Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073437 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073437
Unique NameTCONS_00073437
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1315

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073437 ID=TCONS_00073437|Name=TCONS_00073437|organism=Clytia hemisphaerica|type=transcript|length=1315bp
CTTATATCTTTTATTTGTGAAATTAGACGGTCTAAAtctcaaaaataaga
aaattaccAAATATTAGCACTCTAAAATTAAGCGAAAATTTTTGAGTTAG
TTTACGAAATATGTAATGGTTCGGTTAAATACCTCCCCGCCCGATTTGAA
GATAAACCACCCAGAAATCTTGGTCAGCACAGTCAgcattttttcagttt
caaaatggcGTTCTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaag
tttcagctgaccCAGTACAAACACCGACATTTCTTCAAGGATCAAAGGGA
GAATCTAAAAGAACTTTACAACCTATCACCACTGGAACATCAGTTCTTGG
TGTCAAATTTGATGGAGGTGTTGCACTGGCTGGTGATATGCTCGGATCTT
ACGGATCTTTGGCAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGAC
GATAAAACAGTTGTCTTCGCGTCTGGAGATTACGCTGATTACCAATACCT
GAAAGAAGAATTGCAACGAATGTCGATCGAGAATGATATTGAAGACGACG
GTCATAGTTATTCGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGATG
TATTACAGACGTAACAAATTCAATCCAATCTGGAACACGTTAGCAGTTGG
TGGTTACAGTAATGGAAAACCATTCTTGGGATATGTTGACAAAATCGGTT
CGGCTTATGAAGAAAATGCAATCGCGACTGGATACGGTGCTTATATCGCT
CGACCTCTGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGAA
AATCGAAGCAGTAAAAGTCTTGATCGAATGCTTGAAGATCTTATATTACA
GAGATGCACGCTCCATCAATAAATTCGAGATCGCAGTGATCACAGAAGAA
GGGGTGAACATAGAAAGTAATATGACGGCTGATACCAATTGGGAAATTGC
ACACTACGTTAAGGGCTACGAATAAGAATTGTTTCAAGCACACCTTGTTT
CATGTTGGTTGGTTGGTCGTTTGTTCCTTATTTATGACGGAAGGGAGAAA
AAGCCAAGTCAGTAATGCATTCCCTTGTACAGTCATGATATTCTTTTtaa
atagactttttttttggaaataaattttcacacgtatttaaaatgaattt
ttgataatAAGAACTCACTTCCCTCTGGTTATAgataagaaattttgtaa
tatCGGTGTAAGGTTTTTGTGTTTTAGACTTTAACCCTGTTTCCTTTCGA
AAGAGAGATTTTGTTTTGTCTCGGGGTTGAAGATAACTCAAATCACCAGC
CACACTTCTTCCCAC
Run BLAST on NCBI

protein sequence of TCONS_00073437-protein

>TCONS_00073437-protein ID=TCONS_00073437-protein|Name=TCONS_00073437-protein|organism=Clytia hemisphaerica|type=polypeptide|length=256bp
MAFSITSHPAHVGLKVSADPVQTPTFLQGSKGESKRTLQPITTGTSVLGV
KFDGGVALAGDMLGSYGSLARYPGVSRLIQVDDKTVVFASGDYADYQYLK
EELQRMSIENDIEDDGHSYSSKSIFAYLRLLMYYRRNKFNPIWNTLAVGG
YSNGKPFLGYVDKIGSAYEENAIATGYGAYIARPLIEKAIEEKGGKLTKI
EAVKVLIECLKILYYRDARSINKFEIAVITEEGVNIESNMTADTNWEIAH
YVKGYE
Run BLAST on NCBI

transcript from alignment at scaffold_92:20801..45362+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073437 ID=TCONS_00073437|Name=TCONS_00073437|organism=Clytia hemisphaerica|type=transcript|length=24562bp|location=Sequence derived from alignment at scaffold_92:20801..45362+ (Clytia hemisphaerica)
CTTATATCTTTTATTTGTGAAATTAGACGGTCTAAAtctcaaaaataaga aaattaccAAATATTAGCACTCTAAAATTAAGCGAAAATTTTTGAGTTAG TTTACGAAATATGTAATGGTTCGGTTAAATACCTCCCCGCCCGATTTGAA GATAAACCACCCAGAAATCTTGGTCAGCACAGTCAgcattttttcagttt caaaatggcGTTCTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaag tttcagctgaccCAGTACAAACACCGACATTTCTTCAAGGATCAAAGGGA GAATCTAAAAGAACTTTGTAAGTAtgatttgaaattatattagtgTCGAT CTCTGGCAGTCAATTTGTCCTACTATGGACCAcatagagtcccctgccca gttggcgaccgaacgtctNtaagagtcccctgcccagttggcgaccggtc tagttggcgaccgaatgtctttgaacccagaaaagtcatacaaaaacaaa cctctggagaatttcttttggtagttatctgctttgacctatttcccgta ctgtgtaaaaaaaattctagaaaagaacaagtagaatccgaaagatccaa ctttgcacggaagcacacaaaaaagccggattttttcgaaaaaaataata aatggctacctgtggacaaaaaagctttgtaagaaaaaacgcttcaactg ccactccaaaaaatatgttagaaagcatttctataaaaatcaGCTCAATA GCGTTTCCTTcgtctgaaatattgataaaaaagttgatgcaatcgTTTCG AAATTagacgtccagtctgcgaccgacaaaatcgaaagtaagaaaaagaa gactctacattgcgatcaaaacattccagatgctgagaaaaaaaagaaga ctttacattgcgatcaaaacattcaagggGCATGTCCGCGGTCTTTAACT TGACAATTATGTGTTTTTTTATCATCTTGATCAATTCATATGACCACCTA acctgcaagtagagcactgaatttccctttttagcgatcggtcgcagact ggtacgtcggttgggaactgggcactagcagttacatcaatatgccaaaa