Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073455 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073455
Unique NameTCONS_00073455
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length802

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073455 ID=TCONS_00073455|Name=TCONS_00073455|organism=Clytia hemisphaerica|type=transcript|length=802bp
ATTTCACAAATAAAAGATATAAGTTACTGCGAATTCCAATATAATCGAAT
ATTTTTGcatgatttttgaagaaaaagtagtttttgtaagaaaattttag
aatttttgcctGTTCGGTAAATTCCGATATTATATGTTGCGCTCACATGG
CGTAACATTTTCGAATAAGAGACATGGTTCTGTTACCCAGGCTCCTTTCA
GTCAAATAGTCAAGCGATAGCACAGAAGCAGCAATATGCCTctGTTCAAA
GACTTGCTAAACCCATCCCTTGAGGAAGAACGAAGAAAACACAAGTTTTC
AAGGCTAGTGCCCTCTCCCAACTCATATTTTATGGATGTTAAGTGTCCAG
gaTGTTATAAAATCACCACCGTTTTCAGTCACGCACAAACTGTAGTCTTA
TGTGTCAGCTGCTCAACTGTTTTATGTCAACCAACTGGTGGAAGAGCCAG
ATTAACAGAAGGGTGTTCATTCAGGAAGAAGCCACAATAAATTCGATCAA
TGAAATGAGGGGATGTCAAGCGTAAACCGTTTGCCAACTTATCACCTGAA
GGATTATATACACCTACTGATGGATATCACTCGAAATATAtcatttaaaa
taatattttgtacATTGTAAAATTCAATCCTTAATGAGTTGGGAAAAGAT
TTGTGCTTGAGattacttttcaaaatatttcgtttcaattcttttaaaag
TTCTGAAAATGCATGTAGTTAACCATCGTCAGATCACAAGCAAAATCATT
GAATCAGATGCATCTGGAAACTTTCTTCACTATTTTGACTGCACAGAATC
AC
Run BLAST on NCBI

transcript from alignment at scaffold_92:12021..20823-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073455 ID=TCONS_00073455|Name=TCONS_00073455|organism=Clytia hemisphaerica|type=transcript|length=8803bp|location=Sequence derived from alignment at scaffold_92:12021..20823- (Clytia hemisphaerica)
ATTTCACAAATAAAAGATATAAGTTACTGCGAATTCCAATATAATCGAAT ATTTTTGCATGATTTTTGAAGAAAAAGTAGTTTTTGTAAGAAAATTTTAG AATTTTTGCCTGTTCGGTAAATTCCGATATTATATGTTGCGCTCACATGG CGTAACATTTTCGAATAAGAGACATGGTTCTGTTACCCAGGCTCCTTTCA GTCAAATAGTCAAGCGATAGCACAGAAGCAGCAATATGCCTGTATGTAAT TTATTTGGTATTTTGGTTGTTATTGTTTTATTCTGGATTATTTTTGGAAT ATTTTGGAGTTTGATGTTGGTATCATGTGTTGAGTTTGTTATTTCTTTCT TTTTAGCTGTTCAAAGACTTGCTAAACCCATCCCTTGAGGAAGAACGAAG AAAACACAAGTTTTCAAGGCTAGTGCCCTCTCCCAACTCATATTTTATGG ATGTTAAGTGTCCAGGTAATAAAACTTTACAACATTAAATCACATTTAAA AGTAATGGAGTTAAGACCTACTGAACTTGTTACATAAAATATCTTTGATT TGCTGAGTTAGCACTTTTCTCTGCTGACTTACAAATTCAGTATTCAAACT AGCCACTTAAATCACTCACTCATTATTTGATTCTGGTACAATTGAATAAT GAAATAGAGGAAGGCTAGTAATTTTTACATCATCATTAGCCTCATTTGGG TGTGCGACGAATGTACGATAAGTATAAGACAATCCAACCTAATTAACCAT TTGTGGATAAAGGACCTTGATGCTTTCCTTAGTGCTGTGGAAAGAATGGC AGAATTCAATCTAACATTCTATGTCTGGTGGTAAAATTTGCAATTTATTA ATTATGTTGGCGCGTGCGCCTCTTTTCCCATCTTGCACCCTTATTGAAAA ATTGAATGTTGGTACAAAAGAAATTTTGCTTGGCGCGAGGCTTGCTGCAC GGAAAAATATCTTCGGCGCGAGATTTCGTGGAATCCATACTGGACAGTAT GTATTGTTTGGTTGTGTATAATATTCTCAACTTCAGTTGAGCTACAATCT GACAATGTCTGTGTGTGTGTGTGTGTGTGTCTGTCTGTCTGTCACAAAAA CTTTAGGGCAGCCTGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGTCAG AGCCTTTGACGCTAAGAAATTTCAACAGAATATTGATTTTCAAACCTGTA ACATTTTGTATTCCGTCCTTCGCTACACCTGCCATCTTATAATTCAAATG CATAAAATATAACAGAGATGATATCCAATACTCTTCCGTTACGTTTGTAG GAAAATGTTATTATCTCCCTAACCATAAAAACAGAGATACCGCAATAAAA