Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073448 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073448
Unique NameTCONS_00073448
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2908

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073448 ID=TCONS_00073448|Name=TCONS_00073448|organism=Clytia hemisphaerica|type=transcript|length=2908bp
tttagaaatctttttatagtagaaaaatcaacaaaaaaaatctcAGGACA
ACAATTATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGA
TGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGAT
TGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGA
ACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAATGATGA
TGGAAGTGAGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGATT
CTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTA
ACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTT
GTACAAGGAACAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAACT
CCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAA
TGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACTAT
CAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATT
TTCAGAATCAAGAACGACAAGTGTACGATACGATTGCAAGTGATTTTGAA
GACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTACTC
TGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGA
AGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCT
GCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAAATGGATAT
CCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAA
GAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATTACAGCC
CGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAAGG
TGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCACCA
TTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTG
AAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATGTAATCAG
TCGCGGTCTACCCACGGTCGATGAAATTATCTGAGAAGTACGTCTACGCC
TGGATATCCGCCTTCTCACCGCCTTTGTTTAAAATGGTATGATATGCATA
ttctttattatttattttttaatgtacttattttttagatatatttcatt
ttcaacaaTGTAGGATTTTTATGATTATGATTTATTAGAGACCTTATCAA
TGTAAATATTTAGCCTCACTctgacatttttattttaaaagatgCGAATA
CCCGGGGAATCGGAGTTTTTTACCTTTACATAGCGCACGACTATCctttt
tgattgatttcattTGTGCATGAGAAAAAACCATACTTTATTTGTAAGTT
TTGTAAGTATCGATGCAACTTTCGGGCGCTTGAAAATAATAATACAGTCA
AATttgaattcttattttttttctattgaaaaaatatgaaaaataatatt
aacagaagaaacaaaaattatttggttcaattttgTGAATGAGAAGAAGT
GCTCTTCCAATCAGTTAAATGAAAAATGTCGAACACTTTTTTGCTCGCTT
TGCCAAAGCGTTTTAAGGAGCCCCTTTGATTTGAAGGataatctgagcct
cagatctAAGCAATTACTATCCGGTAACTAATTATATatcgttgaaaaga
tagtaCAGAGCACTACATCCTttgacaaaaatactttaaaagtatttaaa
aaaaggaatattTGAGGCTAAAATGTTTTCTTACTACAACCTCAGATTGA
TGACATTGTAGAAATCACAGAGTCGTAgagacatttttgtgaaagcttAT
TGGGCTTTACTGAGGTATAGCTGGCAATTTACAGGTTAAAACGTCCTTAA
AATgtcattcttaggttcagttgttATATTCCgtgatggtgatattttta
gcattctcttaattttttggccaatttcatcatgaatatttttataaagt
atatcATTCTAAAATTAGCGTGTAATGGTACAGAGTTTACAACTGGAAAA
GAATACGTAAAGAAAAGTGCCAAAGTAAAGAGTTCTCGGGATGTACCGGC
TGGCAAATTTTTCGCAACCTGAGAAAtctttttcttagatagtgatttgc
aCTCCACTGTACCTTAGTCTAGGTCAAATGTCGATTTCCAGACGAGAGAG
GCTTTTCGGCTCACACAACTTTCTCATGTTTCAAAGCTGTTGTTGATTta
ataatatatttttaggaACATTTTGTCAGCTAAGGCACTTATTCACAAGT
GGCTGCTTCACAGACAAATTTTGAAGTGGTTTTTTTTTACAACTAAGAAA
CTTTTATGTTTGATTTGCCGGCTTTTGGTGATGTATTTTTCTAGTAATAG
CTTTTACGTCTCATGTGATATTTTCTCAGCTCTAGATAAGTTTGCCCGAT
TACCTTTTCCTCCGAGAAAGAAATTTCACACTATTTGGCTATCTTTCCAA
AAGTACGCTCTACATTCAAATGataaaatttctgataaaaatacaaatta
aagtatgtctcaatataatttgcagcggagacaaaaaaggttataacttt
tgatagaattcaaatTATATAGCGGtcttgtgctcgttaaaaagataatc
cggagtggaatattttaatattattaaaaaagaaaaaaaacgaagaagaa
gaaaatcaatttcttgtagaataatgccgtgatcttcatttttatatcag
aaattctttaatcttagaACGTTATAaatgcgagaaaaaaaatcaaaaaa
tattcatt
Run BLAST on NCBI

protein sequence of TCONS_00073448-protein

>TCONS_00073448-protein ID=TCONS_00073448-protein|Name=TCONS_00073448-protein|organism=Clytia hemisphaerica|type=polypeptide|length=375bp
MIDEDSNLTEPEKDDAGSCDEGGNTIEISARLISNKNQDSEKEDENEGTA
KDEDEHEEGSDDNDDGSEDDDDDDEDEDSEDSDSLGEEEAETRKTQYVTD
MSDLEKQFSDLKEQLYKEQISQIESQLKEVNSSEAKEYTGPLKQIEQECI
IRTEVAWQLKHYRTINLENKLQCELQAAEQHFQNQERQVYDTIASDFEDK
LKKVEEERHTSEMYSGNTQDLWCEDTFRSRKKRNKGMEIHVPEKRKKPAT
VTGPYVIYMLNEMDILEDWAAIRKAKSELARRKALELSSQDRDPLITARY
EDGKFFYENEWFQKGDSVVLDNRIDSPVQVTIAGINTGEVWVSKTDGVKC
KLYIAQFQKGKYVISRGLPTVDEII
Run BLAST on NCBI

transcript from alignment at scaffold_92:188217..220131+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073448 ID=TCONS_00073448|Name=TCONS_00073448|organism=Clytia hemisphaerica|type=transcript|length=31915bp|location=Sequence derived from alignment at scaffold_92:188217..220131+ (Clytia hemisphaerica)
tttagaaatctttttatagtagaaaaatcaacaaaaaaaatctcAGGACA ACAATTATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGA TGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGAT TGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGT AGGTGAAAGAATGTTgtatcttattaagagtacaacatcaagataaaaaa gaaaaagcattTCAACAAGCAGAGAGAAGACATAaaacttcaataatttt gtaattttctattGCTCCGTTTGGagatgaaagaatatttttaaaaaatg catCAGAAACTGGGGCTTGAAAAATGTCAGATGAGCAGTTTTTATATATA CAATATGTTATCTAGACACTTTTTTCAACTTTAGGAACAGCAAAAGATGA AGATGAACATGAAGAAGGCTCAGANTTTTTTCAACTTTAGGAACAGCAAA AGATGAACATGAACATGAAGAAGGCTCAGATGATAATGATGATGGAAGTG AGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGATTCTGATTCT CGTAAgaatcctttttttctttttttcaacgcgcctttctaaaatatgtt TAGAACCCTGcgatccttttttttttttttaaacagaaaTAAATACGGTT TCAGGCGCGCATGGGCCTCTTAAACCGATCGTTTACAAAATACTTTCTTA AAATAAAGCTTGTCACGAGGAGTTCCTCGGACTCTTATTACATGATCCTT CTCTGACATCACTTGATTCATTTCGTCCGCTTTCTTTCGCCCACTCTTTA ACTTGTTCGCGTTCGGATTTGGTTAAATCGTCAGTTATGCTAACTTTGTC GTACTTTTGATATCTCTTTAGTTCTCTCAACTGCTTCATAAATCTGTATT TAAAATGAGTATCTTTAAACACAACTTTGATGGGACGCATGTCAGCAGAC TCCTTTCCTATACGGGAAATGTATGTTGGCACTGTCTTGATGTTGACGTC GCTCAGTATCTCGGCTACAAATTCATTATCGTCTTTATCTTTGGTCTCTT TAACGCCATGGATGATAATTTTGGCATCCCTAGATTCTTTTCTTTGTTCT TCAATTTGTTCTTCGACTTTCTCGCTACGGAGAAGCCGTTTGATATTGGA TATGTTTAATTCGTTGCTGGTTGTCGCCATCTCAGCGTAACTTTTAGCAG GAATTTTCTCTGGGTCCGTTGTAGTCTTCGCATTAATGGTTTCTTCGACT TTGTTTACGATTTTTGTTTCCAAGACAGACGGAAAATTCTGTTTGAATTA TTTCGGTTACTTGATTTTTCTCCCTTAGATATCCTTGACATCTTGCTTGC AGCTCCTTAACAACACAGCTCAGTCTCCTCTCATTCTCACTATTGTTTTT GTGGCTATCGGTGCAGCTTTTGATTCTTACTGATTGATcgattatctttt tattcagttcttcaTCGATTGAGCAGCAATTTATACACTGGTATTTACGA TATCCTTTATTCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNGTCCTCTGGCATTTTTGGCATTCAATTCTCA TATTATCGTCATCTTTAATACAGTTCTTTTCCGTGCATTGGTCGGCGTCA TTTCCATTTTCTTCCTTGTTAGATTTTGCAGCAAGAGGAGGCAATTGTTG ACGAAATTTGGtcgtttttttcatatttttttatattgtacaaaatattt attttgtcGGAAAGTGGCTTTAGTATGGTAAGTAGATGCTGATGATTATT ACCTTAAGCTGGtttaatgttgacatcccttgTATAATTCTTATACCCTC CTTAGAGATTAAtaaggaaggtcagaatcactgattgaaaaaaagatGCT TTACTCTTTGGCCGCTAATTAGCAATCAGTGATTTTGACCTTTCTGTTAT TCCTAggtttaaagaagggtgtcggaattagattaAGTTATCAACATTAG TGTTATAAtatcaaacctttttaaaattatttggtCATTTTCGTTTTAAT TTAGTGGANggtttaaagaagggtgtcagaattagattAAGTTATCAACA TTAGTGTTATAAtatcaaacctttttaaaattatttagtCATTTTCGTTT TAATTTAGTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTAA CCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTAA GTGttgaaaattatgattgttTATAGTCtgtgaatgaatttttttcaata aatgtaaACATAGGAtagaaataataataacaacaacCTTTTTTTGCCAG TAAAAAGGGGAGTTATTTGTTAGTTgagggctctggtcatagtgaaaaat caatttcagaatttgaagataaaaccttatgttttcgctgctttgacatg tttaagaacaaactgcttttgaaaaaatgaatttaagtaattacatcatg agttattaaggaataagtgtggcatggaccttaataaaacgtcataatac atcacctgaaccaaacatgtttgatttttaccgagattagggctttgaat ggtgaaatactcttcttcgaaaaactgttcgttttcttcttcatttaata gCAGAAATTGctatttaagttggtgtaaaatcgaaaaattgagtatgtcc agagcccttaagcctGTAGATTACCAGCTGTTATAACTTTTAGGCTTAAC AACTGTTTTCTCTGATGCCATTGGATTGATTTTATTTACCCTTATTAAGA TTGCCTTGGGACTCAAAATGAGGTATTTTCAACATTAaggtgattttgaa attttatcttACAGGTTGTACAAGGAACAAATATCACAAATTGAATCTCA ACTGAAAGAAGTCAACTCCAGTAAATATGTAGTTTCTGTTCTGAAATATA GATatatagtctacacaatagacagctccaggcttttagaccttactctt ggtctataggcactgctataagGGGCCACTAGTaaccccaccgggaattg