acattttgttcaaccaccttcacttcaatataggccaccatagaatgaac ttccttttataggatgaaacatattcatgtggctttcagccttgcactcc atcgcagaggctaatcaattttaatgacttttttgactaatgaccaagtt aaaattttttaatttttttatatttgagtattaaaaaggcatgcattcaa attgtctgtacacaaacccaatatctacggctaatttcaaaattcattgc cgtagagggtcagttgtcattgtcttttctggttttgagatttttcaaac caaccgctACGATGGAGTGCTGTTGGAGTTTGGCGAGAAATCGGAGGCGA TAAGACAAAATGGCCGTCAGAGTTGTCAGAAAGTATAAAGTcgaaaaaag tgttttcataacaaaactgcccggggggggggtacttaggcaaatggagg gtacggtatgtgccgcccttaagggtaccttttttggacttccaaagtcc cgctaagggNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatttcagtcccagtaagggt cggaaaaataggaaaatttcaactttttaccccctgaaagatcaaaattt ggtcaaaattggtcaaattagtcccgcaattttcctttgttttagtcccg gtaaagggtccaaagttcgaaagtcgggcgacaccccccgtcagctcgca accctagtattACCCCCAATAATTGGAATAAAAGAGAGCTcctaaatgaa gacattctattgcaaaataactctttttgcacaaatcgaatgttttttgt ttacattttggatcTTTGAGTTCACGAACATGAGAGAGAAATTGTTTGAT TGGAATCTTGTTCTTAAAgtggttttaacttcagttctttgcAAAAGAAT ATACTCAGAGTATCTCTGCATGttttatgttcaaattcagtattactTTT ACGGCATTCGATCTATGTAGAGTGGctatagtttgttttgttggcaTAAC TTTTGTAATTAAAATGTTTGTATTTTTNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNTAAATAGGGtaattggaaaataattttct gttagacaattttgaatatgtcttcgttacttttcagcttttagtttggc tcaaaaacattaaaaaagcagccaaaACATGCTCAGAAAGTGACCCTCAA TGGACCCCAtccctttgtttacaattgtcgtactttggcggccattttat ttcaaaattgtacttcatcgcagaggtctccgtacggaaaaacttttatc aaacagacaatgcgcacagagtgaactacgctacgataatcgtgagatac actctggtacagagtagcattcaaataataaaggtttagaatttttctct gggctagttagtaaaatatctcaaataggctctgcGATGGAGCGCAAGgt tgaaagccacatgaatatggttcatcctataaaaggaagttcgttctatg gtggcctatcttgaagtgacggtggttgaacaaaatgtttttggcatatt gatgtaactgactaGTACtctaaattcaaaatggagtgacgaaattcaaa atggagtgGCGAAATTCAAAATAGCGtgagaataaaaaaattagagtgAC AGTTGTGGGCCACCGTAGATACAgggtatttgaacttttcaaaaccatGC GCTCACTAAAAaagcgtcttttttataagaactttagcgttttactaacc tgtttatttttgtaaatattttcttgtcgtccattttttgttttattttt caagttttgctcatTGAAAATGGCGGCAATGTAgtatcttcttttttaat tgagatcgccagctttggaatgttttgacgttgcaatgtcttcattttga atatatgGTGTTTGGATCATTCTCGGAcccttttttatatcaactattat gtttctattgattttgaattaatgtGCTAACATATgcttcaatgaaattt tgtgtgatggaagataacaggttcttaaaagaggaaagtcattttcagaa ctcttcttgcgcaaatcttcttataaaaaacatttcctcTCGCGATCagc catgtttacaaaaatcacgaatttcgtgatttttttacttggcctcgttc aaaatcggtttggtgttgttctagtgctccgtttattttaatttttggac agATTGCTAGGgatagtttgaggattctgctgcacaaaggaagTTTTATA GAAGtctgtttttggttgttttttttcaagttcaaagacgTTCGTTCGTG CATTGGGGCTGTTCGCGCACTGGTAACTTGACTCTATACGATTAGCcaaa tagaatttttttacGCCCTTGTAGATAATTCCAGCAGGGGTGACTTAGTT TGTGAATTGACGTATGTTcgtgtcaaaattggaaaatcccATTGTCCTTG GTTGgcaaaagttcaaaatatttttgcttaacTCTTTTTCAAAGTCGACA TAATCACGTTacagatttttgatttttatttaaaagaaaacaaaataatt ttgacataccttattggaactaattttcgcgggaactaattttcgcggtc gaaaaaaatatctggaaaattgcgtttcgcgggttttaattttcgcggtt tttttcattctggaattttcgcgagttttaattttcgcggttttgccctt ttttggacaaatttctttcattttcctacggatttttcaaatttttcgat aaaattggaaaaaattgtatttcacgGGAATCAATTCTCgcggttttcaa ctctcaaaatttttcgcgggatcaaattttcgcgattttgacgaaaaacc gcgaaaaacgctaagattaaaacccgcgaaaattagttccaataaggtaa gaTCCGTGTAAGAGCctcttttttcaaagaattcaaaTTGTCATATCTCG ACTTTGGTAAAGAGttaggtaaaaaaaaattgaaaggtttTACAGAagtt ggcgaccgaaatttttttattcaaatttttcacttactttttactttttt gaaaatccttttcgaccaacggttagacaacttttaacatgctcttcgtg tttgttttgattttttatttgaggcgatattcttagaataaaaaacctTC TAAGCGAGCAGCGGTACtagtcagttacatcaatatggaGTTTGATTTCA CTTTATTAAAACACTCATATTCGAAAAAGTGCATTATAAATGACTGCTTG GCGTCCTGATTAACTTTACTACTTGCCTAAATTGGCCGGGTCAGAAGATC GGAAACGAGTAGTTCAAGAACCTTTTAGGATGTTTCCGAAAACGTGGTAG TGAGAAACTATCGAAACGAATACTTGGAATATTTTGATCATATTATTGAG ATAAACCGGTTAGAAAGCCAGAAGATTGGCGTTCTGCATTAAAGTCATAT CGTTTtatgggttggtctaaaaagcagggtagccaatggggtagccaatc gggctaggttatggggtacctctttttgcctaaacttttgaaatctgaaa cctgttttcatgtggaaataactattacaacatcttgttaatgattccat gNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNccccaa ttggctaccctgctttttagaccaaccccgtTTTTATTAGATGTTATGTA AAACATTTATTTGATAAAGTACCATTTGATCAACCCAATAACCTTCTACA TCTTTTCTTCTTCCAAAGAGGCCGCCAAATAGGAGGGATACTCTGCTGAA CCAGCCCTGAATTAAGGGTGCCTATTTGATTAAAAgatagaaaaatcaca aaactaaatcaaaaaatcagaatttcTCATTTACCTAGACATATCATAAG TCAAtcaatcacaaattttatgctgattacaAAAAATGTCAGGCTGAAAA TCTTACTATcttgaggaaaaaataaattcaatttgCCACTTGCCTTGGTT AATTTCGAAACACTTTCCTTAACTACAAATAAAAATCCAGTGCATGTGCA TAGGTGTCAGGCAGCCATATTTCATTTTGGCTCACCTTCGGTATGGCTAG CATGCCGAAGGATATTTGATAAGGAGCCTGCAACTTTCAGTAAAAGGGGA GATAATTAATATATGATTATGGAGCAAAGACATGCAGATAATGCATACCA AAAAAGTAACTTCAAATTAGTCTCAATCAATTCTTATCCCCGGAACAGTA ATGTCAACCCTCGGCTGACAATAGGCTACAGGAAGTAATCCTCATGGAGT TTTGggccgttatttttacccctaaTAAAATCCCACTGGGCCTGTGAGAA GGGTGTGTATGAAGCAAGTCCGAGCCACTATGTCCTTCGTGTGCAAGTat tctaactttttttaaatgatcgtTTATGCCCTAAACTTCACAAAAAGTGA TGGTGAACTcgatttcgaaaattttacaggtccccatgtgacgtcataac tttAGCTGGGGCCTTGAAAATGATGTAAAAAttacggttagtgtaaaaca caggtcacaggtcacaggtcacgggtcacgggtcacaggtcagtgttgac aggtcagcttcaattactgtaaaacacaaagaaaatgtttgaaaaacagt tgttaatgtcaaaaNccttgagagtggtttgtaCATGGTAGCAAAACAAA CTTCCAATTTACATGGAATAGATTTTAAATGTAAGATGGGTTCAAGAAAT GAGCTTGTCGGAACAGGTTGACgagataaagcttttaatgctttaaagat tgaaacataaaaaataatcaggaataccgtgagtggtcctaaatccgaca gccctgcctaaatccgatggggtctttcaaagatacaaactaaaataaaa acaagccttTCACTGNgatacttgtattatatactagtacatagcttaca ctaacatgccaccgcagcaatataatatttaaaaaattctataataaatt gtataatcataACAATGTCANtaaactgagagatttgatacattgagcca attgaaccaaatagaaataacaataattgcttcttatacaaaacataatt ttttattgcaatatgtacaacagcagtaacagcatcataaaaagtaatta cTTTTATAACAATTTACActttttaaattacattaattggcatcttgaca ttatagccatCCTGTTAGATATTTTGTTTCGAGagctcttgcaatagttt atcgttcaacttggagagggaatgtttgtaaacatagaatttttttcata acagttatttgggggggtcggaattaNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNccgccatatttttgcggaacacatAATTGGCCG GAACAGAAATACTAACAAACGCGCGCgcgcgcaaagattcgagattcctg tccaattagcctccgtctcggaagaggactgggcccgaatttgcggacgt tttcacagtttcactttcgttttcggctatacgacagcgttttcaagcag aaagcagaggaaaccTGTTAAATTATGACAGGGAAtactaacctattttt ccagtgtttctcaagattagagcaagattattgttctagaaagttcataa aggcctaatagtttcagattagtatgatttcatcagaaaaaacatttata ccaaagctccttattattgatatgtgaaggctaccaaaaatagcaatgtc ctccgtcagaacaactttaacataaggcaGCTTGGTAAAACCCGTGTGTT TTCATTATGTAAACGAAAGTACTTACACATAGTCGTGACGTCGAGAAAGT CAAAACGGTAGAGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTTGAAACCATGTATTTTAAGGTTGACTCCCATAA TACGTGGAGTGTTGAAATCTGGGGCTTCAATTTCGGTAAACTTATCAATT CTAATCAGCATACCGACACCAGCTTCACGTTTTCGTTTTTAGCCCGACCA ATGGAATTCATATTTTTCTCCAGTGTCAAGTTCAATTAATTTACTATCGA CACCTTTCCATCTGACTTCTTGAAGTAAGAGAAATTGTAGGCCTGTTTTT GACATTTCTTTGGCGACCGAATATATTTTGGCTCCGTCATCGTTTTCTTT CCCGGTGTACGAATATTAAGTGATCCAAACTTCCATTCGCAgtattgatg aaattttttggtgtttttctttttgtaatttttttgttggTTCATTTTGA AGAAGTGATTTAAGTCGTAGAGATGAGAAGCAAAGGATTTGCTTTGAAGG GTATGAAGGACAGTAAGGTACTCTTTCGCTCGGTGATAGATTCACTTGGT AGCTGTACTAAGGCTTCCTTGAAGCGAGATTGGTGAGTTATGCCGCGCTG TACACCATCCCAGAATTTGACCTCCGCGTCAAAAGTAAGtaagctatttt aaaacaaaagaacgaatgtaaataaatttaatacgggaaagcttatgagt ttttttatcatcctgatcaattaatACGACCTTACCTGtaagtagagcac tgatttTTTCCTTCTTgcgatcggtcgcagactggtacgtcggtcgggaa ctgggcactagtaccgctcgcttcgaaagttttttattctaagaagatcg cctcaaatgaaaaatcaaaacaaacacaaagagcatgttaaaagttgtct aatcgttggttgaaaaggattttcaaaaaagtaaaaagtaagtgaaaaat ttgaatcaaaaaaatttcggtcgccaactgggcagggtactctagTCGTT TGGGGGAGAACCACTTCCGTCGTTTGGTTTTGTGGAAAGCGAACTACtgt ctaaatttttcaatatatctcctgaactaacagattttttgaaattttgt ataaaattcCAAGCTTGTAAATAGTTTAAACtgtgttctgtgaaaaaatg ataaccatcagtgaaatactctttcattggcccagcgctagcaatagggc ctttcattagcacttTTCCGTCCGTGTatctgtctgtccgttttggtaga aacggcgcttaaaaccagtaacacactttttaNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNactttgatccatgtcaacag ggtcatacatttgctgttttgcacgctctttatcaacacgttacttttcg ctgggccttcaagcCAACAGGCTTCTTGTTTTATATTTAaggcggccatc