Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073445 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073445
Unique NameTCONS_00073445
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1757

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073445 ID=TCONS_00073445|Name=TCONS_00073445|organism=Clytia hemisphaerica|type=transcript|length=1757bp
CAACGTTTCATTTGGCCGAAGAAAAAGTATCGTAGCATCAAGAATATGCA
AGTGACGCGGATCAAAGTTCGCGAATTGTGTCTTCTGTTGTGCCTTCTTT
CGCTATGTCTAATTATGGTGGTGCGTTATCGAGCTCCTGAGGATAAAAAA
CAGATCCGAAAGAAGAGAGCGCAACATGTTATTCCACAAGATAAACCTGT
TCCTCCTCGTTATTCAGGAAAGTTGAACTCGCCGGGCGATCTATTGATAG
ACTTAGAGAggaaaatacttttgaaaaatgaagtttcGAATGCAATTTCG
GACAGGGAGGCTGAGAACGAGAAACGGATGTCACAACTAGAGAGTAAATT
ATTTCAACGTTTGAATATCATTGAAAGCAAAGTAAACCGAAACGAAGACC
TACTTCTTGAAATTGATCGATTGTTGAaaacgaaatcgaaagtaaacgAA
CCAAAACCACCGGCAACAAAGATCAAACTCCAAACAAGAGATTTTTCTAT
CATGTACGAAATTCATAAAAAGGTTTGGAACAAATTGACTGAAAGTGAAA
TCAAAGAATTTTACAACCGTGAAAGAATATCACATTTGAAATATAACAAG
CGCATTTTAGATATTGAAAGGGATCGACATTTATTGATGGAGCTATTTCC
AGGACCCGACGAGTCGCGAGACCGAGTCACCGATCAACTTATGGTCAAAA
TTAAAGTTAACACAACTAAAACCATTTTCGTCAGTGGTTCTAATGTGAAT
AATCAAAAGAAGTTCCAAGCAGACCAGTGCAACGTTGATAAATGTTTTAT
AACAAGTAATCCCAAATATGCTTCGGTCGCAGACGCTCTTTATGTTGAAC
ATAAAATGCCATATCGATTTTTAAGAGAAAAGAATATTAATAAGAATCGG
GTCAATATGGTTTTCCAGTTAGAATCTTCAAGAAATTACCCATCTATATC
TATCTTACCCGATGGATTGAACTGGACAGCTTCTTATCGCGTCGATAGCG
TTCTGTACGCTCCTTATGAACGTTTCACGTCATTTCTAAATGTGACCGAG
CTACCCACCAAACCTAAAGAGAATTATGCCAAAGgtaaaacaaagatggc
ggcttGGTATGTTTCGAACTGTGGAGCAGCAAGTGGTCGTAAAAATTACG
TCAAAGAACTACAGAAATATATTTCAGTGGATATTTACGGACGCTGTGGT
AAACCGTGtccgaaaaataacaaaaaatgcTATGACCAATTGAACAATGA
TTACAAATTTTATTTGGCCTTCGAAAATTCAAATTGTAAAGACTATTTCA
CTGAGAAAGTCTATTGGAACGGACTTTTTTATCGTATTATCCCAGTTGTG
TTTGGAGCTCATCCTGACGAATACAAACGCATTGTCCCTCCACACAGTTA
CATTCACACCGACCAATTCGCATCGCCAAAAGAACTGGCGGAATATCTCA
TCTTTTTAGATCAACATGATGACTTATATAATCAATACTTTTTGTGGAAA
GACACTGGTAGCTTCATCAACACCAAATTCATGTGCCGTATGTGCACCAT
GGTCCACCTGGCTCCCCATTTCCCAATGTGGTATAGCGACGCAAACAATT
GGTGGAGGAGTAAAGACAATTGTGTTGATCCCACCAAAAATGGTGATGGC
GTTTCTTACGGAACGTGGCGTAACAAACCTCTCCCGAAACAACATTCAAA
CTTTGTGAAATACGGGTACAAGAGATACGGCTGATATTTTTACCTCCAAT
TGTATTT
Run BLAST on NCBI

protein sequence of TCONS_00073445-protein