cttattgataggtttaaacataattgataacttttacaaaaaatgtttat caatagagatttcaaataaaagaatgtttaaaacacagctgattggctta ggtttcgaaactttctattgttttattaaaacctcagtgcgcatgtgacc gggtagctcagtcggtagagcattccccttacaatctaagggttgtgggt tcgatccccggtcacgaCCAACTCaccggatgagtagcttagattgggta atctgatctaggcggtaagttactgagagctgagagtaggtgtggtgctc cacctcagcatttgatctcccaggtctagcgcaaatagaaaaggggatag actccttcactcccggctccgtcgacagccaccagatgaatatacttact actacagtgcgcatgcgatttatccggagaatttcaatattcaaaacaag agcagtgctcatatcccaaagagtaggagttttacactCGAAACGAATGA ATATATGACGTAGCCTGATGGATACATTGCTTTGATTTTGAAGAGGCATT CAAAAGATAACAGCCTCTATCATTTACGGGTACAGAGCGTAGGTACAAAA TAGGACACAACAGATCCATGAAAACCAAATGACTCTACAGGGAATACCTT aattaaaacataaaaacatcaATAGTACGGCCAATTAAAATGTTCATTAC GATGGAGTGATCATCTCCATTAACAACAACAGTAGGAAAATTTTCATGCA CTCATAGTGTCAACCtccccagaaatctgaagggcatCTACGCCAGGTTA GGGGTTGGGGGGCTAAtattttgcaattctttggggttatcTATTCATTG GGGGTACCTAGCTGTTTTGATAGAGGCTATGGGGGCTgtgtatattttcc aaattgaatatttcaaaatatttcaaactattgattttttttaccccAGC GCCcagtttcccatccaatttcTTGTTTCTTTCACGTCATCTTTTACTAT ATTTTTCAAACGTGATTGTTAAAAGAAATTATCGGCTGaatgggggtacc taactcaaagcaactTTTCAAGGGGATCTAACTTGTTGGGGGCACCATGC TTTAATGGGGGTagctgaaaagtgggctgaaaccatggcACTCTAGCCTA CCACTGTCTTTGCCTAACTAATGATGGTAAACAGAATGTTCTTCGTGTAC ATGTGCCATTAACAACATGTTATTatatttaaaatgaattgaTAATTTCC ATAAAAGAGTATAAAACAATGTTCAAAATAGCACCATTTTCTCCTGCCCA AAACAACGCCAATATGGTGTGCTATATAGTGTGCTATAATGTGTGTTTAT ATCATGTatttgggacgagatggagtttttacaagctcttatttgatttg gttggttgttaaccagtaatgaaacaattttgttactttttctataaaGA ACGCGTcaaagtatcttgtaaaaactccatctaaTCTGATATATTTTTAG GTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAATGC ATCATAAGAACTGAAGTTGCTTGTACGTAAACTTTTTAAACATGACTTTT ATACGTTATTAGATATTAGATTATTTGGGAAAATTTTACGtaatatattt cctttttcaatacaattttGAGACTCAATATTGAAGAGTTTATGTTTAAT GGttggattttcttttatttgtcaGGGCAATTGAAGCATTATAGGGTaag tattttatttgttttttgttgttttttattcgCAATTTAGTGCGCAAGTA GTTAGTCCAAGGGCtcaaaataacgatttcaagtggtTTAGAAGAAAATG TCTGTCCAGGGTTTTTTTAGCTTGAAAACTATGAGTTAGACTAGGAGTAA TTTAGGTTAAGGTCGAGGCCGCTTATTCAAAACCAAATTTGATTGAAACT AGCGGCGTCAAcgcaaaaaaatctttaaagtgcGTTTTAAGTCTTAACAC CTTCTTATAGTTACTATACTACAATATAATAGAGAAGAATcgttttgatt tgattcaagACAATCTTAGTCNACACCTTCTTATAGTTACTATACTACAA TATAATAGAGAAGAATCGTTTTGATCATTTGATTCAAGACAATCTTAGtg ataattcaatcaaaaactGTCCAAAAACTCAATCGCTCAGCAAGCAAAAG ATCCTCGATTTAATCGCCTCTTATTTCGGCACCTTGGAGAGAAATTTAAT CACACATCCATCATTGATTACAAGAGTCtttatctattatttttttacag ACTATCAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCA ACATTTTCAGGTATCAAgtgtattttgaattttaaagaagCAAGAATCAA GGGCACTCAGGGGCATCTTCTACACTGTTGAGCAATTGCAAAATTCTTCT CACATTCTTCTCTCTAAATCTCTAAATCacatgtttatgtttatgtttct ttaaagttgatgtaTAATAATACAATGTGTATTTAGCTCAAGGCTTATTG ATATCAACTTTTAATTACAATTCTATCTAAGGTTTATACTCAAAATCAAG TATTATTTACAATTAGGTGATATAAATTCAATCGATAAAACCATAAATTA TTATGATGTGACAAGGAAAGAGctctgaaaaaaattgaagctgTCACTTT TAATCTGTAGAGATTATTTAATCCTTTTAGTTCTAACGACATTTCGATCT TTACAGATTTTTATCAAGTCATTGCTTGAGTTGAGTTAAACTTTGTTTGA ACTTTCGAAAACAAGTGAGTGAAAAGAGTCGAAAAAATGGAACTTTTTCT CGGAATTAGTTAAAAATCCCACCTTTTGTCCAGATAAAACTGAATTTTTC CTgaagtcaaaataattttattagTATTTCTCTATTATTTCTGGCTTTTC ACGAAATATCAAGGTTTAAATTGGTTAGAAATATACACACAATATTTGTA AATCACTCTCAAACGTTAGAACAGGATTTTTGCCTTTCAGTTTTTTGGAc cgtaaaatttgaaattcccACGCATTAAttacaaaatacaattttttcgt ATCCTCATTAgtattttaaaagctttttcatTTGATCTTCAATAAGGGTG TGTCTCTTCTATGTATATTTCATTTCCTCTAAGACATCTTTCATTGCTTA TTTATAATATGCTTTAAAGCTTTAGGGGGCTTTGATGGAGTTTGACAAGG AAAGGTATGCTGTTGTAATTTCTGTATCTGTAAGAATTCAATGCAACGAC GAATAAAGCAAACACATATTGTTGTTATTACTGTAGAATCAAGAACGACA AGTGTACGATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAG AAGAAGAGAGACATACCTCAGAAATGTACTCTGGCAATACGCAAGGTAGG CGACATTCTAAAATTCTGATTGAGGATAATGGTCTTGAATAGTTGAGAAT TGATAACTAAGTAAAGAATGGCCTGGAGGCCAAACCATTTAACGAATAGT TCATCCTTGTTTTTCGGCAATAGCCACAATAAAATTTTGAGGGTTTGGAC ACACCTTGCACAGATCCCTGTGGAATCGTTTTACGCCATGAAAAAGTTTG GCTGATTTCTGTTGGTGTATATGACAACCCGAGACGTGTGAAATGAAAGT GTttgcaatttataatttatccCCAATTAAGTTGAGCTAGAATTTTGCtc ttttgatcgttttttttcCGAATAGCGTCCTTCTTTGCCTTTGAgtggat agctatcgaaagaggagcctctAGGTTTCCTCTGACTGCGTTCGCTAGAC CTACTTACTATTCGAATAGCAAAAACGTATATTTGGTACCACTTATAggt ttttgaaagaatttttcacatttttttagATCTTTGGTGTGAGGACACTT TCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAAATACATGTTCCAGAG AAACGAAAGAAGCCTGCCACTGTTACAGGTACGTTATTACCGatgttttt gtgtgtttttctgaCGGTTAGCCTCTGATGTTTTTAGatcctgatcaact gaggacgacgcTCGATTCTACGGGTCAAAAATGTGGGTTagtctaaatcg cttcaccgTCTGCAAAAGTGCAATTAGTGCAAGTTATTAATCATTCTGTC TGATTCGATGCCCAAAGGACCCAGATTTCTCTTCGAACTACAGAGAGCTT CCGAACTACAGAGAGATTCCGATAATAGAGGCTCTATGGAGGAATTAGAC ACTGTTACAGCTATGAATCTTTCGTTCTTTGCACGCTTTTTTGTGTAGGC TCGTATACATTCATCGGgtattttcaataaaagaaacgttcaaaaatttt tgaattgtgattgttgttgaattttttgttaTCGGTCATCAAGTTGATCC GCTTTCGGTCAAGGGTAATCCTACATTAAAGCAAAGTCTGTTATGCCAAT ATTGACAATTCTTATAATTGTCTGCTTCAAAAAATATCTCGATCAATCTG ATGGGAAATTCTCAAGAACATGTCATCGCCATTGCTTTTTGCTGCCATTA GTGGAGCTTTCTTTCTTTGAAAGTAGATAATCTCTTATACACATGCCACA AAAATCGGATTATCATTTCAATGCTCTTCAAAAACTGAATTATAATCGTA ATTATTTCCAAATGGTTTTTGTGGTATGGTATATTATGTCGGAGAATTTA TTCTAAATATTATCAGTTGCTAGGTGTTTGTACCACTTTCACTGGAATGT TCGAAGATTTTCAGATAGCATTCTCTTCCCATTATTTCAGACCAAGCTCA CACATTACAGGTCTGATAATTATCCCCTTACTGTAAAATACAGCTCATGA CTAGACCACTCAGCTCTCTACCCAAATTTCGGTCAGTAAATGACTAAGCA CTCCTGCATATTTAGTGGGTCAATTACGGGCCTTCGGCCACCAGATTGTG CAGTGTCGGCTTCACCACAAGTAATGTGTAAGATTTACTATAAAAATCTT ACCCCGGAGCATTAATCGCGATagatttttaaagataaaataaaatgatg aaGAACAACATGTATAAACTAAAGAATGACGGGGTGCGGCTAAAAAAGAA CGAAAGAAAGGCCTCAAATGCGACTTGAAAATTTGATCATCGTACAATCG ATCACGGATTATTTCGTAAGACTTTCACCGTTTGTTTACtagtgaaaaag aatttttgccatctttttatgattgtttactCAGACATTTTCTGAAGTGC CCTCACTTGTCttggttgatttttttgtcagttgtaaaatttcttcattg GTTAATCCGTGTTATCTTAACTGATCTAAGTAGGCTAGTTTGCTGTTTAC CGAAAGTTAAACCAAAATACCGGTTTCTATTGATGCACTCTTCTTTTACT TTTGTCAACAAAATGCATTTTATGTCCACTTTCTTTAGATCGCTAATATA AGAGGATTGTCTAAAATTATCCCTAAGATATGAACAAAATATTGACACAT AGTCTAGAGAATGCATGAGAATTTATAAGAGACTCAAGCCTATCTCAATA CGATATCAgtatttgttatgatttttttaccaTAACCATGTTTATTAATG CTCAAATTATCCTTGAATATCCGAAATGAGAAGGTTCCCTGTAACCCTAT CTATCTCATAGTACTCACTTAAcatattttttaaggaaaactaCTGAGTT GGAAATCTACTGAGTTCGAAACTGTATTAAAGGCAATCTTTATACAATTT TGACTCGACATATTTTGCGAAATGATCAAGACATTTAATAAACTTTCCCT GTAACTCtatctttatttctttttgatcGCTTTTTTCAGCTAAACTTGAG aatgaattcttcttttttacatttttcaaggGTTCGTCTTTTGGTGTGCC CAATTACTATTGGTAGGGCATTCGACTGGTGCGTAAGTTTGTGGATTAAA TCCTAGCTCTGGTAATAATCCAAAATAGTCAAagactctaaaatattgct taaTGGTAACTGATACCTCTCTGcctgatgctcagcaactaaataaaata atgaaGTATAAGCGGAGCATTCCAAAGAGAAAGACTGGTGCACTCCCCTA CTTACGGGTAGATAACTatcaaaagaggagcctttggTCAGCCTCTGGTC AGCCTCTGACTACGGTCGGATTTCTTACTTTACTTATACTTATACGGAAT TTTATTCGATAAGACTGAGTGAAGTAAAAGATGACAAAAGTGGGGTTAAG GATCAGAAGTATGCCTTGAAGTGTTACGGTCCTTTAAATTTACAAGTACG GCCTGCATTTGAGTGGCCGAAGAAGAAACACGTGATTGgggaaaaatttg ctttgaaaaCAAAGCACTTTGTGggatactttaggcgtacaaactttcgc gaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNttcctagaatttttaaagacatttactttcgcgaa aagggccaaaattcgcgaaaatcgcgaaagtttctgctcgcgaaagtttc tacgcctaaagtagtctTCGTTCGTTCACTGGACCAATCTATTCCCATAC CACAACACCTTCGCCTTAAGCAACTACATATTATTTTTTACTGTAAATAT CTgtttttgtaaacatagaaCATGTTTTGCTTTGCTAAGACCACTTGTCT AGAACCAAGTGTCCTTGAGGAAGTGGTCAGCAATcgatgttgttgttttt atctTTGTATATTGTTTGCAAGCCTAGGCATTGCTTTCATTGTTTCTTAA GCAAGGTTGAACCCAAGAAAGAATAATAGGCTTTAAAGTTTAGCTTGGAG TAAGAAATTACTCGTGGACGAGACTATTTTCGTTTGGAAAAAATTCAACA TTTAAAATGGAAAGTTTAGTCACAACATATCTAATCTGTTAAAGCGCAAA TTAAATACAGTGTTTTCTTtttgtgatatttttaaaagaacgatTAGTCT GAAATAACAcaaataccgtattacttcgaataaacacccgTGCGTTCATT AATTTATTTGGTTTTTAGGAGGaatgtttaaaagaagggggcttttattc aaagtaatatgGCAATAAGAAGAATGATATCAAAACTTCAAATACCTCAA TTTTGCATACTGTATGAAATAAGAACATGACGAGAACAATTTGAGGCACA AAGTGCCATAAATGATATGCAGCCCGACCTGCCTAGTTAGCGAGCACCTc gctaaaaaccgggattttttatctcgtttcttagtgagttccactttgac gatgtgttttgacgcaaattcgattatttcgCTACTGCAAGAGCTTCTAA AGGCCGATGTCCACTTTCGTGCGAAGCGCGTGAAAGATTTTTCTTAAccg