gaaaaattgttctattcgcgtcacccacCTGCATCATATTTTCCCCTGAT TTTCTGGTGCGGAGATGCGGGAAAAAATCCGGAAAAAGCAAATTCTTCTT TTGACGTATAGTTTTTTAGGGCAGTCGGAAGTCGCGTATTTTCCCGCGTG ACAAAAGACGCGGCAacaaaaaaaggataaaaataaaattcagaatttaa TATCTAAATGATAAAGAAAGATATCTGCATGATTTTTTGttccaaaatga aaagaatttaatcacctttacagtgcaaaaaaacagaaatcTTTAACGTT CTTCGTTCATTTGTAATCTTCGATTTTCAGAGCTTGGGTTGCCCTATTTG TTGTGAACAAGATTACGGCACCGCGAATTTGGAAAaaccatggttacttt tgttaaGATCACGAAGGAGCAGATTNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTTTGTGTTTGAAAGATGGTAGATCAAGCTTTCTTT TGAAACCGTTCGTTCTGTGGGGTCGTGCATTGTCTTCCAGCAAATGTAAA TCAAAGAATTAAATCGTaaatttttcgaagaatccGTCAAATTTTTATGT TGCAAAAGGTAACAGCAGAGAGCTTAGACCTTCCTCTTTCATGCTGTGCA ATTATCTTTTGTGTATCTTCCCATTAAGGGAAGTTTAATGGTATAGTGAC CCCCGTCTCTATGGCTCGCACTACGGAAAAACACTCTCGCCCCAAACTTC CTGCGCTGATTTGTTTGtaaaacactttcgatttcagtgaCGTGGACATG TTACAAGATGGTAGGAAGTTTTTGAacaggaatcttcaaaaaaatggaac ttcaaaatggaatatctgaAAAACTACTTAAGGTTGAAAGataagtgacc cctcattttttttctgaggacaagggcttttcattaaacttggtttgaca ttttgaaaatgattttgaaatttcgactgacCCCCCCTAGCTTTTTTCTT GATCGCTCTGGCGGCCATCAGGAAATTGTTCTGTTCCTGACCTGTCACCA CCTGCCCCCGACTTACAAAAGCCATTTTAAAAAACCCGGGAATTTTTCCG ACCTGatgcgacgcgaacagaacaatttttcgctGGCCGCCTaagccaga cccgatcaatcgaacttgtcgaaccaaggctgggcttaaaaaattgttgg tttgccgtcacccgaccctagattttgaaggtgggtcggtcggtcagaat ttttttttattttggcgatttatgaagttttcgtccatggaagggttaac agtttgtttacatttaggtaattttgaataaNggaagggttaacagtttg tttacatttaggtaattttgaataaaaaacagaagtgctagcagggaatt tacgattcttatgcttgagacaaacaagatacaagttatgattttttatt gtttgaagtttttgaaggaaaaaaaattttctttaaaatggcaataaaat tttttgggtcggcacgTTTCGAGgtatagtcccgctgctgagattgaaaa aagtggctagaaaacgattttcgtgacacacatcttagaactaacttttt ttggtggaaactcacgaattagtatatgtagattccNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNcatgatttttggggggtcttcaaattagaaaa agacctatatcttcaaactgagcaaaaacgtgtattacaccaaagtccct acttctctagatcaaaagttatgggcctatttgtggtcaaaaagttTTGC ATAAATCTGCATTAAAGATTGTGGGGAAgttccctgttttcaatcagTTT TTCCACCTCCAAAGGTGACTTTCTTTGCCAATAACCTTTGATAGAATTGT TCTCCTAATTTCCCCTTTTCAGTAGGTCTTCCTCTATCTTATgtgcttca gaaaaaccaaaaacattgcccTAAAAGCTTAGCTTCACGAAGCCCCAGCT AATAACATAACCCACTGGTTGAATCTTTGTATTCTTATCCTATAAATATA ACAGAACGACCATTCTACAGAAATTGCTGTCACGTGACTTTTTTCTACCT CATGATACAAATCGCGCATTTTCATTGTATGTTGGAAATTTATTTGCCAG GTGACAAGAAGTTCCGACttcacatttttaaaaaacaaaatgacgAAAGG ACGTTTTTTTTATGTATATGATTATGGAAAGAGTTCAgttgatttaaagg ttttaattatttctttttcttttgccaTGTGTACCAAAAGATTCTACAAT GTTTGGGGAACTCAAATATctaaaagtttttctatttttcatggaaaaat gaGTTATAAAAGGCAATTTCTTTGCTtaaggtttgttttttctttgtgaa ttttcattttcaatctttctttaaagattgtatattttatttctatttct atttctatttggttgagtcacaggaggctttgaggctcattttcgcaact atagacactTTCAATTAGCGCCcatcagcaccttgaactgactacccaat tctcctcacatggtatgggttgacccgggcgaaggttcattaacttgcca agtgaaccgctgcgagtgggaatcgaacctcagtcgcctgtgcagcaact aaggtcaatgaccactataacACAGCGCCTTTTATCAATTATCTTGGTTT TTCCAGGGTTTATTCTAGAACTATTTGGGAGTAGAGAGCTATTTACAGAT ATAGTCAAAAGTTTAGACGTTTTTCCAAATTAGACACTCGTAAGCTTTAG CAATCAGGCCTTTCATGAGAGCTTTTCCGTCCGTCAGTCTGTTTTTGGAG AAATGGCGCTTCAAGCAAACTAAGGTTATGTCATTACTCATTACAATAAA GTTTTCACCAATGAAACTGTCCGTCAGTCCGTTTGCTCTTTTTTTATGTA TGATAGTGAGCAGCAAAAATCATTTAATCATTTAAGAAATATCTTTTCTT TTATCAATAGAAATGTTCTTCACCCTTACTGACTTTTCGATTTACAACTC CCACTTTTCGATTTGCAACTCCCAAATTTTGTGTGTTAAAATGCAACTCG TGATTTTAATTAAAATTTAGCTAAATTGGTCAGATTGTTGTCTAACGTGA TTCTTTTTTGGTTGGATCTGGTTGGGCAAAAAAAAATACCAGGTAGAAAT TTTTAAAGACATAAGTTGATAGTATGATTTTGACTTGAAAAAGGATGAAT TGTTTGCTTTCACGCACGACGAACAGAGGACATTTTTAACTGCAGAGAGT TTCTCTGTGTAAATAAGGAAGTTGCTTATTAGAATCTGACAATGTCTGTA TGTATGTATGTCTGTAGGCGCAGTAGTGTAGTGGTTATCAATCTTGACTG CCGTCCAGGAGGTCAGGGTTCGATTCCCGCTCGGTGCTGTGATTCACTTG GCAAGTGAATCTACCTTCGCCCGGGCCAACCCATGCCATGTGAGGGGAAT TGGGTAGACAGAAACTCAAGAAGCCTGTCGGGGACTGTGCTAGGTATCGA TTCCACAATCCATCGTGGATGAGGTGAGAGTGCACTGGCCTTGTTCCCTA