>TCONS_00073445-protein ID=TCONS_00073445-protein|Name=TCONS_00073445-protein|organism=Clytia hemisphaerica|type=polypeptide|length=577bp
QRFIWPKKKYRSIKNMQVTRIKVRELCLLLCLLSLCLIMVVRYRAPEDKK
QIRKKRAQHVIPQDKPVPPRYSGKLNSPGDLLIDLERKILLKNEVSNAIS
DREAENEKRMSQLESKLFQRLNIIESKVNRNEDLLLEIDRLLKTKSKVNE
PKPPATKIKLQTRDFSIMYEIHKKVWNKLTESEIKEFYNRERISHLKYNK
RILDIERDRHLLMELFPGPDESRDRVTDQLMVKIKVNTTKTIFVSGSNVN
NQKKFQADQCNVDKCFITSNPKYASVADALYVEHKMPYRFLREKNINKNR
VNMVFQLESSRNYPSISILPDGLNWTASYRVDSVLYAPYERFTSFLNVTE
LPTKPKENYAKGKTKMAAWYVSNCGAASGRKNYVKELQKYISVDIYGRCG
KPCPKNNKKCYDQLNNDYKFYLAFENSNCKDYFTEKVYWNGLFYRIIPVV
FGAHPDEYKRIVPPHSYIHTDQFASPKELAEYLIFLDQHDDLYNQYFLWK
DTGSFINTKFMCRMCTMVHLAPHFPMWYSDANNWWRSKDNCVDPTKNGDG
VSYGTWRNKPLPKQHSNFVKYGYKRYG
Run BLAST on NCBI

transcript from alignment at scaffold_92:176401..181990+

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073445 ID=TCONS_00073445|Name=TCONS_00073445|organism=Clytia hemisphaerica|type=transcript|length=5590bp|location=Sequence derived from alignment at scaffold_92:176401..181990+ (Clytia hemisphaerica)
CAACGTTTCATTTGGCCGAAGAAAAAGTATCGTGTATGTGGAGTTTGTGA GCTTTTTGAGATTATCTCAGCGTTTAAGTTTTTTGGGCCAAGGTATAAGT TTCAAGTAGAGCAGAAAACCGTTCAACCAAAATTTGAGACATTAGATGAT TGACTATAACTTTGTGATGTTATTCGAGATCTTTATATctaaggagaaaa aaacaatgtgGTAGTAATTCGCTTTTGACGTTTTATCAGGGCTGCCACGT CTGTCAGAAATGTCTGGAATTAGGTAAAAGTCTGCAAATGTTTGGAAAGT CCGGAAAAAGTCTAAAATTGGTATACTTGTTTAGAAAAGTCTGGAATTAA CGTACATAGTTAACTTTCTGGAGATAGGAAACTTTCCTTCTGTNTAAAAT TGGTATACTTGTTTAGAAAAGTCTGGAATTAATGTACATAGTTAACTTTC TGGAGATAGGAAACTTTCATTCTGTCAGcatttgaaatttccaaaaactg GCCTTTCAAATCACCattaaagaaaaactaaaaacctTCCGAATTGATAA AATGTTTGGGTAATATTGGGTATTTTACCAAAATATCTGaaacatttttg acattttcatatAAAATATCTTGAAATATGTGGCTTTTGAGACTAAAAGT CTGGAATTTCAACTAGGCAAACCTGTAGCAACCTGTTAAAACTATTTGAc atcaaaaaagtaaaacatatAGATAAAAATTGAGGGAAAAATATTGAGTA CTTATTTTGGAATCCTTATAATTTAGAGACTGAGTGGACGGtgtgtttaa aaatctttaccggacgtgtccgagaataatttatatattgatgacgtcac aagcaaaagtgAAGAATTGATTTTGCAGAATTATAAAGTTTTATATACCA TTTAATGCATTTTTAGATCACATCagtccaaaaaaataaaaatttgaata tgaaaaatgacgtcatttttgaagaattttaaaagaatcacaATCTTAAT TTTATTGAGTTAGGTTTAGAAATCGAATATATCCGTCTAAATGTGTTCTA TATAGTCGAGtcgagctttcgaatggtataaaTCGTTTTTCGTTTTGACG ACGTTcaaatttgacattttcaggTTACCTCTAACCCCCTAAAGATTTTA GTCATAGCTCTTGaaatctagaagagctatggacCTTTATAACTTTTCAT