tttttgcctgaagaaaagattacgtcataaaaaagtttcgcgcgaacaaa aaaaaagttgaaggaagttcaactttttTCAACTGTTACGTCAATTTTGA CCAATGGAATTGCTTCTTTTTTCAATCAACCAATGACGTTACAAATAACG TGAAAAGTTTCACGCGcttcgcgcgaaagtggacaccggccttaaagcta aaagtgacgtcaaaaatcgaATCTTTAGAGCCTGAAAACCCGGGCTGGAT CATAGAACTCTATAAAACCGTAGATAGTACATGAATCGGTTATTCCATGT CAGCAGTCTAGCCTGGCatctgtcaagaaatgaaaaacaaacagacaaac aaacaaactgcCATGTCATTGCAGTGATTTAAGAGCCTTCTTCTCTATCT GTCTGGTCGGCTACAAAACACAAActcatatttttcattcaatttcaaaa atcttttcttcTCAAATGGCTCGGCACAAGCTTTGTTCCTAGTACTTTGT CGGTTTTTTTAAAGACCATCATAAACatatttctctttgtttttggTGAT TGGAAAATCACCTAGACGTAAAATCCGTCATTTTTGAGAACCTGTCTCGG TCTCTTTAATGAAATGTCATCTCTCTTTGAGAAGCTCTAGTATTTATGAC ATCACTTCTTTGTAATGTGCCTCAAAAACTGTGAGCCAACTCTCATTTGA CAGGATTTTGCCAGTTCATTCCACGGTCAAGTAGTAaagataattctttt tttaaatctttttttttcggaattttcaaaagttttgagtACCATCGCCC TAACCAAAGATTGCTATGTTGAAATTATCGATTTTTACCGTCTGAAGTTT TGTGATCATCAAATCTCAAATAGAGCGAGCCGAACAAACAACCAAGAGGA AACGCACTCGCCCTTTGATGTTACATCCCACCTATAATCATGTGAAGGAC TGGACTCTCACCGCTCTCATCCCTCAAGTGGATGCTAGAATAAATTATCA AATTATCGAGTTTAAGTTTGTGCGTTTTTCTGCGACGGCGACGgtattac ttttgatttttctagatTCTGATCAACTAAGGAGGACGGTAAATCAGCCA AGGAGAATCAAATTGTACGTCTCcttgattttgcgggtcagaaactgcgg gttattccaagtCGAGTCAGTCACTCCGCCTTCCTCAAAAGTGTAATTTA ATAAACTCGCTATTGCCCGGAGCTTCTCGCTTCTCTCTAGCCATTAAATG CAATGTGCATTTAGACCATATACTCCATTCCTTTAAGCTGTTTAAAAGCT TTCCCAATCAACTATTATCTATCTCTACTTTGACTTACATCGTGCTTTGA TAGACAGTGAGGGAAATCCCTAGTAGAGTTCTGAAAGCATGCATGTTGAA GTTATTCTTTAATTAAGGTTGGGTCATCATCATCAGCATCCACTGACTGG TCCGAAAACAAACAATAACCCTCCCCCATTAGCTTGTGATCAGCCTTTGC AGTATCTAATAAGTCCTCGATCTCTAACCCATCGAGATTAAGAGAGGAAT CTTggacctttctcaagcaagaaataGTGACGCCCTAAGATTTTCACCAC GTTTAGAataacggattgaatctagccctTTCTTTGTTCTTAAGTGgttt atttttggaaatctggtgatggatttttattttcaatccaaAGTTTGTTT GAAAACTACGCGGGTAACGCgttttagatgggaaataagtggctttcaTT TCATTAGCTCCTTCAGGGCTTCTAAACAATGCTATCAAGAATAATATAGC TAATATCAAGAAATGTGTGTTTTCTTGAGCACCTTCGCTACCAGAGCAgt agaaattttcaaatacattACNGTGAGTGCTTTGTTACTTGTTCCATTTT CCAAGTCTGTCTACCGCCTTTTCCGGTAGACGGGCCTTAAATTCGCTCAT CTTTCCTGTTGATGTTTAAAATCGGTACGCTCTCTGTGTTTTAGAAGAGT TTTAAGCGGCGGAGACGCGAGTCCTTTAGGCTTTCCTATGTTGTGGTCAC GGTAAAATTGATTCGTTATACATTATACGCTTCCTTATTCCGCTTTTAGT TTTtactttctaatttttttctctttggtTTACATACAAATAGCACCGCC TTCTCTTAGATTATAGTTggaagttgaaaatatttgcaTTAGAAGCGACA ATGAACTTCCAAGAAACAGTTCCTTTCGGTACGCGTTTAGTTCAGGATTC CCAATTTTCCTGTCGCCACCTTTCACCCTCtggaaacacgttttttttat aagaatatgcaTGATGAAgttggtcaaaaaattaagaaatagtGAGATTG CGTTCCCCTTGGATCTGTTTGGCTGTCAGGCAAAAAtgctctcgcttatt cgaactttcagttattcgaagcgATTTCTTTTCCCTTTGGGTCTGATTAT TGGCTAAATCACCCTCAGTTATTTGAATTCCTCTTATTGAGAGATCGTCG AGTGAGAACATTGAATTTATGCGTTTCAAACACTTATTTTCTTCACAAAA GTCAGGTTTCGATATTCATGGCTGTTTACACGATCTTCAAgcaatttctt caaaagctcAATATTCTACTTCGGTCCAGTCTGAACTGGATGCCTCAATT ACTTCTGAAAAGTCCATCCCATTGAGGTGCAGTCTGAACTAGATGCCTCA ATAACTTCTGAAAAGTCCATCCCATTTAGGTGCAGTTGAAgatctagtct gaatcgcatacCTCTATATACTtgctataagaaactttttagcTAGAGGA TGATCATCTGGCGggaaaacgaatttttcagttataTTCGAACACCCGTT ATTCGAAGTAAACTACTATCCCCCTTGtagcttcgaataaccgggacCGG GAGTCTACTGATGTCCTTAATAtgtactttttttcttcacacAGGTCCCT ACGTTATCTACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCA ATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGGTAAGAA CTTTGTTATTTTAGTTATACCCTTGCATTGGGTGTGTGTTAGTCTCTTTG TCTCATGGGCCCGGTCGTTCAAAAGTAGATTAAATTAAATTCCGATTAGC GACATTCGGaaatgttttttggacctacctcggagatccttttaaattaa cccatgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttcgttcgttcgttcgttcgttcgttcgtccgtccgtccgtccgtccgtc cgtcgggattggctcattacttttttctgtttttggcacaatgatgcaaa atgatgattcctaaaaagtgacggagcccgattttggagaaaaaaatttt ccggctgaaaatgctggaaatatgccggaaaaactgttttttggcatttt ctctagattttatcattagttgtttctgattttttgctcaaagatgcgta ttaacaatgtccaaaacatggccgagtccgatttttgagaaagctttttc cggccgaaaatgccggaaattgccgttttagaagattggattttttcgtt ttatgtctttgtttttttttcaaacaaaaacattatttataagaatgtcc acgattaagcatggttcaattttcaatgaaactgNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtcgtattattctgcattt tcatactattgttgtcatttttcaattgtcttattacatcaatcttcagg taggtccattcagcatgttgcttgtttcgtTTGAAATTTATAATTCGATG CAGCAGCTGCACTTTTTTGtaggaaaaagtttcttaatccTTGCTAGTCC TTCTGTAACAGGAGTATGATTAAATATTGGCCTACATAATCGGTAAAATC CAGATTTTAAgcctgatttttttccaaacaacCGACAGTCTAACGCAGAT CGAGATTTAATCAAAAGTTAATCTAATCTTTTTGAACAACCGGACCCTGG GATGTTTCCGAAAAAATGATCGGAATCGACtgaaatttcacatttttacC TTGGTTGAAAACACGGAAGCAGATTCTTCTACAATTCACTTGAGTCTCTG AGTTCGTGGAAGAAATACTGGTTGTGACGTGAGTTCTTTTTCCGACCCCA CGATATTTTTCGATCTTAAACATTGCGTGGAAATATTAGATCTGTTTAAT CAGTCTAGAGCTAGACTACTAATTAAcatcagttttactcaaaagctTCT TTTACAGTAGTAGAAAAAAccttctttttgactttgagGCAGGATTGCAC CTACGTTGTtaaactagccatagctttcactaactgccacccgctacaaA TGCTTATAACGACTAAATGCCGATTAATGCTTTATAGTGAAAGTTTCGAA AATTATTAggaacaagaatcgcaaaattgcgattaaatatttccttaaaa atgaaggtcattatcgACATATACTAGCATgtagctgtcgctaagaatgt cccgcagagcttcctatcgaaatatccctaagtaagcaaaattacgcatg tgtagattttaaattcgttttatcgataaaatttaagttgtaggaagaaa gcttggtttcaactttacttttgagataaCATGGGATAGATGatcgctca catctcaaaaagagaagttatcgctcacatgttatcacagtgaaaacgca aaaaattctcaaattgatttgattcttataaagtagacacttataataaa aataaatatgctcatctttttcgccatcctttgtttactttctaataact aattaccgaaaggtatattgccTTCAACTCCATATGATTTctccaatttt tttagaaatatggtttataataaagataaatatgctcatctttttcacca tcttttgtttactttgtaagaattaattaccgaaagatatattgccttca attaagagttattgatttgattcttataaagaaaatgcttataataaaga taaatatgctcatctttttcaccatcttttgtttactttgtaagaattaa ttaccgaaagatatattgccttcaatcaagagttattcatttgattctta taaagaaaatgcttataataaagataaatatgctcatctttttccccatc ttttgtttactttgtaagaactaattaccgaaagatatattgccttcaat taagagttattgatttgattcttataaagaaaatgcttataataaagata aatatgctcatctttttcgccatcctttgtttactcNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtctaataact aattaccgaaaggcatattgcctttaatcaagagatattgatttgattct tataaagtagatgcttataataaaaatagatatgcttatctttttcgcca tcctttgtttactttgtaagaactaattaccgaaagatatattgccttta atcaagagttattgatttgattcttataaagaaaatgcttataataaaga taaatatgctcatctttttcgccatcttttgtttactttctaacaACTAA TTATCGAAAGATATactgccttcaatcaagagttattgatttgattctta taaagcacaTGCCTATAAtagaaataaatatgctcatctttttcaccatc ctttgtttactttctaataactaattaccgaaagatatattgcctttaat caagagttattgatttgattcttaNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGAATAGT GGTCTGGAAATCGAGACTACTGTTTAATCAGTAGTGGTGATAATTTAGTA GGAAACCTCACACGTTGAATCTCATGAATCAAAATTTCTGGAAGGAgatg aaaaagatgtttttaaGTAAAGTTGTTTTCCTCTGCGGTTGTCTCGAATG TGGTCGAggttttcatcaaaatcaaaaaacaaattttaagatacgtgtaa atcaattttttcaCGACAATAACAGATTCACAACATAACTTAATACGAGA AATTTAGCGAATCGCTCCATTCGTCACTTCTCGTACAATAAGAATTATTA TTGCTTTGCATGCAACTATTCATGCAAAAAGTTGGTTTTAGGGGAACCCT AGTTGACATCgagaaagaaattaaattttgttgAGAACCAAGGAAAGAAT GGAGACCTGAAAACTAGCAAGTCGTCGCGCTTTTCTGTGCCAAATGGCTT TAAAAGAGACCAACCATTCTCTTGGTAAAAAAATAGGATGACGAAAGAAT AGTGGCTTTCGTTGCAGAAAAATTGGTTTTAAGGGAACATTTGATGACAT CGTGAAagagaaattaaatttaaattaaaacaGCAGAGGCTTGAAAATTA GCAAGTCGATGATATTCCTCTCTATACCAAATAACTTCAACTCGTTTCAT AAGAGATCCTCTCTTCTCTTGGTAAAAAAAAATAGGGCTGATAAGAAATA GCGGCTTTTGGAGGCGAGAAATGACCGGTACTATCAAATAACCGGTACTA TCAAATAACCGGTACTATCAAATAACAAACTACACTAACAGTACGGTatc ttgtttgtttattttttgtgaGGGTAAGAGTGAGTGGGTGAGAAAAAAAG AGAGGGAATCTTCCGATGAGGTGTTGTGAGAGTGTTAAGTGTTAAGACTC TATCAAAGTCAATATTTAAagaaaggaaacaaaaataaatcccccttttt cagaaaattcttggcaAGGGATCCAACCATATTTCACAATAACAACTTTT ATCAGCTGTCACCAGATGTATGTTTTAAGGACATCTTCGGAAGGACATCA GGATAGATTCCTAAAGAGCCGTGGCACTCAAACCGTCAGCAAATAGTACC CTTGCTTCTCATAACCACCGCTTACGCGGACTAAAATAAGACCTATTTAT TCGAACCCTTAACAAGAGGAGAAACTCCACATCTACTTCAATGAGTCAAT ACAGTTCACAGTGTATTAAGCCAAAGCTTTTTTTAAGGATGCAGGAAAAA CTTGGATTAAAAATCGACTCTTAATgtgcaatttttctaaaatgtttcGC CGAGAACTTaatattgttttcaattttgagaCTTTTCAGTGGACTGTTTC CCTGTCGATCTTTACAACGCactctcaaaacaaattaaAGAACCGCACCT CCCTGCCTCTCACTTCTACTTCGATGAAAGTATGAAGCTTGTAGATCAAT TAAGATATTGTCTAGGCGACAGCTGacatcttttcattttttgctgacgt aatgtctaaaattttgaaatttaccagTTTTGAATTTCGATGTACATATA CTGATTGATGTGTTTCGAAAAAGCTACttattttttggctgaaaatgtAT