCATTCTCTTGACAGGTAAGATA TCATTTTGAAAAGAGAAAAGATCTTAGAGAGGGCTAACGTTTAATGCTTC TTCTTAACATTACTTTAATACACCCCTGTGTCACAGACCCGCTGGGGCTC CAGCCTCACTAGAAAATTTGGCAAAATTGTTGTCCTTGTTGGGATAAACT TTTCTTCATCACTGGGAAAATTGGCTTTGATTTTATCCCCATTCTAAATT TTATATAAAAAAAATGCATTCCAAACCCCTTTCCGTTGGATCTATTAACC TCGGAACCATATCCCCATTCGGTTTACAATATAAATTCTTATCCCCGCTG TGGGGAAAAAGTTTCACCGGGGCTGTGAGAATGGGGTGTTTTAATCTGAT TAAACTTTTTAGAATTCGCACACTTTTTCAGATTTATTTCCAAGAAACAT TTAATGCAAAAGATGCATAACGCACCCCTTTCGAAAAATTGGTGAAAACA TTTTCTAATGGTAGTAGGACCATTTAAGAAAGACTGCCTAAGGGTTACTT TTTAACCACCGGGGACAAAATTTTAGCAAAATTTTATGGTGAGGCTGGAG CCCCAGCGGGTCTCACAGGGCGGTGTATTAAAGTAATGTTGGTCCCTTTT CTGAGGAATAGAGCATTATCCTTCATCCACGAGCCCTAGCACAATCAGGC TTTACAACGCACGTTTTATCCACCTGAATAAAAACAACAGCACCACCCCT GGATTGATAATTCATACATCGATTATGTACCTACCTTTTCTTCACACATA GTGTGGTGTTATATGGTCAATTGTGACATTTCACCTGTTCACCAAAAATT AATTATGAACTAAAATCATTCCCCTGGAAATTTAAGAATAGCTTTTTACC CTCTTGGAAAAATGAAAAGACAGCCCCTGGAAATCTTTCTCGGATTTACC GTCCACCCCCCTGTATGGATATAAAATGGAATGGCCCATTTAAGAAATAC TACCTAAGGGTTTCTTTTTAAAGGTCCTTCTTCTAACGAATAGAGCATTA TCCTTCATCCACGAACCCTAGCACAATCAAGCTTTACAGCGCACGTTTTA TCCACCTGAATGAAAACAACAGCACCACCCCTGAATTGATAATTTATATA TCGATTATGTACCTACCTTTTCTTCACACATAGTGTGGTGTTATATGGTC AATTGTGACAGTTCTCCTGCGTTTATTAAAGACCCGAACGTTGATTTCTG TGGAACTGATGTCAATACTTGTGATGGAAAAACACCAGGCATACATGTCA CCATGAGTTATATAGCAGTTGAATGTAGTGCAGGCTTCACACTGGAAAAA TGTTATTATTGCGACTTCGACTACAAGATGGAAGGGAATCCTAAATTAGG GTATGTTCCAAAGTGTTTGGCATTTTTTGAAGCACCTAGTCTCAATGCCG GAGAAGATTTTTGTAAGAATAAATATTGCGAGGGGAAATCGGCAGGAGAA TTCATTGTATCGGGGAAAGAAGAAGAAGAAGATTCTGAGTTTCTGGTGAA GTGTACTGGCAATTGTGTTACTGAGCGCTGTTATTATTGCTCCCTTGACG GATTCAAAGTTAACAAGAGCAAGGACGGACAACCCCCTGAATGTGTTTAT GAACTTTAAGAAAATACCTTTGAAGTAAATTTAACGATATTTATTGTTAA AATCTTTTTAATCATGAGATATTTGTTTTTCTTAACTAAGAATTTGTTTG TAATTACAAGTTTGAATCTAAAATCAAGCCATATCAATCCCCCTAATATT TCGAAGATATCTTTTCAAATTATTCTTTGATTAATTTATTCTAAATTTCT AATTTTCTAAAACTTCATTAGAATAATATTTTCATACAATTCTCCATGTT TATTTTCTAACTTGACCACAAATTTCGAAATTAAAAGTTACAGTGCTCTA GAAATATGTCCAAGTTGGATAATATTTCATAATCAAATAATATTACAATT TTCTCTATAAAATTACACCACAATACAAAATATTTTGGTGTAATTCGTCC AATACCGGTTGCACCAAAAAAAAAGTAGACAGGTTTGTCGAGACATTGTG AGCTTCAGGATTTAAATTTTTTGTTCATTCTTTTTTTATTGTATAGAGGA TGCTCTAACTTGAATTTTGAGCTATCATACATTAAGTTTGAAAAAGTATT TCGAAAGTTATTTCCAAAAAACTGACTTTTTTTCCATGTCGAAATTTAAA AAAATCATTAAAAGTAGCAATCACGCTATAAATAAGACAAAATGACAAAA