ATAATCTTTACTCGTTGAGACTGATGCGATTTGGAATCTACTTGCCATGC gctgaaatcaaattttaagtggtggtgacgtcatcagctgacAAAACATT ACCGGACGTGTCAGTTGAATATTTTGTCGGACGCCGACTAAAATATTTAA GATCAGTTGATATACAGGAATGCAAGAAAAACCAACTCAGTATTTGTTTC AAACTCATCCAAATTTTAGAAATCATCAGCTGCCTGTCTGAAAAACGAGC CACTTTTTATAACCATTTGTGAAATAATTTGTGAGCCAGAGGCGTGTACA AATATCAAAAGGGTTAAAGGCTTGTTTTAATGATATACATAGAAAATTCT GGTCTTAAAAGGTGAATTTGTTATCAAATCCGAAGAAGAAAATATATTGA AGATATTCTTCTAACCTTCAAAGGCCAATCTACCTTATTGAACAATAAAC GAGATAAGTCAAGAGCTAATATCGCCTAcaaaaaaatgaattgaatttCG TGCTTAGTAGTAAACTTTATAGATTACTAAACTATTTTTCCCTCTCTAAC TCTTCATAACAAGAGCACCTTATTGATCTTTCAAGAAAGGGGAAGATTTT TTCTCCAATCAAATCTTGTTTCAAGACCCAAGAATCAGAAAAATAATCTT CTAATCTTTCTTCGAGTttaacttttcaaaatatttttatcgaAAAGTTT GTTTTATCTCCTCATGTGAGGAAAGAGTTTTGGACTACCCTCCAGTTAGA TGACTTTAGGGCCCCATTTTGACGTTGTTAAACTATATGACGCTTTATAG CAATGTTTTTCATGGAGATCATAACTTTCGTATAACATTTTTGTTGATTA TTTCCCTTCAGAGCATCAAGAATATGCAAGTGACGCGGATCAAAGTTCGC GAATTGTGTCTTCTGTTGTGCCTTCTTTCGCTATGTCTAATTATGGTGGT GCGTTATCGAGCTCCTGAGGATAAAAAACAGATCCGAAAGAAGAGAGCGC AACATGTTATTCCACAAGATAAACCTGTTCCTCCTCGTTATTCAGGAAAG TTGAACTCGCCGGGCGATCTATTGATAGACTTAGAGAggaaaatactttt gaaaaatgaagtttcGAATGCAATTTCGGACAGGGAGGCTGAGAACGAGA AACGGATGTCACAACTAGAGAGTAAATTATTTCAACGTTTGAATATCATT GAAAGCAAAGTAAACCGAAACGAAGACCTACTTCTTGAAATTGATCGATT GTTGAaaacgaaatcgaaagtaaacgAACCAAAACCACCGGCAACAAAGA TCAAACTCCAAACAAGAGATTTTTCTATCATGTACGAAATTCATAAAAAG GTTTGGAACAAATTGACTGAAAGTGAAATCAAAGAATTTTACAACCGTGA AAGAATATCACATTTGAAATATAACAAGCGCATTTTAGATATTGAAAGGG ATCGACATTTATTGATGGAGCTATTTCCAGGACCCGACGAGTCGCGAGAC CGAGTCACCGATCAACTTATGGTCAAAATTAAAGTTAACACAACTAAAAC CATTTTCGTCAGTGGTTCTAATGTGAATAATCAAAAGAAGTTCCAAGCAG ACCAGTGCAACGTTGATAAATGTTTTATAACAAGTAATCCCAAATATGCT TCGGTCGCAGACGCTCTTTATGTTGAACATAAAATGCCATATCGATTTTT AAGAGAAAAGAATATTAATAAGAATCGGGTCAATATGGTTTTCCAGTTAG AATCTTCAAGAAATTACCCATCTATATCTATCTTACCCGATGGATTGAAC TGGACAGCTTCTTATCGCGTCGATAGCGTTCTGTACGCTCCTTATGAACG TTTCACGTCATTTCTAAATGTGACCGAGCTACCCACCAAACCTAAAGAGA ATTATGCCAAAGgtaaaacaaagatggcggcttGGTATGTTTCGAACTGT GGAGCAGCAAGTGGTCGTAAAAATTACGTCAAAGAACTACAGAAATATAT TTCAGTGGATATTTACGGACGCTGTGGTAAACCGTGtccgaaaaataaca aaaaatgcTATGACCAATTGAACAATGATTACAAATTTTATTTGGCCTTC GAAAATTCAAATTGTAAAGACTATTTCACTGAGAAAGTCTATTGGAACGG ACTTTTGTAAGTTCAAATTTTTCGTTTTCTGTGTCGTGATACTTTAGGTG