AACTATTGGCGTGTTCTCAAGGTATTTTCTATTATTTGATAATAAGCCAG GGCTTGAATAGTTTCTGAACCGGGATTTCAATCTCCACTTTTATCTCCAT AACATAGTTGGTATTTTTAGAATGCGTGGCCAGAATATATGTTTATTATT GTTGCGCATTGGCACTGATACTGCAACAATGTCCATGTCTAGACTAgttc attgcattgacgtcattGTTAAAATCCGTTTCATAATGGTAGTCAAGTTG CGAAACCTCCTACGGCCAAGCTTTTCCGCAAAATACTTTATTTTCGCGAG GATTGAGAGTAGTTTCGGAAATAGATTTATTTTGTTAAGGTTCACCActg ttatttctattttcctATTTACGGGACCAAACTCTCAAAAGAGGAAACCA CcgtttattcaaaacaatactTCGATTGATCTTAGAAAATTGGTAATTAC TTTTCACAAGATTAACGCATTACCAGTGGAATTGGCGTCCGAAATTAGAA ATTCATCTTTCGGACACAACGTTGATTTTAATGTTCAACATTTATGAAAT CTCAAGAAGATGTGACATCAACATTAAATTaggtctacttctgactgaac ttatTGATAAATTTGAATCACTTAGATTTGAGTTCACTTTTAATCGCGTC ATCTAGTCGACCAAAAAGCCTTGCGGTGGCCACGAGGAAGGCTACATCAA GATTGAACGTTATGCGAAGCGCCGCAGGTTCATTGTATAATACATTCAAA TTCTAACACATTATAATTTAGGATTTTcgtttgtttttcaatcagaACTG TCGTCACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAAA ATTCTTCTACGAAAATGAATGGTAAGAAAATTGATGATATACCTTGTTTA CTGCTAGTTAACTATAAGGTAAAGCAGGGTATCATTATGATTTAATAAGC TAACGTCATGCTTTAACAGTTATGGCATtacaccttttttttcaaagaag atccaaaaattttgaagtcttccgatgttcttaactttttgagctttaag ctttaaatgttcttaacatgttcttatttccacattttgtgggtattttt tcgattttcctaagaaatcgggtgtttttgagttctcaaagcaaaaatgt tcttaacttgttcttaacattctggccatcgaagcctttatgtagttttt cttatgaaaaaacgcgTATCGTATAACATCTATATTACTGTATAGCATTC ATTATAAACTTATAAATGACTCCAGTCTAATTTTTTTCCTAGTTGACAAG GAACAAAGATTTCGTAGAGATATACCCTTATTAGATTTTTACCGTCATTT ATCTACCAGATCGGTGAAAAAGTTCATTATTGTTCTCATTCtgaaatctt ttaaatttaattCAATTTCTGTTTAAATTGAAGTTGGTCCACTCATTATC AACCAACATTCGTTGTGTTGTGGGCAGGGCTAGGTCACTACTGCAATCGT CACATATCAAACTTGTTTTTGTTTGCCCATGACAAGCTCAATAATTTATG TTGCAAATACCTATGTATTTATTTCCTTTATCAAGTGGCTCCTTATTTAA TTTGGCACAATTGTtgccccaattttttttctcgttatTTTTTGTGGCTG TCTGCTTTTTGAATGTTTGTTAGTTTTATTGCCAAACGAAACTTTCCTTT TCGCCAAAAACATTTAGCCTTTCtattaacaaaaataaagatttttttgg gGTCAAAATCTAGAGGGATAGAAAAGGACTGGTATTTAAGAATGGCGAAC TATTTTTAGTCAACTTTAGGTAATCATCCTAAAGACCTTGTTTGCTCAAA TCTTTGAGTAATGTTTAATGCGGTGAGTAACAAAGCTCTAGAACTACATG TTGAATAACAAATATTATTGATAGAGAAAGGtctcaacaaaaaaataaat gcCACCCACAGTGCCCAATACTTGAAATTATAGTACAGTAATAATATGGT CATGGTCATCAAAACACAAGTCTCATATGTTAAATAAGCATTCCATTTTG AAATAGTCTGATTAATTAGCATAATTATAAGCTCTGAAAATTTAGCGCAC TTGCACTTGATAAGATattctttaaaacttttctaaaaaaaattaaaaac tgatCAATCACAATTTATGTCTTGATTTAATTAAGGGATAAAAGATCAAA TTTAGAATTATTATTTAAGATAATGAAAGGCtctaaaatgacgtcatctg ggCCTGAAATTTCGCTAGTAATCGTAACATTCAGGATTATCTTGAATCGA ACACTTCcaacgatttttttttcaggttccAGAAAGGTGACAGCGTGGTA TTAGATAATCGAATCGATTCTCCTGTGCAGTGAGTCAAATTTCATTCATC TTTCGAAACTCTATCATTTCGTTCACCAGATACTATTAAAAGTGCACTGC CAAGTTCAAGACACGGCGCAAAGTCCTTCTCTTGCGAACTGTTGGCAAAA ATGTCTACTGGACATAAAGTGCTTTCTATTGCTATACAATAATACACCTT TCATCCTCGCATCCAAATCCCACTCTTGTTATAACGGGAATGTTTATTAT AAATGGAAAAAACAACACAGGGTAGTTATTTTGCAATGGAAAGACGACGA GACTGTTTGATTCATTGATGAAGACACTCTCCTGAAATTCCAATACCCAC GCTGTGGTTTTCCTGGCCACGATGAGACGTTTTAGTCCCACGCTCTGTTT TAAAACAGTCCAAGGCCAAAGGCAATCAATTCTAATTTCAGAAAGGAATA TTCTATGTTTAAAATGAGGAAAGAATTACAACATTTTATGATAGCCAAGT GCTACGACAATTGCCTTTTGTAAATGATAATAATATGATTTTGAAGAATG TTTAATATTGTGGAATATAGAAATCCTAACACATGAATTCTTTTATTTCA CGTTTACAGAGTCACCATTGCTGGCATCAACACAGGCGAAGTAAGTTTCA TTTTCTACCAAAGTTTTCTTTTCTCGTTGTATGAAAAATCATGTTTGGAA TATATGGgcttttccagagaaaaaatttacccctactgttgaggatattg atttttcgaagtatcgaaccccctgagcctactttattagtaaaaaCAAC CTGGATATCCACCCTTAAAAacatgctcaaccccctggatatcctctctt ataaagatgcttacccctggatatcgtattttttacatgaaaagacattt tacttcctggatatccgctcccttgtagatatttgatcccctggatatcc gatatgcTCAacaggggggcacggactatttctgaaAAAGCCCACTTTCT GATGCTTGGAATATTTTTCTCTAGGAATTTACCGCTTATGGGGTGTCTTC CTTTTCACTTAACTTTATTACATTTCCTTACCCTAACAGAGTTAGTccag ttttttatatttatactaaaataacaaaaatgtttgaatttttcattatc TTGCAGAATTATTTCAGGAGATAGAACTCCTAGAGAATATGGAGGAAAAA AAGTCTATATCCAAAAATAATTTCTAGAATGTTTTCTAAGCGTTATTTCA CAAAGTCTATGAAGACAAAGTTTAGCCAGACAAAACCGTTAGTAGAAAAA CTATGattaaaaatcattgaaaagaaaacaaaacatgatataaaaataca aggaaaaagtCTTCAACCCCACCCTCGAAAAAAGCCCCCATCCTTTGCCA CCAACCCCGCCATAAGCCAAGAAATccctttttgactttttcagaAAACC GTTTACCCCACCATCTAGCTAGGGTGGAGTGGAAAGTATGCGCAGGTTTG TCTAAAAAATGAATGAGAAAAGCTTGGAGCATATTTGATTTAGAAGATAT GTGATGTAATAGTATATGGTGTGTAAGCTGAGGTTTCATTCAATCATTGT ACGTGCTCATGTGAAAGTAGTGGAGAAATTTTTTctgcattttgtttttt actttcATTCATTAGTTTGTTTACTACTGTACTATCAATTTGGACGCAAA CAAATTACGTAATGATTGACAAAGTGTCATCACTTATGATGgtacataaa aatattgatgatgaatgtcaattttcatttaaatcATGAAGAGATGCTTT TTTAGCCTTGTTTGCTTGTCGAAAATTATCTAATGTGATACCACGCAACA AGCACTCAGCTCGCTTTTATGgacaaaatcttcaaaacgGGAAATTTTTG GCATGTATTAAAAGTTCAATACAACAACAAAAGACcctcaaatttgaaat taatcAATCCTCGTTTGTcttgaattttgacgttcagTTTGTAACCACCA TCCAACATTGGTAGCAAGTCATGTACTTTGATGCACGTAAATAGCCTATG ATCTTTGTCACAagatgttgaaattttttaaattttctcttaTCTTGCGT ACCTTGCTACTTTCTTTTATCTTTCATCCTCCCGAATAGATCCACTGTTA ATTTCACCCTCCCCCTTCCCCTGTTCTCTTACTGTAAAGACCTTAAAGAC CCATCCCCTTGTTAGAGCTTAGAAGTTTTTTCCACTGGAAGACAAATATT ACTCAGACATGGTACGATGTGTGAACTTCTTTTCATTCAAATGAGAATAA GATGTCCAATTCTTTTCTCGAAAGTGAATAATGTGCCTGTCTAGGGGAAc ggttttaaaagattttcgtGTGAGCTTTTTCAGACGTCTGGGTTTCGTTC GTGCACCCAGTTTGATATCCGCCTTCATTGGGTTGAATGGCTTGTTCGTG ACCAGACATTTTAATGCGGGTTTCAGCACACGCCACTGGGTCCTTGTGTA ACAATATGTAACTTTTTAactctttttcttctttcatttccTTCTTAAAA CCCTTCATATCGTCTGAAATTCACCATAAACACGTTGTTTCATTGTAACT CGTCCGAATTTCCGActcttgactatcatgcttagAAATATTGCTCTATC CTTAATATGATGATAAAGTTTCTACTTTTCTaaactatgctatagtctaa gacgaattcgaaaaataaagaataacctCAAACACACAAATTAGCAGTTG GGCGGAAATTTTGTCCNttcatcggactttttccttttatttcgttgttt tttcacacaaaaacattattgatagcaatgcccaccatgaagcatggttc aatcgtcaatagaacttttttttttatacccGAATAACGataattatttt aactaaacaCAAAAGAAGATATATACAATTAAATTTTCCTGGGTAATACT TTTATATATGTTgcactatttaaaaaaaacaaacccaaAAAGTGGGCcac acacacaaaaaacaacctGAAAAGACCAGAACGACAAGAAACTGAAAAGA CTCgaaagataaaaagtaaaataataatctataaaatgttttctgGGGTG AATATTTTTCCCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TATCGAATACGTATAGCGTCCCAGAACTCTTGTTTTGATAGTTCGTAACC TTCGTCTTTGATCGGAAGCACCGTCAGCCAGTTTGAAACCCCCTTTTGGT TGAGGGTTTCCATCTTTCGTTTGGTCGATTCATCGGATTCGTTCAGAAGT TGTTGAAGTTTACCTTGATCTCGTAGATCTCGTTCTTTGCGAAGCTGACT TCTGGTCTTTTGATTCTCGTCATTCGAACCCAGAATCTGATTTTGAAGAG TTGTTGTGGCGTTCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNttttttcacttaaaaaaattattgataacaatgc caccatcaagcatgattcaattgtcaataaaacttttgcaattttgcaac cagaactttctatttctttttttccctaaacccctctgcccatcaacaat caatgatgacatttaatgcattttcgctaagcgctatattttcttaatga ttgcttttctccttattgctatctaagtttcatcatcaggtaggtccatt cagcatgttgcttgtttagcCTTGATTGCTTGTCGAAAATTATCTAATGT GATACCACGCAACAAGCACTCAGCTCGCTTTTATGgacaaaatcttcaaa acgGGAAATTTTTTGCATGTATTAAAAGTTCAATACAACAAAAGACcctc aaatttaaaattaatcaaTGCTCGTTTGTCTTGAATTTTGACGTTCTGTA ACCACCATCCAACATAGGTAGCAAGTCATGTACTTTGATGCACGTAAATA GCCTATCATCTTTGTCACAagatgttgaaattttttaaattttctcttaT GTCTCAAACCTTGCTCCTTTCTTTTATCTTTCATCCTCCCGAATAGATCC ACTGTTAATTTCACCCTCCCCCTTCCCCTGTTCTCTTACTGTACAAACCT TAAAGACCCATCCCCTTGTTAGAGCTCAGAAGTTTTTTCCACTGGAAGAC AAATATTACTCAGACATGGTACGATGTGTGAACTTCTTTTCATTCAAATG AGAATAAGATGtccaatttttttctcgaaagtgAATAATGTGCCTGTCTA GGGGAacgattttaaaagattttcgtGTGAGCTTTTTCAGACGTCTGGGT TTCGTTCGTGCACCCAGTTTGATATCCGCCTTCATTGGGTTGAATGACTT GTTCGTGACCAGACATTTTAATGCGGGTTTCAGCACACGCCACTGGGTCC TTGTGTAACAATATGTAACTTTTTAactctttttcttctttaatttcCTT CTTAAAACCCTTCATATCGTCTGAAATTCACCATAAACACGTTGTTTCAT TGTAACTCGTCCGAATTTCCGActcttgactatcatgcttagAAATATTG CTCTATCCTTAATATGATGATAAAGTTTCTACTTTTCTaaactatgctat agtctaagacgaattcgaaaaataaagaataacctCAAACACACAAATTA GCAGTTGGGCGGAAATTTTGTCCGCGCGGGCGAAAAATAGTCGGAGGGGC TCAATGTCTTGTCAGATCAATGTAAACACAGGCTCTATTTTCCGCCgcgc aacatattacgttttataatatacaactaTATCGTAATATCATAATGATA TATTACACGGTCGATAGCATCGTCTGCTACTTTTCATGCTTCAACGCGTA GTCTTTTGAACCAGGTTCCTGTGTCTAGTAAACAACCCCTTTAAAGACAC ACTTAAAGCTCTTCATAACATCATTCAAACGATTTAGGAAGATGACCAAA ATTGAATCTTCCAAGTACCATCAATGGATcatgaaaaaacatttcttgtg TGACGCAAAGAttattaagaacatccgagtTTCACCAACCTTATTGCAAA AGATTCGTCCACATGTTTAAGACGTCCCCGCCTGAACCTATGACTATTTA CAACGTTAAAAAAAACTAGTTTATTAAAAGACTCAAGCGGCAGacgacaa