AATAGATGGGCCGTATTTTGATATACAAGGGCCGCGCTGATGGACCGTCT ACATAAATATGACAAAATAAGGACCCGTTTGTCTGGGGACAAACAAATGT GAAAGTCATAAGTCAAAACCACTGTTTTAAAACCAAGCGAAACGAAGCAC AAAAATTAATGTGGCTGGAATATCAATATCTGTAATAATATAGAAGAAAA ATTACTTTCATCGATTTTTGCTATAATTAATGTAAATGACGCTAAGAAAG AGGGGTGGGGGGTTCTTCAGATAGTGTCACAATGACGTTAGTTGCAGGAA AAATCAATATGCGAGTGACCCCTAACTGTTATTTGGCAAAGTTTTAAGTC AATTTTGTAGGGTATTTTAGTTTGAAAACCAGACCCCCGCGCTCGATAGG ATCGGTCATCAGAACGGCTCGATGACTGATCGATAGATTACTTAGCGATC CGGATAGGAGATCGATAGAGGATCGATACTCAAGATTTTTTAAGCTTATG ATTAGTTATCGATCTATCATCGATCTTTTATCGATATTATCGACCCTATC GACTCTTTCTAAAAATTGTGCTTTAATATTAATTGATCTTTCTTTCTATC GATTACCTATCGATTTACGATCGATAAAAAATCAATTAACGATCAATGAT GAATCGATATACTCGATTGAAATACTAGCTCGATAATGGATCAACAAAGG ATCGATACTCAAGATTTTTTAATGGCTGAATCTTCCATCGATCTCCTATC TGGATCGTTAAGTTAAGTAATCCATCCATCACATATCGAGCCGTTCCGAT GATCGATCTTATCGAGCGCGGGGGTCTGGTAAAAAGTACAACTGTTCCCC CTTCCCATCCAGAGCCCTATAGCAAACTCTAATTTCACACATATTTTTCA AAATTTGTACATTCACACATATTTTCATGCTCACGCAAACCTGTGTCACA CAAAATTGGTAAACTTTTTGGGAAAATCAGATAAGTTGGATGTGATAAGA CAGTCACAAGCAGATTTGTTTGCGATCAGGCGTCTGTATAACTGTATTAA AAACTTGTTGAATGGAGGTTACACACCTTGCCTGACTCTCTGGTTACCAA AGCACAAGACTTAATATATTCATCCATTTTCAGGATTATTTAAAATGCTG TAAAATGTATGAAATTGTGATGAGAAGATTAAAATTGCCTTACAGGATAA CTCAAACTTGATTTATTTTTTTTACAGGATGTTATAAAATCACCACCGTT TTCAGTCACGCACAAACTGTAGTCTTATGTGTCAGCTGCTCAACTGTTTT ATGTCAACCAACTGGTGGAAGAGCCAGATTAACAGAAGGTATTAAATAAC TTTATTAAAAAAAAAAGGGTTATTCAAAACAAAGGGGTAACCCATTTTTT TAACCTTGCTTTCCCAATGTAGACTTTATACGTATAGAAAGAAAAAATTT TAACTAGAGATTTGTCAAAGTCAGATTGACAGTCATGGAAGGTCTGAATC ACTTTACCAATCTTGCAAAAAAGAGTGAGCAAGAATAGAAAAAAATTTTC TAAACATTTTTCATTTCTTTTGGGATATCAGCACAACTTTGAGGTTAAGA AGCTGTATAATAGTAATAAAAAACAAATATATTTTAAAAATATCTTTAAT ACTGCTTCTTTTGGTGATTTTGGTCAAGCTGTCACTTTTTATGGGTTGCA GGAAACCCAAACAATCATAAGATGACTGCATTGAATCTGCAAGAAATATT TCTATTGAACTAATCTTAAGGACTGTCTTTACACTTGATGCAGCTTGATG TATGGTGTTTGTTTTTTCGATTTAACTTTTTTTCCTGAAATTTTTTCATG ATAAAGGTATATATTTCTGAAAGCCAATAAAATTATCTATCAAATGTAAT CAATTAGGATTATTATGCACAAAGTGAGTAGAAATTACAATGCTTTGAAA AATATAACGTTTGTTAACTTCAAAGAGTTCAACTTGCCCAACCACTTACT TTTTGGACCTACCCTAAGGTAGTCCTTTAAATTAACCCTTGTCCGTCCGT CCGTTCGTCTGTTGCCAGCTTTTCTCGGGATCGGCTCATCATTAGTTTTT TCTAATTTTTTGCACAATGATGCAAAATGGCAATACCCAAAATGTGACGG AGCCCGATTTTCGAAAAAAAATTATTTCCGGCCGAAAATGCCGGAAATAT GCCGGAAAACCCGTTTTTTTGGCATTTTCTCAAGATTTCATCATTANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTGTGCTAACAGA CCTCACATATAAATGAATTTGTGTTGCAATTTTGATTACTTTTAATCCTG AAGAGCTTTCCTAGGAAAGAAACAAATTTAAGGTAGCTTCAATAAGAATA TTTTTTGACTGTCCACGTGAGCAACTTGCAACAGTCTTAGTTTCGTATGA TTACCTGGCGTTAAAACTATAAATTTGACTAGGCTTAATAAGATTTTCAT TATTTTTCAATCAGGGTTAATTTTTATAATTTCATTATTAATTTTTCACC GGACTGGCGGCTACTTGCCCTGCCATATTTCTCACCAAATTTGTTTTCTT TTTTTTTACTAGGGTGTTCATTCAGGAAGAAGCCACAATAAATTCGATCA ATGAAATGAGGGGATGTCAAGCGTAAACCGTTTGCCAACTTATCACCTGA AGGATTATATACACCTACTGATGGATATCACTCGAAATATATCATTTAAA ATAATATTTTGTACATTGTAAAATTCAATCCTTAATGAGTTGGGAAAAGA TTTGTGCTTGAGATTACTTTTCAAAATATTTCGTTTCAATTCTTTTAAAA