ACACAATTTCATTGTTTTTTTTATTCCTTTTTCTCTTATCTTATATTTTG CCAACAGTTTATCCTTCTTATTTGCATGTCATGAACATTTCCAACACCAG CAAACTCAATGCAGACCCAAGTTCTTTGAGCAACTAGTCGAGGAATGGTG ATCTATTTTTTCAAAAGTTTTCTCACATAGCACACACATAACATCAAAAC CTCTCTTGGAGATTACCAAAAAAAAATTTTCAGCCTTTCCAAAAGTATTA TCCCAAGTGGGAATAGCTTGTTTTACCATATTCTTAAATTCCGTAACGAG TTTTGATGAGCACAGTTGTATTTTTTGGTATTTTTATGTGTAAAGGAGGT AAGTGTAAAGAGAAAAGTTTGCTCGCTGTTTTTAATGATTTTTTGAAATT TCGACATGGAAAAAAAGTCAGCTTTTTGGAAATAACTTTCGAACTACTTT TTCAAATTTAATGTATGTACGATGGCTCAAAGTTCAAGTTAGAGCATCCT CTATACAATAAAGAGGAATGAACAAAAAAAATTTAAATCCTGAAGCTCAC AGTATCTCGACAAAGTTGTATACTTTTTTTTGGTGCACCCGGTATAATGT TGAGTAATTAAGAGCCTAGAAAGGTCTCACCCTCACACAAAACTTAGATT CGCTCTTTTCGGTATTGAAATATTTTTTTCAATCGTTCATTTGATGAACA TGGAACTCATTAATGACTCATTGACTCATTTGACGGAGAATATTGAACGA AGCATGCAAAAACATCAAAAACTTTAAAATAGAAAAACAAAAAAATTCTA AACAATGTAAAGGTTATTTTTAAAAGAAAATTTCCGTCGCATTCGCAGGG TTTATGGTTTCACATCTTTGTTCAAAAACAGGAAAGCTATAGTGACTAAT TAATTAGCAAT

Coding sequence (CDS) from alignment at scaffold_92:242684..246144-

>TCONS_00073465 ID=TCONS_00073465|Name=TCONS_00073465|organism=Clytia hemisphaerica|type=CDS|length=1539bp|location=Sequence derived from alignment at scaffold_92:242684..246144- (Clytia hemisphaerica)
AGTTCTCCTGCGTTTATTAAAGACCCGAACGTTGATTTCTGTGGAACTGA
TGTCAATACTTGTGATGGAAAAACACCAGGCATACATGTCACCATGAGTT
ATATAGCAGTTGAATGTAGTGCAGGCTTCACACTGGAAAAATGTTATTAT
TGCGACTTCGACTACAAGATGGAAGGGAATCCTAAATTAGGGTATGTTCC
AAAGTGTTTGGCATTTTTTGAAGCACCTAGTCTCAATGCCGGAGAAGATT
TTTGTAAGAATAAATATTGCGAGGGGAAATCGGCAGGAGAATTCATTGTA
TCGGGGAAAGAAGAAGAAGAAGATTCTGAGTTTCTGGTGAAGTGTACTGG
CAATTGTGTTACTGAGCGCTGTTATTATTGCTCCCTTGACGGATTCAAAG
TTAACAAGAGCAAGGACGGACAACCCCCTGAATGTGTTTATGAACTTTAA
TGTGGTGTTATATGGTCAATTGTGACATGAAGACGATATTTGGATTGACC
ATTCTCTTGACAGAGTTCTCCTGCGTTTATTAAAGACCCGAACGTTGATT
TCTGTGGAACTGATGTCAATACTTGTGATGGAAAAACACCAGGCATACAT
GTCACCATGAGTTATATAGCAGTTGAATGTAGTGCAGGCTTCACACTGGA
AAAATGTTATTATTGCGACTTCGACTACAAGATGGAAGGGAATCCTAAAT
TAGGGTATGTTCCAAAGTGTTTGGCATTTTTTGAAGCACCTAGTCTCAAT
GCCGGAGAAGATTTTTGTAAGAATAAATATTGCGAGGGGAAATCGGCAGG
AGAATTCATTGTATCGGGGAAAGAAGAAGAAGAAGATTCTGAGTTTCTGG
TGAAGTGTACTGGCAATTGTGTTACTGAGCGCTGTTATTATTGCTCCCTT
GACGGATTCAAAGTTAACAAGAGCAAGGACGGACAACCCCCTGAATGTGT
TTATGAACTTTAATGTGGTGTTATATGGTCAATTGTGACATGAAGACGAT
ATTTGGATTGACCATTCTCTTGACAGAGTTCTCCTGCGTTTATTAAAGAC