aatatttttccaacagTCTATTTCCATATGTTTCACTTTGTAAATTGCGT CTTAATAAAGAATTAGTCAGATTTAAGCAATCAAGTGCCACTTACATCTT ACGGAATCGGTCGAATAATTCTGCTTAGAATCTGAATAGTACAGTTGTAA CATTGGTAAAATAGAAAGTGAGAAATTGGGAGGAGTTTTCGTGATATTAG GGTGTTTTCGTGATATTAGGGTGTTTTGAGTTGGTTTCTTCAACCCGTAG AGGGAATTGAATCGCATACACACGGTGGTATCAATTTTGACCAAGTGCTA ACTCTTATGTACATAAGCTATATCTAAGCTGTAAAGAGATAATTAGATTT ATAGCTAGATAGTTAGGTACTTTTTAGATTGTTGTTGCAGGTCAACGGCC AGCCAGAACATTGAAAGGAGCAAGGATTCGAATAGGGGGGCCCTTTAGTG TCCCGCTGATgtcttagaccactcggccattgctcCTAAACCTGCACATA GCATTTAGTAATTGTATCTTTTTCTACTAGGTGTGGGTGAGTAAGACGGA TGGAGTGAAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATG TAATCAGTCGCGGTCTACCCACGGTCGATGAAATTATCTGAGAAGTACGT CTACGCCTGGATATCCGCCTTCTCACCGCCTTTGTTTAAAATGGTATGAT ATGCATAttctttattatttattttttaatgtacttattttttagatata tttcattttcaacaaTGTAGGATTTTTATGATTATGATTTATTAGAGACC TTATCAATGTAAATATTTAGCCTCACTctgacatttttattttaaaagat gCGAATACCCGGGGAATCGGAGTTTTTTACCTTTACATAGCGCACGACTA TCctttttgattgatttcattTGTGCATGAGAAAAAACCATACTTTATTT GTAAGTTTTGTAAGTATCGATGCAACTTTCGGGCGCTTGAAAATAATAAT ACAGTCAAATttgaattcttattttttttctattgaaaaaatatgaaaaa taatattaacagaagaaacaaaaattatttggttcaattttgTGAATGAG AAGAAGTGCTCTTCCAATCAGTTAAATGAAAAATGTCGAACACTTTTTTG CTCGCTTTGCCAAAGCGTTTTAAGGAGCCCCTTTGATTTGAAGGataatc tgagcctcagatctAAGCAATTACTATCCGGTAACTAATTATATatcgtt gaaaagatagtaCAGAGCACTACATCCTttgacaaaaatactttaaaagt atttaaaaaaaggaatattTGAGGCTAAAATGTTTTCTTACTACAACCTC AGATTGATGACATTGTAGAAATCACAGAGTCGTAgagacatttttgtgaa agcttATTGGGCTTTACTGAGGTATAGCTGGCAATTTACAGGTTAAAACG TCCTTAAAATgtcattcttaggttcagttgttATATTCCgtgatggtgat atttttagcattctcttaattttttggccaatttcatcatgaatattttt ataaagtatatcATTCTAAAATTAGCGTGTAATGGTACAGAGTTTACAAC TGGAAAAGAATACGTAAAGAAAAGTGCCAAAGTAAAGAGTTCTCGGGATG TACCGGCTGGCAAATTTTTCGCAACCTGAGAAAtctttttcttagatagt gatttgcaCTCCACTGTACCTTAGTCTAGGTCAAATGTCGATTTCCAGAC GAGAGAGGCTTTTCGGCTCACACAACTTTCTCATGTTTCAAAGCTGTTGT TGATTtaataatatatttttaggaACATTTTGTCAGCTAAGGCACTTATT CACAAGTGGCTGCTTCACAGACAAATTTTGAAGTGGTTTTTTTTTACAAC TAAGAAACTTTTATGTTTGATTTGCCGGCTTTTGGTGATGTATTTTTCTA GTAATAGCTTTTACGTCTCATGTGATATTTTCTCAGCTCTAGATAAGTTT GCCCGATTACCTTTTCCTCCGAGAAAGAAATTTCACACTATTTGGCTATC TTTCCAAAAGTACGCTCTACATTCAAATGataaaatttctgataaaaata caaattaaagtatgtctcaatataatttgcagcggagacaaaaaaggtta taacttttgatagaattcaaatTATATAGCGGtcttgtgctcgttaaaaa gataatccggagtggaatattttaatattattaaaaaagaaaaaaaacga agaagaagaaaatcaatttcttgtagaataatgccgtgatcttcattttt atatcagaaattctttaatcttagaACGTTATAaatgcgagaaaaaaaat caaaaaatattcatt

Coding sequence (CDS) from alignment at scaffold_92:188217..220131+

>TCONS_00073448 ID=TCONS_00073448|Name=TCONS_00073448|organism=Clytia hemisphaerica|type=CDS|length=16920bp|location=Sequence derived from alignment at scaffold_92:188217..220131+ (Clytia hemisphaerica)
ATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGATGCTGG
AAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGATTGATCA
GCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGAACAGCA
AAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAATGATGATGGAAG
TGAGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGATTCTGATT
CTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTAACCGAC
ATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTTGTACAA
GGAACAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAACTCCAGTG
AAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAATGCATC
ATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACTATCAATTT
GGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGA
ATCAAGAACGACAAGTGTACGATACGATTGCAAGTGATTTTGAAGACAAA
TTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTACTCTGGCAA
TACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTA
ACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCTGCCACT
GTTACAGGTCCCTACGTTATCTACATGTTAAACGAAATGGATATCCTCGA
AGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAG
CGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATTACAGCCCGTTAC
GAAGATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAAGGTGACAG
CGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCACCATTGCTG
GCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTGAAATGC
AAATTATACATCGCCCAATTCCAAAAAGGTAAATATGTAATCAGTCGCGG
TCTACCCACGGTCGATGAAATTATCTGAATGATAGATGAAGATAGCAATT
TGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTGATGAGGGTGGTAAC
ACAATAGAAATATCTGCTAGATTGATCAGCAATAAAAATCAAGATTCAGA
AAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGAAGATGAACATGAAG
AAGGCTCAGATGATAATGATGATGGAAGTGAGGACGACGATGACGATGAC
GAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGCGAAGAAGAAGCAGA
GACAAGGAAAACACAATATGTAACCGACATGAGTGATCTGGAAAAACAGT
TCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAATATCACAAATTGAA
TCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGAGTACACTGGACC
ATTAAAGCAAATTGAACAAGAATGCATCATAAGAACTGAAGTTGCTTGGC
AATTGAAGCATTATAGGACTATCAATTTGGAAAACAAACTTCAATGTGAG
CTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAACGACAAGTGTACGA
TACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAGAAGAAGAGA
GACATACCTCAGAAATGTACTCTGGCAATACGCAAGATCTTTGGTGTGAG
GACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAAATACATGT
TCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGGTCCCTACGTTATCT
ACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCAATAAGGAAA
GCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACTGTCGTCACAAGA
CCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAAAATTCTTCTACG
AAAATGAATGgttccAGAAAGGTGACAGCGTGGTATTAGATAATCGAATC
GATTCTCCTGTGCAAGTCACCATTGCTGGCATCAACACAGGCGAAGTGTG
GGTGAGTAAGACGGATGGAGTGAAATGCAAATTATACATCGCCCAATTCC
AAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCACGGTCGATGAAATT
ATCTGAATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGA
TGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGAT
TGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGA
ACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAATGATGA
TGGAAGTGAGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGATT
CTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTA
ACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTT
GTACAAGGAACAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAACT
CCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAA
TGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACTAT
CAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATT
TTCAGAATCAAGAACGACAAGTGTACGATACGATTGCAAGTGATTTTGAA
GACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTACTC
TGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGA
AGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCT
GCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAAATGGATAT
CCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAA
GAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATTACAGCC
CGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAAGG
TGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCACCA
TTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTG
AAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATGTAATCAG
TCGCGGTCTACCCACGGTCGATGAAATTATCTGAATGATAGATGAAGATA
GCAATTTGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTGATGAGGGT
GGTAACACAATAGAAATATCTGCTAGATTGATCAGCAATAAAAATCAAGA
TTCAGAAAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGAAGATGAAC
ATGAAGAAGGCTCAGATGATAATGATGATGGAAGTGAGGACGACGATGAC
GATGACGAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGCGAAGAAGA
AGCAGAGACAAGGAAAACACAATATGTAACCGACATGAGTGATCTGGAAA
AACAGTTCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAATATCACAA
ATTGAATCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGAGTACAC
TGGACCATTAAAGCAAATTGAACAAGAATGCATCATAAGAACTGAAGTTG
CTTGGCAATTGAAGCATTATAGGACTATCAATTTGGAAAACAAACTTCAA
TGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAACGACAAGT
GTACGATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAGAAG
AAGAGAGACATACCTCAGAAATGTACTCTGGCAATACGCAAGATCTTTGG
TGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAAAT
ACATGTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGGTCCCTACG
TTATCTACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCAATA
AGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACTGTCGTC
ACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAAAATTCT
TCTACGAAAATGAATGgttccAGAAAGGTGACAGCGTGGTATTAGATAAT
CGAATCGATTCTCCTGTGCAAGTCACCATTGCTGGCATCAACACAGGCGA
AGTGTGGGTGAGTAAGACGGATGGAGTGAAATGCAAATTATACATCGCCC
AATTCCAAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCACGGTCGAT
GAAATTATCTGAATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAA
AGATGATGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTG
CTAGATTGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAAT
GAAGGAACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAA
TGATGATGGAAGTGAGGACGACGATGACGATGACGAAGATGAAGATTCTG
AGGATTCTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAA
TATGTAACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGA
ACAGTTGTACAAGGAACAAATATCACAAATTGAATCTCAACTGAAAGAAG
TCAACTCCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAA
CAAGAATGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAG
GACTATCAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGC
AACATTTTCAGAATCAAGAACGACAAGTGTACGATACGATTGCAAGTGAT
TTTGAAGACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAAT
GTACTCTGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTC
GAAAGAAGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAG
AAGCCTGCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAAAT
GGATATCCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAG
CAAGAAGAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATT
ACAGCCCGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttccA
GAAAGGTGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAG
TCACCATTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGAT
GGAGTGAAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATGT
AATCAGTCGCGGTCTACCCACGGTCGATGAAATTATCTGAATGATAGATG
AAGATAGCAATTTGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTGAT
GAGGGTGGTAACACAATAGAAATATCTGCTAGATTGATCAGCAATAAAAA
TCAAGATTCAGAAAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGAAG
ATGAACATGAAGAAGGCTCAGATGATAATGATGATGGAAGTGAGGACGAC
GATGACGATGACGAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGCGA
AGAAGAAGCAGAGACAAGGAAAACACAATATGTAACCGACATGAGTGATC
TGGAAAAACAGTTCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAATA
TCACAAATTGAATCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGA
GTACACTGGACCATTAAAGCAAATTGAACAAGAATGCATCATAAGAACTG
AAGTTGCTTGGCAATTGAAGCATTATAGGACTATCAATTTGGAAAACAAA
CTTCAATGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAACG
ACAAGTGTACGATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAG
TAGAAGAAGAGAGACATACCTCAGAAATGTACTCTGGCAATACGCAAGAT
CTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAAT
GGAAATACATGTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGGTC
CCTACGTTATCTACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCT
GCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACT
GTCGTCACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAA
AATTCTTCTACGAAAATGAATGgttccAGAAAGGTGACAGCGTGGTATTA
GATAATCGAATCGATTCTCCTGTGCAAGTCACCATTGCTGGCATCAACAC
AGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTGAAATGCAAATTATACA
TCGCCCAATTCCAAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCACG
GTCGATGAAATTATCTGAATGATAGATGAAGATAGCAATTTGACAGAACC
TGAGAAAGATGATGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAA
TATCTGCTAGATTGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGAT
GAGAATGAAGGAACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGA
TGATAATGATGATGGAAGTGAGGACGACGATGACGATGACGAAGATGAAG
ATTCTGAGGATTCTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAA
ACACAATATGTAACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTT
AAAAGAACAGTTGTACAAGGAACAAATATCACAAATTGAATCTCAACTGA
AAGAAGTCAACTCCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAA
ATTGAACAAGAATGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCA
TTATAGGACTATCAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTG
CCGAGCAACATTTTCAGAATCAAGAACGACAAGTGTACGATACGATTGCA
AGTGATTTTGAAGACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTC
AGAAATGTACTCTGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCC
GTAGTCGAAAGAAGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAA
CGAAAGAAGCCTGCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAA
CGAAATGGATATCCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTG
AATTAGCAAGAAGAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCA
CTCATTACAGCCCGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATG
gttccAGAAAGGTGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTG
TGCAAGTCACCATTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAG
ACGGATGGAGTGAAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAA
ATATGTAATCAGTCGCGGTCTACCCACGGTCGATGAAATTATCTGAATGA
TAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGATGCTGGAAGC
TGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGATTGATCAGCAA
TAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGAACAGCAAAAG
ATGAAGATGAACATGAAGAAGGCTCAGATGATAATGATGATGGAAGTGAG
GACGACGATGACGATGACGAAGATGAAGATTCTGAGGATTCTGATTCTCT
GGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTAACCGACATGA
GTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTTGTACAAGGAA
CAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAACTCCAGTGAAGC
TAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAATGCATCATAA
GAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACTATCAATTTGGAA
AACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGAATCA
AGAACGACAAGTGTACGATACGATTGCAAGTGATTTTGAAGACAAATTGA
AGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTACTCTGGCAATACG
CAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTAACAA
AGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTA
CAGGTCCCTACGTTATCTACATGTTAAACGAAATGGATATCCTCGAAGAC
TGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCT
TGaACTGTCGTCACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAG
ATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAAGGTGACAGCGTG
GTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCACCATTGCTGGCAT
CAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTGAAATGCAAAT
TATACATCGCCCAATTCCAAAAAGGTAAATATGTAATCAGTCGCGGTCTA
CCCACGGTCGATGAAATTATCTGAATGATAGATGAAGATAGCAATTTGAC
AGAACCTGAGAAAGATGATGCTGGAAGCTGTGATGAGGGTGGTAACACAA
TAGAAATATCTGCTAGATTGATCAGCAATAAAAATCAAGATTCAGAAAAA
GAGGATGAGAATGAAGGAACAGCAAAAGATGAAGATGAACATGAAGAAGG
CTCAGATGATAATGATGATGGAAGTGAGGACGACGATGACGATGACGAAG
ATGAAGATTCTGAGGATTCTGATTCTCTGGGCGAAGAAGAAGCAGAGACA
AGGAAAACACAATATGTAACCGACATGAGTGATCTGGAAAAACAGTTCTC
CGACTTAAAAGAACAGTTGTACAAGGAACAAATATCACAAATTGAATCTC
AACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGAGTACACTGGACCATTA
AAGCAAATTGAACAAGAATGCATCATAAGAACTGAAGTTGCTTGGCAATT
GAAGCATTATAGGACTATCAATTTGGAAAACAAACTTCAATGTGAGCTCC
AAGCTGCCGAGCAACATTTTCAGAATCAAGAACGACAAGTGTACGATACG
ATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAGAAGAAGAGAGACA
TACCTCAGAAATGTACTCTGGCAATACGCAAGATCTTTGGTGTGAGGACA
CTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAAATACATGTTCCA
GAGAAACGAAAGAAGCCTGCCACTGTTACAGGTCCCTACGTTATCTACAT
GTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCAATAAGGAAAGCCA
AAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACTGTCGTCACAAGACCGC
GATCCACTCATTACAGCCCGTTACGAAGATGGAAAATTCTTCTACGAAAA
TGAATGgttccAGAAAGGTGACAGCGTGGTATTAGATAATCGAATCGATT
CTCCTGTGCAAGTCACCATTGCTGGCATCAACACAGGCGAAGTGTGGGTG
AGTAAGACGGATGGAGTGAAATGCAAATTATACATCGCCCAATTCCAAAA
AGGTAAATATGTAATCAGTCGCGGTCTACCCACGGTCGATGAAATTATCT
GAATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGATGATGCT
GGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAGATTGAT
CAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGAACAG
CAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAATGATGATGGA
AGTGAGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGATTCTGA
TTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATGTAACCG
ACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTTGTAC
AAGGAACAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAACTCCAG
TGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAGAATGCA
TCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACTATCAAT
TTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATTTTCA
GAATCAAGAACGACAAGTGTACGATACGATTGCAAGTGATTTTGAAGACA
AATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTACTCTGGC
AATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCG
TAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCTGCCA
CTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAAATGGATATCCTC
GAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAA
AGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATTACAGCCCGTT
ACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAAGGTGAC
AGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCACCATTGC
TGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTGAAAT
GCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATGTAATCAGTCGC
GGTCTACCCACGGTCGATGAAATTATCTGAATGATAGATGAAGATAGCAA
TTTGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTGATGAGGGTGGTA
ACACAATAGAAATATCTGCTAGATTGATCAGCAATAAAAATCAAGATTCA
GAAAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGAAGATGAACATGA
AGAAGGCTCAGATGATAATGATGATGGAAGTGAGGACGACGATGACGATG
ACGAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGCGAAGAAGAAGCA
GAGACAAGGAAAACACAATATGTAACCGACATGAGTGATCTGGAAAAACA
GTTCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAATATCACAAATTG
AATCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGAGTACACTGGA
CCATTAAAGCAAATTGAACAAGAATGCATCATAAGAACTGAAGTTGCTTG
GCAATTGAAGCATTATAGGACTATCAATTTGGAAAACAAACTTCAATGTG
AGCTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAACGACAAGTGTAC
GATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAGAAGAAGA
GAGACATACCTCAGAAATGTACTCTGGCAATACGCAAGATCTTTGGTGTG
AGGACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAAATACAT
GTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGGTCCCTACGTTAT
CTACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCAATAAGGA
AAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACTGTCGTCACAA
GACCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAAAATTCTTCTA
CGAAAATGAATGgttccAGAAAGGTGACAGCGTGGTATTAGATAATCGAA
TCGATTCTCCTGTGCAAGTCACCATTGCTGGCATCAACACAGGCGAAGTG
TGGGTGAGTAAGACGGATGGAGTGAAATGCAAATTATACATCGCCCAATT
CCAAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCACGGTCGATGAAA
TTATCTGAATGATAGATGAAGATAGCAATTTGACAGAACCTGAGAAAGAT
GATGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATCTGCTAG
ATTGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGAATGAAG
GAACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGATAATGAT
GATGGAAGTGAGGACGACGATGACGATGACGAAGATGAAGATTCTGAGGA
TTCTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACACAATATG
TAACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAAGAACAG
TTGTACAAGGAACAAATATCACAAATTGAATCTCAACTGAAAGAAGTCAA
CTCCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTGAACAAG
AATGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTATAGGACT
ATCAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGAGCAACA
TTTTCAGAATCAAGAACGACAAGTGTACGATACGATTGCAAGTGATTTTG
AAGACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAAATGTAC
TCTGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAA
GAAGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAAAGAAGC
CTGCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAAATGGAT
ATCCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAG
AAGAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCATTACAG
CCCGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttccAGAAA
GGTGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCAAGTCAC
CATTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAG
TGAAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATATGTAATC
AGTCGCGGTCTACCCACGGTCGATGAAATTATCTGAATGATAGATGAAGA
TAGCAATTTGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTGATGAGG
GTGGTAACACAATAGAAATATCTGCTAGATTGATCAGCAATAAAAATCAA
GATTCAGAAAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGAAGATGA
ACATGAAGAAGGCTCAGATGATAATGATGATGGAAGTGAGGACGACGATG
ACGATGACGAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGCGAAGAA
GAAGCAGAGACAAGGAAAACACAATATGTAACCGACATGAGTGATCTGGA
AAAACAGTTCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAATATCAC
AAATTGAATCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAAGAGTAC
ACTGGACCATTAAAGCAAATTGAACAAGAATGCATCATAAGAACTGAAGT
TGCTTGGCAATTGAAGCATTATAGGACTATCAATTTGGAAAACAAACTTC
AATGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAACGACAA
GTGTACGATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAAAGTAGA
AGAAGAGAGACATACCTCAGAAATGTACTCTGGCAATACGCAAGATCTTT
GGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGAATGGAA
ATACATGTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGGTCCCTA
CGTTATCTACATGTTAAACGAAATGGATATCCTCGAAGACTGGGCTGCAA
TAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaACTGTCG
TCACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAGATGGAAAATT
CTTCTACGAAAATGAATGgttccAGAAAGGTGACAGCGTGGTATTAGATA
ATCGAATCGATTCTCCTGTGCAAGTCACCATTGCTGGCATCAACACAGGC
GAAGTGTGGGTGAGTAAGACGGATGGAGTGAAATGCAAATTATACATCGC
CCAATTCCAAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCACGGTCG
ATGAAATTATCTGAATGATAGATGAAGATAGCAATTTGACAGAACCTGAG
AAAGATGATGCTGGAAGCTGTGATGAGGGTGGTAACACAATAGAAATATC
TGCTAGATTGATCAGCAATAAAAATCAAGATTCAGAAAAAGAGGATGAGA
ATGAAGGAACAGCAAAAGATGAAGATGAACATGAAGAAGGCTCAGATGAT
AATGATGATGGAAGTGAGGACGACGATGACGATGACGAAGATGAAGATTC
TGAGGATTCTGATTCTCTGGGCGAAGAAGAAGCAGAGACAAGGAAAACAC
AATATGTAACCGACATGAGTGATCTGGAAAAACAGTTCTCCGACTTAAAA
GAACAGTTGTACAAGGAACAAATATCACAAATTGAATCTCAACTGAAAGA
AGTCAACTCCAGTGAAGCTAAAGAGTACACTGGACCATTAAAGCAAATTG
AACAAGAATGCATCATAAGAACTGAAGTTGCTTGGCAATTGAAGCATTAT
AGGACTATCAATTTGGAAAACAAACTTCAATGTGAGCTCCAAGCTGCCGA
GCAACATTTTCAGAATCAAGAACGACAAGTGTACGATACGATTGCAAGTG
ATTTTGAAGACAAATTGAAGAAAGTAGAAGAAGAGAGACATACCTCAGAA
ATGTACTCTGGCAATACGCAAGATCTTTGGTGTGAGGACACTTTCCGTAG
TCGAAAGAAGCGTAACAAAGGAATGGAAATACATGTTCCAGAGAAACGAA
AGAAGCCTGCCACTGTTACAGGTCCCTACGTTATCTACATGTTAAACGAA
ATGGATATCCTCGAAGACTGGGCTGCAATAAGGAAAGCCAAAAGTGAATT
AGCAAGAAGAAAAGCGCTTGaACTGTCGTCACAAGACCGCGATCCACTCA
TTACAGCCCGTTACGAAGATGGAAAATTCTTCTACGAAAATGAATGgttc
cAGAAAGGTGACAGCGTGGTATTAGATAATCGAATCGATTCTCCTGTGCA
AGTCACCATTGCTGGCATCAACACAGGCGAAGTGTGGGTGAGTAAGACGG
ATGGAGTGAAATGCAAATTATACATCGCCCAATTCCAAAAAGGTAAATAT
GTAATCAGTCGCGGTCTACCCACGGTCGATGAAATTATCTGAATGATAGA
TGAAGATAGCAATTTGACAGAACCTGAGAAAGATGATGCTGGAAGCTGTG
ATGAGGGTGGTAACACAATAGAAATATCTGCTAGATTGATCAGCAATAAA
AATCAAGATTCAGAAAAAGAGGATGAGAATGAAGGAACAGCAAAAGATGA
AGATGAACATGAAGAAGGCTCAGATGATAATGATGATGGAAGTGAGGACG
ACGATGACGATGACGAAGATGAAGATTCTGAGGATTCTGATTCTCTGGGC
GAAGAAGAAGCAGAGACAAGGAAAACACAATATGTAACCGACATGAGTGA
TCTGGAAAAACAGTTCTCCGACTTAAAAGAACAGTTGTACAAGGAACAAA
TATCACAAATTGAATCTCAACTGAAAGAAGTCAACTCCAGTGAAGCTAAA
GAGTACACTGGACCATTAAAGCAAATTGAACAAGAATGCATCATAAGAAC
TGAAGTTGCTTGGCAATTGAAGCATTATAGGACTATCAATTTGGAAAACA
AACTTCAATGTGAGCTCCAAGCTGCCGAGCAACATTTTCAGAATCAAGAA
CGACAAGTGTACGATACGATTGCAAGTGATTTTGAAGACAAATTGAAGAA
AGTAGAAGAAGAGAGACATACCTCAGAAATGTACTCTGGCAATACGCAAG
ATCTTTGGTGTGAGGACACTTTCCGTAGTCGAAAGAAGCGTAACAAAGGA
ATGGAAATACATGTTCCAGAGAAACGAAAGAAGCCTGCCACTGTTACAGG
TCCCTACGTTATCTACATGTTAAACGAAATGGATATCCTCGAAGACTGGG
CTGCAATAAGGAAAGCCAAAAGTGAATTAGCAAGAAGAAAAGCGCTTGaA
CTGTCGTCACAAGACCGCGATCCACTCATTACAGCCCGTTACGAAGATGG
AAAATTCTTCTACGAAAATGAATGgttccAGAAAGGTGACAGCGTGGTAT
TAGATAATCGAATCGATTCTCCTGTGCAAGTCACCATTGCTGGCATCAAC