GTGGTTCACGCTGGACTTAACGCACTCGATCCAAAAACTGTGTGTCAGTG TCTTGCAAGCTGGTCGCAGTATAAACCATCGCGTAAACGGTTCTAATGAG ACGACTCCTAGACTGCTCAATACAGAACCGGATGCAGCCAGTCATCATGT CTGTCTGTCTGTCTGTCTGCATGTctgtccgaaaactttggggcagcctg aaaacttcaaaaattgttcgatttggctgaaattttgcacttgttccttg ggtgaatatctgggggcgtttttttcatttttcaaaaattttgttttttg gggcctggggacgagtttttcgccaaaacgaggctaaagctttggggcag cctggagacttcaaaaattGTTGGATTTGGCTGAAATTTGGCACACTTGT TTATTGGGCGAATATCTGGGGGTCTACAATTGGGCCGATGAATAATTTGA AGTCACTGAAGTTGAGCCCAGTGCGTTGCGCACGTTCCACTATTTCAAAT TGTCCGACCAGAATCTATTTTGGTCCATTTCATCGATTGGGTCGGACAAT TCCCATGTCCgatgctttgattggtcagtcactTGATGGCAGTGCAAGTt ttcctccactgatgcaagttacccgacttcagggtactaattaaagtaaa ttaaagaagataaaataaaaccttaaaatcaaccagaatttacaaccttt tatccaaagcaaaaagaggtgcttttctcgccgccatcttgttttagaat gaaaattATTGTTCGTGCCAGttcgtatggaaattttttcatccaatcag attgcgcGATTTCACCTTCGACACGGGATTTGAAAACCCGcgcaaaataa aatagaaatacaggggccACACTACTGGCtccaggaactgaaagcaaacg ataaaggtataggaagctttactgaaggcagcataaggctgggactattt atttaaaagatatggacaataAAAGGCACTTTTAATCCTGTTACCCCTGT CCCACGCTGTCTTGACATGAGCGAGGGAACCATGTTAGTCacctctcctg aaaatttcagatcaaaacaaaaaaggaataaattcctgtaactcgatgaa aattggaaaaagctggtttttgactgtttcttaTCCtgaagtgctatttt ttggtaaaagctatgcaattcatgtttggatttctagaaagcttacccgt TCATtgtcaatttattttttatttgaaagtaattgcttcatgtataaaaa gatatagtcaaatcttgtagcgtcaaaaagtttttttccagACCGATGGc taaaaaacttaaatttagcaaaaattaaatttgacggaTGAAGGATTAAA AAACGCTATTAAATAACTGTTTAAAGACTAAAATAGCAGGCATTTAGGGA TTGAGTatagaaatttaaatttggggTTATTTAATTTGGCCTTATTAATT TTGacaggaacttaatttggcaaattttacCTAAATCTGGCCAGATTAAA CTCCTGTCATGTTTATTTTTTAAGGCATCAGCAAAATTAAATGCTGGCCA AAGTTGATTgtgttgatttttttgattaacCTAATGTCATTAAAATCTGG ACAGATTTTAATGACATTAGgttaatcaaaaaaatcaacacAAAAGTATG TTGATACTTTAAATGAGTGAATTTTCTAACAAATTATAAACTTAAATATC TTTGCAACAGATTAAGGTACGGCGTTCAAATTTTGGAAATGAGTTAACAT CGAACAAaggaaaaattttaagaaaaaattgttgATGTTATATATTCATG ATTCTTTTTTAGTGACCAAAACAACAATACTGATGTATCTTGTAATGTGC TTctatttaatttgataggttgaCTTTGAACGTCTGCAAGCACTTTTCGA aagtaaatttttcattcaatgaTCTTGAGAAATTCGCTtgaaagagaaac ttttttgtgacgCACCCGATATTTTGGATGATGTAGTGCCANATTCACtt gaaagagagaaacttttttgtgacaCACCCGGTATTTTGGATGATGTAGT GCCACTTgacattaatttttaacactgtaaTGGCTTCTTAGTGGGTacca ctttttaaaaaaactctgatcaaaaaTGGCAGATGTAACTTTGTCTGGGG TTGATAAAGGTCAGTGCATAGAACGGGAATGTAGGATGTTGGCATCAATA TTTTGGATTGTTATCAGGAAGATAAGTGCAAGTGAGCCAAACACTAATCC TTGGTTACGGAAATGACCTCTACCAGTTAGTCAGGAAGGCTCAAATTATT GTAGAAATTAGATGAGGCGAGatccattgtttctgacatcggtgtaagaa aatatttagactaaaaaaaggcctgaaaacttggcaatccttcatcaaat gacaagattgtttgatcaatgttttcttcaaagtgaactctattgcttga tacttttttccaaaattctccagtgaTATTCTCAATCGATACACAAAATG TGTAAAAGTGTAAAAATTGAATCTGAAATCgcgtatgcttataaagaact ttccATTTTCTGggttaagaaatattttttcaaaacaaaatttaaaagat aacgaaatggaacataaacttgtttcgtgGGGCTAAGTGTTAATTAATTA TCCTATTATATTAAATGGCTataaatcttcaatactgatagttagaatga gttctactaaaaagtcttacttcatcgggcgagcttagaattttgtttta atgaattttataaaagaaatcaaaaaaccaATGAGCGAcaaattcaactc ctgtttttctttatacctcaaTGGTATAAAAGGTGTCCTTCCGTTGGTTA TAATAGAATACCAAATGTAATTCACAAGAGCTTTCTTTTTCGTTTAGACA ACCTATCACCACTGGAACATCAGTTCTTGGTGTCAAATTTGATGGAGGTG TTGCACTGGCTGGTGATATGCTCGGTATGCGACgaactttttatctttgt acCGCCTGAGGTGTCATGAAGATCTTGTAAGGAAAAGGGAAATTATTGAA TGAATCAGATTTTGGATTTAAAAAATAGGGTTACACCTGACATCCATACT TCAATCATGACATGGTTTTCTTGAcaacattttgtttgatttcagGATCT TACGGATCTTTGGCAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGA CGATAAAACAGTTGTCTTCGCGTCTGGAGATTACGCTGATTACCAATACC TGAAAGAAGAATTGCAACGAATGTCGTGAGTCCCTATTTCTTACTCAGGA TAAAGGTTgagtaattcttttcaatttgCGTATAGTATGAtacccccccc ccagaaaattttagcttagctcttaagctaaggctacactgatagttttt tcaggcggctgcaatgcaattaGCGTTGCGTTGCAAGCGCGcaagaaatt gcaaaatgtagCACGTCAATTTTTCTGCAATTGCTCTGCAacgcaataaa aatattgcagaaCAAATTGCAGTTTGAACTGATTTTGTTGTAGAAGAATC TGCAATTTTTTTGACGATGTGTCTGACATTCCAATCTTATTACGTCATTC AAACGGTGGACCTtcgaaatcgaatgtttttgataaaatcgaatgttttg