CCGAACGTTGATTTCTGTGGAACTGATGTCAATACTTGTGATGGAAAAAC
ACCAGGCATACATGTCACCATGAGTTATATAGCAGTTGAATGTAGTGCAG
GCTTCACACTGGAAAAATGTTATTATTGCGACTTCGACTACAAGATGGAA
GGGAATCCTAAATTAGGGTATGTTCCAAAGTGTTTGGCATTTTTTGAAGC
ACCTAGTCTCAATGCCGGAGAAGATTTTTGTAAGAATAAATATTGCGAGG
GGAAATCGGCAGGAGAATTCATTGTATCGGGGAAAGAAGAAGAAGAAGAT
TCTGAGTTTCTGGTGAAGTGTACTGGCAATTGTGTTACTGAGCGCTGTTA
TTATTGCTCCCTTGACGGATTCAAAGTTAACAAGAGCAAGGACGGACAAC
CCCCTGAATGTGTTTATGAACTTTAATGTGGTGTTATATGGTCAATTGTG
ACATGAAGACGATATTTGGATTGACCATTCTCTTGACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045596XLOC_045596Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073465-proteinTCONS_00073465-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073465-exon-scaffold_92-1575043694:245853..246144TCONS_00073465-exon-scaffold_92-1575043694:245853..246144Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1575043694:245068..245093TCONS_00073465-exon-scaffold_92-1575043694:245068..245093Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1575043694:242684..244685TCONS_00073465-exon-scaffold_92-1575043694:242684..244685Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1510915933:245853..246144TCONS_00073465-exon-scaffold_92-1510915933:245853..246144Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1510915933:245068..245093TCONS_00073465-exon-scaffold_92-1510915933:245068..245093Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1510915933:242684..244685TCONS_00073465-exon-scaffold_92-1510915933:242684..244685Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1491911889:245853..246144TCONS_00073465-exon-scaffold_92-1491911889:245853..246144Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1491911889:245068..245093TCONS_00073465-exon-scaffold_92-1491911889:245068..245093Clytia hemisphaericaexon
TCONS_00073465-exon-scaffold_92-1491911889:242684..244685TCONS_00073465-exon-scaffold_92-1491911889:242684..244685Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:242684..246144 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.5092 1.864 1.22585 1.20819 0.0246632 0.0389095 0 0 0 0 0.0123937 0 0.0163208 0 35.4966 2.92722 0 0 0 0 0 0.0181385 2.20567 1.8014 0 0 0.179939 0.264916 1.1046 1.5985
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073465 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top