TCTGGTAAACAAGGTCATTGTGGTTGAGGGCCAGGCCTTTCTTTCttaca aataaaaaattaatgcCGGTACTGCATTGTacattaagggaagaaatttc ggcgggaatttaatttggcggatggtggaAAAAAGTAAATTTGGCGAGAA ATTATTGTCGGATTTTGGCCAAATCCACCAAATCCGCCAAGTTTTCTTTT CGCCGAATTACCTCTCTGGTAAAGTCCttaattaaattttaattatctta aattttaaattttaattaatgaagggagtggtcagaaagtatctactagg gggggtTTGGGCTGGAGGATTTCAGTTGGGgttcgaaattatttttgagg gtttagggggggggttccagaaaaaaatcctcAATGGGAAAGGGGGGTGC GAAATATTTTTGGGCAACTTAGGAGGTCAAATTCCATGACATTATTCGTA TTTCGTATTATCGTTAATTCTGTCTTCATGAAATATCATTGTGATAGCCT CACCATTTCGCGATTTCTATAATATAAGACTAAGAAAGGTAGTTTGTTAA GGGATCCCCCCCTCATACAATTTCACATGTCAGCATAGTCTAGTCGTTTT AAAAAGAGCTGAAAATACAGTGCTTTTAGCGAACAAAGTGGTcgaaaatt gcaatttttctcCTGTCgtcgcaaaccatggttgcgcctcccgggggggg gggcagccaggcaaattgaccgacgggtatgtgcggcggctaagggtcta tttttcaagatagcagaaatgcactgtaagggtagactTTTTGTTatatg cactgtaagggtggaaattttagtaaatcaaggaaaaattaagatttttt gcccaaaaagtctgatttttttgctctaaaagggttgaaaatttgaagaa aatgcactgtaagggtatgaatttgaCGGAATTTCGCCgattttttgctg cactgtaagggtgcgattttaaaagccaattttttcgccgcacataccgt cagttggcaaacccagtgccccccccccgggttgcGCCTTCTTAATCTTT GATATTACTCCTGTTATATTAAGGTATTGTATATGCAAAGAAATAATCTT TACTTTTAAATTCCATATGGGCAAAATTAAtctcgtcggcgcaaaccatg gttgcgcctcttTCGTCACTAAATTNcagttgaaaacaaaaataaacgaG GCAAAGTGGGCCTACTAATTGCGAGGGTGTCGAATACCACGTGATCAATA AACCATGTTTGCGCCCCCTTCGTCACTAAATTCTTTGCCCCTGCACGTTT GAAATCAAGCCACTTGCTTTCTTCTTTATATTAATGTAGTCCTCCCCACA TGAGTGCACAACATTTGATACTGAGGCTTATAGTTATAGGATCACTCATA ATCTGGAAATTTACTGTAGTTAAACCCGATTTATATGTCTGACAAGTCGC CCTTATCCAATTTTAGCAAGGAGGGAGGGGTTACGAAggtttttttaacc cttttgaaggggggggttcgaaaaacAGGTTAAGGGTGCGGgtgtgaatt ttttttggattttttgaaatatcctcaactcccccctagtagatactttc tgaccactccctaactCATTCTTTCTTAGCTGTTTCATACAGGGTTGTAT TGTTTAAATCTATTAAAATCTGTTACTTTTCTTGTAATTTGGTGATGTCA ATGAGTGTTCCAGATGATAGCTCTGAAATAAATCCCTCtgataatttctt ttctttcataGTTATCGTATTATCCCAGTTGTGTTTGGAGCTCATCCTGA CGAATACAAACGCATTGTCCCTCCACACAGTTACATTCACACCGACCAAT TCGCATCGCCAAAAGAACTGGCGGAATATCTCATCTTTTTAGATCAACAT GATGACTTATATAATCAATACTTTTTGTGGAAAGACACTGGTAGCTTCAT CAACACCAAATTCATGTGCCGTATGTGCACCATGGTCCACCTGGCTCCCC ATTTCCCAATGTGGTATAGCGACGCAAACAATTGGTGGAGGAGTAAAGAC AATTGTGTTGATCCCACCAAAAATGGTGATGGCGTTTCTTACGGAACGTG GCGTAACAAACCTCTCCCGAAACAACATTCAAACTTTGTGAAATACGGGT ACAAGAGATACGGCTGATATTTTTACCTCCAATTGTATTT