taattcgaatgttttgtaattcgaatgttttgaaatttgaattttttttt gacgtttttcctgGTTCCTTTTTTTAGATGGCTAGACAGCAACAATTTTC CCAATCCCCAAAAAGTGCATGGATAGGCCACTGTGAACTTTGCGAACTCA GCAAACGATAAATTTAATGAACCCATTTGCACACATGATCAGTATATGCT TCATTTACGACGTTTTTTGCAGGATCGAGAATGATATTGAAGACGACGGT CATAGTTATTCGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGATGTA TTACAGGTAGGATTTTTTTACCGGATTTATTGGACCAAAGTCAATCCACT ATCAAACTGATAATGTATAAATTTACTTTCATTAATTTGgtagtgaaaaa aaaaagttttcatagTCGTTAACGATTATTGAGATTGTAGCGAACAGACT ATAATGGAACAAAAGATTCATTCATTTTTCATGTAGCTCTCATAGTCTAG CACCCTACTCGTTTAGTGAACGGCTCACCACCTACTTCTTCAAAGACTTT CAATGAACTTCTTTCCCTTCTTTTTCAGACGTAACAAATTCAATCCAATC TGGAACACGTTAGCAGTTGGTGGTTACAGTAATGGAAAACCGTAAGTTGT CCTCATTGAGCTTTATAAGTGCTACCGTTAGGGTACCGctttgaaattat attgtttgacTGGGTTTGAGAAATTGTTTATTTAGTTTATTAAAAGCTCA GTGGTCGTCCTCCCTCCTTTTATAGAGCTCAGTGTTTTACATTCTTGTTC TGTCGAGGATTCCCGATGCATTGTTCGATCAAAAATAATattgacttcat ttttaacTTTGGAAAGTTTTTCCCCAAAGAAGTTGTGAtcttttttgaga aagtttttttatatcctttttaaaatttgatgtgtTTTCTCTTTAAGATT CTTGGGATATGTTGACAAAATCGGTTCGGCTTATGAAGAAAATGCAATCG CGACTGGATACGGTGCTTATATCGCTCGAGTATGTGAAATTGAGTATTTA CCCACTGATAATTTTTCAGCACTTAAAACCGCGTTATCTTGCTTACGAAA GTcgataccttttctctttgaATTTATTAGTGAAATTCCTTTTCATTTCC AGCCTCTGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGAAA ATCGAAGCAGTAAAAGTCTTGATCGAATGCTTGAAGATCTTATATTACAG AGATGCACGCTCCATCAATAAAGTAAAGTTTTATCCTAGTCTTTTATTTT CACAATGTTCAATGTTCTTCAGTCTCAGACGGGCacccaaatatatttta aactcTCGTCTGTTTGAAGAAATTATTAGTAAATTTCAAGTTCTTTctgt aaaatttctttgattgtTGTGACCAGATCAAGGAGGACAGTGTAAAAAAA TCGTCTGCATGTAGAATCTACTTCGAAAAAAGAATTTGTATACTTTTGTA CTTCGAAGCATTTCGAAGCTCCATTATACTATTCATGGAACCGTGGTATA ATTTGGTCCAACGTGTTGGCTTTTCTTTAAAAGATTAGTCGATAACTTGT ATACTGAAAATTGTTCCCTCTCATTCTCTCTTAGTTCGAGATCGCAGTGA TCACAGAAGAAGGGGTGAACATAGAAAGTAATATGACGGCTGATACCAAT TGGGAAATTGCACACTACGTTAAGTAAGTTGTTGCTAATAATAATAATCT GTTAGACAGGGAGGATTGTCTTCCAAAACGGGacaaaatgatgacgtcat tgatcaCTACTGGTATGTTTTACATGGCAAAACAACCAAATCAATTCCTC CACCCACCTAAATGACTATCATTAATAATAGTTGCATACTTTAGGGTATA GGCTAAGCATTAAAAGTACTAGTCACACATACAAACAAATTCCTTTCCAA GAGCAAGGGAATTTTCTTTATAGATTTGTAAGaaaaatttcatactcttg tGTTTTCAGGGGCTACGAATAAGAATTGTTTCAAGCACACCTTGTTTCAT GTTGGTTGGTTGGTCGTTTGTTCCTTATTTATGACGGAAGGGAGAAAAAG CCAAGTCAGTAATGCATTCCCTTGTACAGTCATGATATTCTTTTtaaata gactttttttttggaaataaattttcacacgtatttaaaatgaatttttg ataatAAGAACTCACTTCCCTCTGGTTATAgataagaaattttgtaatat CGGTGTAAGGTTTTTGTGTTTTAGACTTTAACCCTGTTTCCTTTCGAAAG AGAGATTTTGTTTTGTCTCGGGGTTGAAGATAACTCAAATCACCAGCCAC ACTTCTTCCCAC

Coding sequence (CDS) from alignment at scaffold_92:20801..45362+

>TCONS_00073437 ID=TCONS_00073437|Name=TCONS_00073437|organism=Clytia hemisphaerica|type=CDS|length=6939bp|location=Sequence derived from alignment at scaffold_92:20801..45362+ (Clytia hemisphaerica)
atggcGTTCTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaagtttc
agctgaccCAGTACAAACACCGACATTTCTTCAAGGATCAAAGGGAGAAT
CTAAAAGAACTTTACAACCTATCACCACTGGAACATCAGTTCTTGGTGTC
AAATTTGATGGAGGTGTTGCACTGGCTGGTGATATGCTCGGATCTTACGG
ATCTTTGGCAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGACGATA
AAACAGTTGTCTTCGCGTCTGGAGATTACGCTGATTACCAATACCTGAAA
GAAGAATTGCAACGAATGTCGATCGAGAATGATATTGAAGACGACGGTCA
TAGTTATTCGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGATGTATT
ACAGACGTAACAAATTCAATCCAATCTGGAACACGTTAGCAGTTGGTGGT
TACAGTAATGGAAAACCATTCTTGGGATATGTTGACAAAATCGGTTCGGC
TTATGAAGAAAATGCAATCGCGACTGGATACGGTGCTTATATCGCTCGAC
CTCTGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGAAAATC
GAAGCAGTAAAAGTCTTGATCGAATGCTTGAAGATCTTATATTACAGAGA
TGCACGCTCCATCAATAAATTCGAGATCGCAGTGATCACAGAAGAAGGGG
TGAACATAGAAAGTAATATGACGGCTGATACCAATTGGGAAATTGCACAC
TACGTTAAGGGCTACGAATAAatggcGTTCTCAATAACAAGTCATCCCGC
TCATGTCGGtttaaaagtttcagctgaccCAGTACAAACACCGACATTTC
TTCAAGGATCAAAGGGAGAATCTAAAAGAACTTTACAACCTATCACCACT