GTTCTGAAAATGCATGTAGTTAACCATCGTCAGATCACAAGCAAAATCAT TGAATCAGATGCATCTGGAAACTTTCTTCACTATTTTGACTGCACAGAAT CAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045590XLOC_045590Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073455-exon-scaffold_92-1575043694:20583..20823TCONS_00073455-exon-scaffold_92-1575043694:20583..20823Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1575043694:20359..20467TCONS_00073455-exon-scaffold_92-1575043694:20359..20467Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1575043694:15736..15846TCONS_00073455-exon-scaffold_92-1575043694:15736..15846Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1575043694:12021..12361TCONS_00073455-exon-scaffold_92-1575043694:12021..12361Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1510915933:20583..20823TCONS_00073455-exon-scaffold_92-1510915933:20583..20823Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1510915933:20359..20467TCONS_00073455-exon-scaffold_92-1510915933:20359..20467Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1510915933:15736..15846TCONS_00073455-exon-scaffold_92-1510915933:15736..15846Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1510915933:12021..12361TCONS_00073455-exon-scaffold_92-1510915933:12021..12361Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1491911889:20583..20823TCONS_00073455-exon-scaffold_92-1491911889:20583..20823Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1491911889:20359..20467TCONS_00073455-exon-scaffold_92-1491911889:20359..20467Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1491911889:15736..15846TCONS_00073455-exon-scaffold_92-1491911889:15736..15846Clytia hemisphaericaexon
TCONS_00073455-exon-scaffold_92-1491911889:12021..12361TCONS_00073455-exon-scaffold_92-1491911889:12021..12361Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:12021..20823 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1176.03 1223.59 1303.79 1429.9 983.257 821.803 1276.14 1372.21 2437.19 2000.14 2670.26 3136.54 3044.93 3230.41 2949.83 2791.35 3148.85 3218.86 1832.89 1951.6 3073.81 2963.55 2005.37 1947.96 1798.49 1783.06 2985.19 3066.1 1738.52 1784.4
Blast
BLAST of TCONS_00073455 vs. Swiss-Prot (Human)
Match: RS27L (40S ribosomal protein S27-like OS=Homo sapiens GN=RPS27L PE=1 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 2.342e-27
Identity = 71/82 (86.59%), Postives = 77/82 (93.90%), Query Frame = 2
Query:  236 MPLFKDLLNPSLEEERRKHKFSRLVPSPNSYFMDVKCPGCYKITTVFSHAXXXXXXXXXXXXXXXPTGGRARLTEGCSFRKK 481
            MPL +DLL+PSLEEE++KHK  RLV SPNSYFMDVKCPGCYKITTVFSHAQTVVLCV CSTVLCQPTGG+ARLTEGCSFR+K
Sbjct:    1 MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRK 82          
The following BLAST results are available for this feature:
BLAST of TCONS_00073455 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RS27L2.342e-2786.5940S ribosomal protein S27-like OS=Homo sapiens GN=... [more]
back to top