Coding sequence (CDS) from alignment at scaffold_92:176401..181990+

>TCONS_00073445 ID=TCONS_00073445|Name=TCONS_00073445|organism=Clytia hemisphaerica|type=CDS|length=5202bp|location=Sequence derived from alignment at scaffold_92:176401..181990+ (Clytia hemisphaerica)
CAACGTTTCATTTGGCCGAAGAAAAAGTATCGTAGCATCAAGAATATGCA
AGTGACGCGGATCAAAGTTCGCGAATTGTGTCTTCTGTTGTGCCTTCTTT
CGCTATGTCTAATTATGGTGGTGCGTTATCGAGCTCCTGAGGATAAAAAA
CAGATCCGAAAGAAGAGAGCGCAACATGTTATTCCACAAGATAAACCTGT
TCCTCCTCGTTATTCAGGAAAGTTGAACTCGCCGGGCGATCTATTGATAG
ACTTAGAGAggaaaatacttttgaaaaatgaagtttcGAATGCAATTTCG
GACAGGGAGGCTGAGAACGAGAAACGGATGTCACAACTAGAGAGTAAATT
ATTTCAACGTTTGAATATCATTGAAAGCAAAGTAAACCGAAACGAAGACC
TACTTCTTGAAATTGATCGATTGTTGAaaacgaaatcgaaagtaaacgAA
CCAAAACCACCGGCAACAAAGATCAAACTCCAAACAAGAGATTTTTCTAT
CATGTACGAAATTCATAAAAAGGTTTGGAACAAATTGACTGAAAGTGAAA
TCAAAGAATTTTACAACCGTGAAAGAATATCACATTTGAAATATAACAAG
CGCATTTTAGATATTGAAAGGGATCGACATTTATTGATGGAGCTATTTCC
AGGACCCGACGAGTCGCGAGACCGAGTCACCGATCAACTTATGGTCAAAA
TTAAAGTTAACACAACTAAAACCATTTTCGTCAGTGGTTCTAATGTGAAT
AATCAAAAGAAGTTCCAAGCAGACCAGTGCAACGTTGATAAATGTTTTAT
AACAAGTAATCCCAAATATGCTTCGGTCGCAGACGCTCTTTATGTTGAAC
ATAAAATGCCATATCGATTTTTAAGAGAAAAGAATATTAATAAGAATCGG
GTCAATATGGTTTTCCAGTTAGAATCTTCAAGAAATTACCCATCTATATC
TATCTTACCCGATGGATTGAACTGGACAGCTTCTTATCGCGTCGATAGCG
TTCTGTACGCTCCTTATGAACGTTTCACGTCATTTCTAAATGTGACCGAG
CTACCCACCAAACCTAAAGAGAATTATGCCAAAGgtaaaacaaagatggc
ggcttGGTATGTTTCGAACTGTGGAGCAGCAAGTGGTCGTAAAAATTACG
TCAAAGAACTACAGAAATATATTTCAGTGGATATTTACGGACGCTGTGGT
AAACCGTGtccgaaaaataacaaaaaatgcTATGACCAATTGAACAATGA
TTACAAATTTTATTTGGCCTTCGAAAATTCAAATTGTAAAGACTATTTCA
CTGAGAAAGTCTATTGGAACGGACTTTTTTATCGTATTATCCCAGTTGTG
TTTGGAGCTCATCCTGACGAATACAAACGCATTGTCCCTCCACACAGTTA
CATTCACACCGACCAATTCGCATCGCCAAAAGAACTGGCGGAATATCTCA
TCTTTTTAGATCAACATGATGACTTATATAATCAATACTTTTTGTGGAAA
GACACTGGTAGCTTCATCAACACCAAATTCATGTGCCGTATGTGCACCAT
GGTCCACCTGGCTCCCCATTTCCCAATGTGGTATAGCGACGCAAACAATT
GGTGGAGGAGTAAAGACAATTGTGTTGATCCCACCAAAAATGGTGATGGC
GTTTCTTACGGAACGTGGCGTAACAAACCTCTCCCGAAACAACATTCAAA
CTTTGTGAAATACGGGTACAAGAGATACGGCTGACAACGTTTCATTTGGC
CGAAGAAAAAGTATCGTAGCATCAAGAATATGCAAGTGACGCGGATCAAA
GTTCGCGAATTGTGTCTTCTGTTGTGCCTTCTTTCGCTATGTCTAATTAT
GGTGGTGCGTTATCGAGCTCCTGAGGATAAAAAACAGATCCGAAAGAAGA
GAGCGCAACATGTTATTCCACAAGATAAACCTGTTCCTCCTCGTTATTCA