ACAGGCGAAGTGTGGGTGAGTAAGACGGATGGAGTGAAATGCAAATTATA
CATCGCCCAATTCCAAAAAGGTAAATATGTAATCAGTCGCGGTCTACCCA
CGGTCGATGAAATTATCTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045586XLOC_045586Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073448-proteinTCONS_00073448-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073448-exon-scaffold_92-1491911889:188217..188414TCONS_00073448-exon-scaffold_92-1491911889:188217..188414Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:188217..188414TCONS_00073448-exon-scaffold_92-1510915933:188217..188414Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:188217..188414TCONS_00073448-exon-scaffold_92-1575043694:188217..188414Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:188651..188668TCONS_00073448-exon-scaffold_92-1491911889:188651..188668Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:188651..188668TCONS_00073448-exon-scaffold_92-1510915933:188651..188668Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:188651..188668TCONS_00073448-exon-scaffold_92-1575043694:188651..188668Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:188725..188817TCONS_00073448-exon-scaffold_92-1491911889:188725..188817Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:188725..188817TCONS_00073448-exon-scaffold_92-1510915933:188725..188817Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:188725..188817TCONS_00073448-exon-scaffold_92-1575043694:188725..188817Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:190525..190612TCONS_00073448-exon-scaffold_92-1491911889:190525..190612Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:190525..190612TCONS_00073448-exon-scaffold_92-1510915933:190525..190612Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:190525..190612TCONS_00073448-exon-scaffold_92-1575043694:190525..190612Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:191231..191286TCONS_00073448-exon-scaffold_92-1491911889:191231..191286Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:191231..191286TCONS_00073448-exon-scaffold_92-1510915933:191231..191286Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:191231..191286TCONS_00073448-exon-scaffold_92-1575043694:191231..191286Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:192917..192988TCONS_00073448-exon-scaffold_92-1491911889:192917..192988Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:192917..192988TCONS_00073448-exon-scaffold_92-1510915933:192917..192988Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:192917..192988TCONS_00073448-exon-scaffold_92-1575043694:192917..192988Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:193142..193161TCONS_00073448-exon-scaffold_92-1491911889:193142..193161Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:193142..193161TCONS_00073448-exon-scaffold_92-1510915933:193142..193161Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:193142..193161TCONS_00073448-exon-scaffold_92-1575043694:193142..193161Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:193717..193776TCONS_00073448-exon-scaffold_92-1491911889:193717..193776Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:193717..193776TCONS_00073448-exon-scaffold_92-1510915933:193717..193776Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:193717..193776TCONS_00073448-exon-scaffold_92-1575043694:193717..193776Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:194753..194861TCONS_00073448-exon-scaffold_92-1491911889:194753..194861Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:194753..194861TCONS_00073448-exon-scaffold_92-1510915933:194753..194861Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:194753..194861TCONS_00073448-exon-scaffold_92-1575043694:194753..194861Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:195346..195444TCONS_00073448-exon-scaffold_92-1491911889:195346..195444Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:195346..195444TCONS_00073448-exon-scaffold_92-1510915933:195346..195444Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:195346..195444TCONS_00073448-exon-scaffold_92-1575043694:195346..195444Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:202111..202209TCONS_00073448-exon-scaffold_92-1491911889:202111..202209Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:202111..202209TCONS_00073448-exon-scaffold_92-1510915933:202111..202209Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:202111..202209TCONS_00073448-exon-scaffold_92-1575043694:202111..202209Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:209112..209187TCONS_00073448-exon-scaffold_92-1491911889:209112..209187Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:209112..209187TCONS_00073448-exon-scaffold_92-1510915933:209112..209187Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:209112..209187TCONS_00073448-exon-scaffold_92-1575043694:209112..209187Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:210642..210695TCONS_00073448-exon-scaffold_92-1491911889:210642..210695Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:210642..210695TCONS_00073448-exon-scaffold_92-1510915933:210642..210695Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:210642..210695TCONS_00073448-exon-scaffold_92-1575043694:210642..210695Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:211276..211306TCONS_00073448-exon-scaffold_92-1491911889:211276..211306Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:211276..211306TCONS_00073448-exon-scaffold_92-1510915933:211276..211306Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:211276..211306TCONS_00073448-exon-scaffold_92-1575043694:211276..211306Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1491911889:218297..220131TCONS_00073448-exon-scaffold_92-1491911889:218297..220131Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1510915933:218297..220131TCONS_00073448-exon-scaffold_92-1510915933:218297..220131Clytia hemisphaericaexon
TCONS_00073448-exon-scaffold_92-1575043694:218297..220131TCONS_00073448-exon-scaffold_92-1575043694:218297..220131Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:188217..220131 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
28.5899 26.6747 13.9604 12.7267 42.9949 30.6396 37.1288 39.1865 30.812 23.6857 22.4199 24.2888 12.145 12.2938 20.2502 19.1338 27.8073 28.006 11.7934 14.271 20.3986 20.3245 35.7195 32.5291 19.2861 15.8968 22.6743 20.0212 20.1775 23.0401
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013907Sds3
Blast
BLAST of TCONS_00073448 vs. Swiss-Prot (Human)
Match: BRM1L (Breast cancer metastasis-suppressor 1-like protein OS=Homo sapiens GN=BRMS1L PE=1 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 1.105e-65
Identity = 115/276 (41.67%), Postives = 182/276 (65.94%), Query Frame = 3
Query:  324 AETRKTQYVTDMSDLEKQFSDLKEQLYKEQISQIESQLKEVNSSEAKEYTGPLKQIEQECIIRTEVAWQLKHYRTINLENKLQCELQAAEQHFQNQERQVYDTIASDFEDKLKKVEEERHTSEMYSGNTQDLWCEDTFRSRKKRNKGMEIHVPEKRKKPATVTGPYVIYMLNEMDILEDWAAIRKAKSELA-RRKALELSSQDRDPLITARYEDGKFFYENEWFQKGDSVVLDNRIDSPVQVTIAGINTGEVWVSKTDGVKCKLYIAQFQKGKYVI 1148
             E R+ + + +MS+LEKQF+DLK+QLYKE++SQ++++L+EV + +A EY  PL  +++   IRT+VA   +     +++NK +CE+QA+ QH ++++  +YDT+ S+ E+K++++EE+RH+ ++    T +LW  D  +SRKKR        P+K KKP  V+GPY++YML ++DILEDW  IRKA + L   R   E   +    L +AR E+G+ +Y+ EW+ +G ++ +D + + P    I  IN  EVW  + DG K KLYI+Q QKGKY I
Sbjct:   54 CERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDI----TSELW-NDELQSRKKRKDPFS---PDK-KKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI 320          
The following BLAST results are available for this feature:
BLAST of TCONS_00073448 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BRM1L1.105e-6541.67Breast cancer metastasis-suppressor 1-like protein... [more]
back to top