GGAAAGTTGAACTCGCCGGGCGATCTATTGATAGACTTAGAGAggaaaat
acttttgaaaaatgaagtttcGAATGCAATTTCGGACAGGGAGGCTGAGA
ACGAGAAACGGATGTCACAACTAGAGAGTAAATTATTTCAACGTTTGAAT
ATCATTGAAAGCAAAGTAAACCGAAACGAAGACCTACTTCTTGAAATTGA
TCGATTGTTGAaaacgaaatcgaaagtaaacgAACCAAAACCACCGGCAA
CAAAGATCAAACTCCAAACAAGAGATTTTTCTATCATGTACGAAATTCAT
AAAAAGGTTTGGAACAAATTGACTGAAAGTGAAATCAAAGAATTTTACAA
CCGTGAAAGAATATCACATTTGAAATATAACAAGCGCATTTTAGATATTG
AAAGGGATCGACATTTATTGATGGAGCTATTTCCAGGACCCGACGAGTCG
CGAGACCGAGTCACCGATCAACTTATGGTCAAAATTAAAGTTAACACAAC
TAAAACCATTTTCGTCAGTGGTTCTAATGTGAATAATCAAAAGAAGTTCC
AAGCAGACCAGTGCAACGTTGATAAATGTTTTATAACAAGTAATCCCAAA
TATGCTTCGGTCGCAGACGCTCTTTATGTTGAACATAAAATGCCATATCG
ATTTTTAAGAGAAAAGAATATTAATAAGAATCGGGTCAATATGGTTTTCC
AGTTAGAATCTTCAAGAAATTACCCATCTATATCTATCTTACCCGATGGA
TTGAACTGGACAGCTTCTTATCGCGTCGATAGCGTTCTGTACGCTCCTTA
TGAACGTTTCACGTCATTTCTAAATGTGACCGAGCTACCCACCAAACCTA
AAGAGAATTATGCCAAAGgtaaaacaaagatggcggcttGGTATGTTTCG
AACTGTGGAGCAGCAAGTGGTCGTAAAAATTACGTCAAAGAACTACAGAA
ATATATTTCAGTGGATATTTACGGACGCTGTGGTAAACCGTGtccgaaaa
ataacaaaaaatgcTATGACCAATTGAACAATGATTACAAATTTTATTTG
GCCTTCGAAAATTCAAATTGTAAAGACTATTTCACTGAGAAAGTCTATTG
GAACGGACTTTTTTATCGTATTATCCCAGTTGTGTTTGGAGCTCATCCTG
ACGAATACAAACGCATTGTCCCTCCACACAGTTACATTCACACCGACCAA
TTCGCATCGCCAAAAGAACTGGCGGAATATCTCATCTTTTTAGATCAACA
TGATGACTTATATAATCAATACTTTTTGTGGAAAGACACTGGTAGCTTCA
TCAACACCAAATTCATGTGCCGTATGTGCACCATGGTCCACCTGGCTCCC
CATTTCCCAATGTGGTATAGCGACGCAAACAATTGGTGGAGGAGTAAAGA
CAATTGTGTTGATCCCACCAAAAATGGTGATGGCGTTTCTTACGGAACGT
GGCGTAACAAACCTCTCCCGAAACAACATTCAAACTTTGTGAAATACGGG
TACAAGAGATACGGCTGACAACGTTTCATTTGGCCGAAGAAAAAGTATCG
TAGCATCAAGAATATGCAAGTGACGCGGATCAAAGTTCGCGAATTGTGTC
TTCTGTTGTGCCTTCTTTCGCTATGTCTAATTATGGTGGTGCGTTATCGA
GCTCCTGAGGATAAAAAACAGATCCGAAAGAAGAGAGCGCAACATGTTAT
TCCACAAGATAAACCTGTTCCTCCTCGTTATTCAGGAAAGTTGAACTCGC
CGGGCGATCTATTGATAGACTTAGAGAggaaaatacttttgaaaaatgaa
gtttcGAATGCAATTTCGGACAGGGAGGCTGAGAACGAGAAACGGATGTC
ACAACTAGAGAGTAAATTATTTCAACGTTTGAATATCATTGAAAGCAAAG
TAAACCGAAACGAAGACCTACTTCTTGAAATTGATCGATTGTTGAaaacg
aaatcgaaagtaaacgAACCAAAACCACCGGCAACAAAGATCAAACTCCA
AACAAGAGATTTTTCTATCATGTACGAAATTCATAAAAAGGTTTGGAACA
AATTGACTGAAAGTGAAATCAAAGAATTTTACAACCGTGAAAGAATATCA
CATTTGAAATATAACAAGCGCATTTTAGATATTGAAAGGGATCGACATTT
ATTGATGGAGCTATTTCCAGGACCCGACGAGTCGCGAGACCGAGTCACCG
ATCAACTTATGGTCAAAATTAAAGTTAACACAACTAAAACCATTTTCGTC
AGTGGTTCTAATGTGAATAATCAAAAGAAGTTCCAAGCAGACCAGTGCAA
CGTTGATAAATGTTTTATAACAAGTAATCCCAAATATGCTTCGGTCGCAG
ACGCTCTTTATGTTGAACATAAAATGCCATATCGATTTTTAAGAGAAAAG
AATATTAATAAGAATCGGGTCAATATGGTTTTCCAGTTAGAATCTTCAAG
AAATTACCCATCTATATCTATCTTACCCGATGGATTGAACTGGACAGCTT
CTTATCGCGTCGATAGCGTTCTGTACGCTCCTTATGAACGTTTCACGTCA
TTTCTAAATGTGACCGAGCTACCCACCAAACCTAAAGAGAATTATGCCAA
AGgtaaaacaaagatggcggcttGGTATGTTTCGAACTGTGGAGCAGCAA
GTGGTCGTAAAAATTACGTCAAAGAACTACAGAAATATATTTCAGTGGAT
ATTTACGGACGCTGTGGTAAACCGTGtccgaaaaataacaaaaaatgcTA
TGACCAATTGAACAATGATTACAAATTTTATTTGGCCTTCGAAAATTCAA
ATTGTAAAGACTATTTCACTGAGAAAGTCTATTGGAACGGACTTTTTTAT
CGTATTATCCCAGTTGTGTTTGGAGCTCATCCTGACGAATACAAACGCAT
TGTCCCTCCACACAGTTACATTCACACCGACCAATTCGCATCGCCAAAAG
AACTGGCGGAATATCTCATCTTTTTAGATCAACATGATGACTTATATAAT
CAATACTTTTTGTGGAAAGACACTGGTAGCTTCATCAACACCAAATTCAT
GTGCCGTATGTGCACCATGGTCCACCTGGCTCCCCATTTCCCAATGTGGT
ATAGCGACGCAAACAATTGGTGGAGGAGTAAAGACAATTGTGTTGATCCC
ACCAAAAATGGTGATGGCGTTTCTTACGGAACGTGGCGTAACAAACCTCT
CCCGAAACAACATTCAAACTTTGTGAAATACGGGTACAAGAGATACGGCT
GA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045585XLOC_045585Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073445-proteinTCONS_00073445-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073445-exon-scaffold_92-1491911889:176401..176433TCONS_00073445-exon-scaffold_92-1491911889:176401..176433Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1510915933:176401..176433TCONS_00073445-exon-scaffold_92-1510915933:176401..176433Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1575043694:176401..176433TCONS_00073445-exon-scaffold_92-1575043694:176401..176433Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1491911889:178462..179756TCONS_00073445-exon-scaffold_92-1491911889:178462..179756Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1510915933:178462..179756TCONS_00073445-exon-scaffold_92-1510915933:178462..179756Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1575043694:178462..179756TCONS_00073445-exon-scaffold_92-1575043694:178462..179756Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1491911889:181562..181990TCONS_00073445-exon-scaffold_92-1491911889:181562..181990Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1510915933:181562..181990TCONS_00073445-exon-scaffold_92-1510915933:181562..181990Clytia hemisphaericaexon
TCONS_00073445-exon-scaffold_92-1575043694:181562..181990TCONS_00073445-exon-scaffold_92-1575043694:181562..181990Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:176401..181990 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.320858 9.36226e-07 0 0 2.45398e-06 0.366344 0.586244 1.15156 0.227742 2.07494e-07 2.08965 0 0.243877 0.411562 0.117125 0.111727 1.77045 2.43727 0.292354 0 6.14146 4.02413 2.02689 2.20102 6.23631 0.917048 1.61823 1.52028e-05 0.00487004 0.00638014
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR031481Glyco_tran_10_N
IPR001503Glyco_trans_10
Vocabulary: Molecular Function
TermDefinition
GO:0008417fucosyltransferase activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0006486protein glycosylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006486 protein glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0008417 fucosyltransferase activity
Blast
BLAST of TCONS_00073445 vs. Swiss-Prot (Human)
Match: FUT6 (Alpha-(1,3)-fucosyltransferase 6 OS=Homo sapiens GN=FUT6 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 6.513e-35
Identity = 94/258 (36.43%), Postives = 131/258 (50.78%), Query Frame = 1
Query:  793 CFITSNPKYASVADALYVEHKM----PYRFLREKNINKNRVNMVFQLESSRNYPSISILPDGLNWTASYRVDSVLYAPYERFTSFLNVTELPTKPKENYAKGKTKMAAWYVSNCGAASGRKNYVKELQKYISVDIYGRCGXXXXXXXXXXYDQLNNDYKFYLAFENSNCKDYFTEKVYWNGLFYRIIPVVFGAHPDEYKRIVPPHSYIHTDQFASPKELAEYLIFLDQHDDLYNQYFLWKDT---GSFINTKFMCRMC 1545
            C IT++ K    ADA+ V H+     P   L      + +  + F +ES  +   +  +    N T SYR DS ++ PY     +   +  P  P  N +  KT++ AW VSN G  S R  Y + LQ ++ VD+YGR  KP P+       +  + YKFYLAFENS   DY TEK++ N L    +PVV G     Y+R +PP ++IH D F SPK+LA YL  LD+    Y  YF W++T    SF      C+ C
Sbjct:   90 CNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPW---SGQPAHPPLNLS-AKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMM---ETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKAC 340          
The following BLAST results are available for this feature:
BLAST of TCONS_00073445 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
FUT66.513e-3536.43Alpha-(1,3)-fucosyltransferase 6 OS=Homo sapiens G... [more]
back to top