GGAACATCAGTTCTTGGTGTCAAATTTGATGGAGGTGTTGCACTGGCTGG
TGATATGCTCGGATCTTACGGATCTTTGGCAAGATATCCGGGAGTGTCTC
GTTTAATTCAGGTGGACGATAAAACAGTTGTCTTCGCGTCTGGAGATTAC
GCTGATTACCAATACCTGAAAGAAGAATTGCAACGAATGTCGATCGAGAA
TGATATTGAAGACGACGGTCATAGTTATTCGTCCAAATCCATCTTTGCTT
ATCTGCGTTTATTGATGTATTACAGACGTAACAAATTCAATCCAATCTGG
AACACGTTAGCAGTTGGTGGTTACAGTAATGGAAAACCATTCTTGGGATA
TGTTGACAAAATCGGTTCGGCTTATGAAGAAAATGCAATCGCGACTGGAT
ACGGTGCTTATATCGCTCGACCTCTGATAGAGAAAGCCATCGAAGAGAAA
GGAGGCAAATTGACGAAAATCGAAGCAGTAAAAGTCTTGATCGAATGCTT
GAAGATCTTATATTACAGAGATGCACGCTCCATCAATAAATTCGAGATCG
CAGTGATCACAGAAGAAGGGGTGAACATAGAAAGTAATATGACGGCTGAT
ACCAATTGGGAAATTGCACACTACGTTAAGGGCTACGAATAAatggcGTT
CTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaagtttcagctgacc
CAGTACAAACACCGACATTTCTTCAAGGATCAAAGGGAGAATCTAAAAGA
ACTTTACAACCTATCACCACTGGAACATCAGTTCTTGGTGTCAAATTTGA
TGGAGGTGTTGCACTGGCTGGTGATATGCTCGGATCTTACGGATCTTTGG
CAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGACGATAAAACAGTT
GTCTTCGCGTCTGGAGATTACGCTGATTACCAATACCTGAAAGAAGAATT
GCAACGAATGTCGATCGAGAATGATATTGAAGACGACGGTCATAGTTATT
CGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGATGTATTACAGACGT
AACAAATTCAATCCAATCTGGAACACGTTAGCAGTTGGTGGTTACAGTAA
TGGAAAACCATTCTTGGGATATGTTGACAAAATCGGTTCGGCTTATGAAG
AAAATGCAATCGCGACTGGATACGGTGCTTATATCGCTCGACCTCTGATA
GAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGAAAATCGAAGCAGT
AAAAGTCTTGATCGAATGCTTGAAGATCTTATATTACAGAGATGCACGCT
CCATCAATAAATTCGAGATCGCAGTGATCACAGAAGAAGGGGTGAACATA
GAAAGTAATATGACGGCTGATACCAATTGGGAAATTGCACACTACGTTAA
GGGCTACGAATAAatggcGTTCTCAATAACAAGTCATCCCGCTCATGTCG
GtttaaaagtttcagctgaccCAGTACAAACACCGACATTTCTTCAAGGA
TCAAAGGGAGAATCTAAAAGAACTTTACAACCTATCACCACTGGAACATC
AGTTCTTGGTGTCAAATTTGATGGAGGTGTTGCACTGGCTGGTGATATGC
TCGGATCTTACGGATCTTTGGCAAGATATCCGGGAGTGTCTCGTTTAATT
CAGGTGGACGATAAAACAGTTGTCTTCGCGTCTGGAGATTACGCTGATTA
CCAATACCTGAAAGAAGAATTGCAACGAATGTCGATCGAGAATGATATTG
AAGACGACGGTCATAGTTATTCGTCCAAATCCATCTTTGCTTATCTGCGT
TTATTGATGTATTACAGACGTAACAAATTCAATCCAATCTGGAACACGTT
AGCAGTTGGTGGTTACAGTAATGGAAAACCATTCTTGGGATATGTTGACA
AAATCGGTTCGGCTTATGAAGAAAATGCAATCGCGACTGGATACGGTGCT
TATATCGCTCGACCTCTGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAA
ATTGACGAAAATCGAAGCAGTAAAAGTCTTGATCGAATGCTTGAAGATCT
TATATTACAGAGATGCACGCTCCATCAATAAATTCGAGATCGCAGTGATC
ACAGAAGAAGGGGTGAACATAGAAAGTAATATGACGGCTGATACCAATTG
GGAAATTGCACACTACGTTAAGGGCTACGAATAAatggcGTTCTCAATAA
CAAGTCATCCCGCTCATGTCGGtttaaaagtttcagctgaccCAGTACAA
ACACCGACATTTCTTCAAGGATCAAAGGGAGAATCTAAAAGAACTTTACA
ACCTATCACCACTGGAACATCAGTTCTTGGTGTCAAATTTGATGGAGGTG
TTGCACTGGCTGGTGATATGCTCGGATCTTACGGATCTTTGGCAAGATAT
CCGGGAGTGTCTCGTTTAATTCAGGTGGACGATAAAACAGTTGTCTTCGC
GTCTGGAGATTACGCTGATTACCAATACCTGAAAGAAGAATTGCAACGAA
TGTCGATCGAGAATGATATTGAAGACGACGGTCATAGTTATTCGTCCAAA
TCCATCTTTGCTTATCTGCGTTTATTGATGTATTACAGACGTAACAAATT
CAATCCAATCTGGAACACGTTAGCAGTTGGTGGTTACAGTAATGGAAAAC
CATTCTTGGGATATGTTGACAAAATCGGTTCGGCTTATGAAGAAAATGCA
ATCGCGACTGGATACGGTGCTTATATCGCTCGACCTCTGATAGAGAAAGC
CATCGAAGAGAAAGGAGGCAAATTGACGAAAATCGAAGCAGTAAAAGTCT
TGATCGAATGCTTGAAGATCTTATATTACAGAGATGCACGCTCCATCAAT
AAATTCGAGATCGCAGTGATCACAGAAGAAGGGGTGAACATAGAAAGTAA
TATGACGGCTGATACCAATTGGGAAATTGCACACTACGTTAAGGGCTACG
AATAAatggcGTTCTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaa
gtttcagctgaccCAGTACAAACACCGACATTTCTTCAAGGATCAAAGGG
AGAATCTAAAAGAACTTTACAACCTATCACCACTGGAACATCAGTTCTTG
GTGTCAAATTTGATGGAGGTGTTGCACTGGCTGGTGATATGCTCGGATCT
TACGGATCTTTGGCAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGA
CGATAAAACAGTTGTCTTCGCGTCTGGAGATTACGCTGATTACCAATACC
TGAAAGAAGAATTGCAACGAATGTCGATCGAGAATGATATTGAAGACGAC
GGTCATAGTTATTCGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGAT
GTATTACAGACGTAACAAATTCAATCCAATCTGGAACACGTTAGCAGTTG
GTGGTTACAGTAATGGAAAACCATTCTTGGGATATGTTGACAAAATCGGT
TCGGCTTATGAAGAAAATGCAATCGCGACTGGATACGGTGCTTATATCGC
TCGACCTCTGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGA
AAATCGAAGCAGTAAAAGTCTTGATCGAATGCTTGAAGATCTTATATTAC
AGAGATGCACGCTCCATCAATAAATTCGAGATCGCAGTGATCACAGAAGA
AGGGGTGAACATAGAAAGTAATATGACGGCTGATACCAATTGGGAAATTG
CACACTACGTTAAGGGCTACGAATAAatggcGTTCTCAATAACAAGTCAT
CCCGCTCATGTCGGtttaaaagtttcagctgaccCAGTACAAACACCGAC
ATTTCTTCAAGGATCAAAGGGAGAATCTAAAAGAACTTTACAACCTATCA
CCACTGGAACATCAGTTCTTGGTGTCAAATTTGATGGAGGTGTTGCACTG
GCTGGTGATATGCTCGGATCTTACGGATCTTTGGCAAGATATCCGGGAGT
GTCTCGTTTAATTCAGGTGGACGATAAAACAGTTGTCTTCGCGTCTGGAG
ATTACGCTGATTACCAATACCTGAAAGAAGAATTGCAACGAATGTCGATC
GAGAATGATATTGAAGACGACGGTCATAGTTATTCGTCCAAATCCATCTT
TGCTTATCTGCGTTTATTGATGTATTACAGACGTAACAAATTCAATCCAA
TCTGGAACACGTTAGCAGTTGGTGGTTACAGTAATGGAAAACCATTCTTG
GGATATGTTGACAAAATCGGTTCGGCTTATGAAGAAAATGCAATCGCGAC
TGGATACGGTGCTTATATCGCTCGACCTCTGATAGAGAAAGCCATCGAAG
AGAAAGGAGGCAAATTGACGAAAATCGAAGCAGTAAAAGTCTTGATCGAA
TGCTTGAAGATCTTATATTACAGAGATGCACGCTCCATCAATAAATTCGA
GATCGCAGTGATCACAGAAGAAGGGGTGAACATAGAAAGTAATATGACGG
CTGATACCAATTGGGAAATTGCACACTACGTTAAGGGCTACGAATAAatg
gcGTTCTCAATAACAAGTCATCCCGCTCATGTCGGtttaaaagtttcagc
tgaccCAGTACAAACACCGACATTTCTTCAAGGATCAAAGGGAGAATCTA
AAAGAACTTTACAACCTATCACCACTGGAACATCAGTTCTTGGTGTCAAA
TTTGATGGAGGTGTTGCACTGGCTGGTGATATGCTCGGATCTTACGGATC
TTTGGCAAGATATCCGGGAGTGTCTCGTTTAATTCAGGTGGACGATAAAA
CAGTTGTCTTCGCGTCTGGAGATTACGCTGATTACCAATACCTGAAAGAA
GAATTGCAACGAATGTCGATCGAGAATGATATTGAAGACGACGGTCATAG
TTATTCGTCCAAATCCATCTTTGCTTATCTGCGTTTATTGATGTATTACA
GACGTAACAAATTCAATCCAATCTGGAACACGTTAGCAGTTGGTGGTTAC
AGTAATGGAAAACCATTCTTGGGATATGTTGACAAAATCGGTTCGGCTTA
TGAAGAAAATGCAATCGCGACTGGATACGGTGCTTATATCGCTCGACCTC
TGATAGAGAAAGCCATCGAAGAGAAAGGAGGCAAATTGACGAAAATCGAA
GCAGTAAAAGTCTTGATCGAATGCTTGAAGATCTTATATTACAGAGATGC
ACGCTCCATCAATAAATTCGAGATCGCAGTGATCACAGAAGAAGGGGTGA
ACATAGAAAGTAATATGACGGCTGATACCAATTGGGAAATTGCACACTAC
GTTAAGGGCTACGAATAAatggcGTTCTCAATAACAAGTCATCCCGCTCA
TGTCGGtttaaaagtttcagctgaccCAGTACAAACACCGACATTTCTTC
AAGGATCAAAGGGAGAATCTAAAAGAACTTTACAACCTATCACCACTGGA
ACATCAGTTCTTGGTGTCAAATTTGATGGAGGTGTTGCACTGGCTGGTGA
TATGCTCGGATCTTACGGATCTTTGGCAAGATATCCGGGAGTGTCTCGTT
TAATTCAGGTGGACGATAAAACAGTTGTCTTCGCGTCTGGAGATTACGCT
GATTACCAATACCTGAAAGAAGAATTGCAACGAATGTCGATCGAGAATGA
TATTGAAGACGACGGTCATAGTTATTCGTCCAAATCCATCTTTGCTTATC
TGCGTTTATTGATGTATTACAGACGTAACAAATTCAATCCAATCTGGAAC
ACGTTAGCAGTTGGTGGTTACAGTAATGGAAAACCATTCTTGGGATATGT
TGACAAAATCGGTTCGGCTTATGAAGAAAATGCAATCGCGACTGGATACG
GTGCTTATATCGCTCGACCTCTGATAGAGAAAGCCATCGAAGAGAAAGGA
GGCAAATTGACGAAAATCGAAGCAGTAAAAGTCTTGATCGAATGCTTGAA
GATCTTATATTACAGAGATGCACGCTCCATCAATAAATTCGAGATCGCAG
TGATCACAGAAGAAGGGGTGAACATAGAAAGTAATATGACGGCTGATACC
AATTGGGAAATTGCACACTACGTTAAGGGCTACGAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045581XLOC_045581Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073437-exon-scaffold_92-1491911889:20801..21117TCONS_00073437-exon-scaffold_92-1491911889:20801..21117Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:20801..21117TCONS_00073437-exon-scaffold_92-1510915933:20801..21117Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:20801..21117TCONS_00073437-exon-scaffold_92-1575043694:20801..21117Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:42248..42324TCONS_00073437-exon-scaffold_92-1491911889:42248..42324Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:42248..42324TCONS_00073437-exon-scaffold_92-1510915933:42248..42324Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:42248..42324TCONS_00073437-exon-scaffold_92-1575043694:42248..42324Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:42496..42625TCONS_00073437-exon-scaffold_92-1491911889:42496..42625Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:42496..42625TCONS_00073437-exon-scaffold_92-1510915933:42496..42625Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:42496..42625TCONS_00073437-exon-scaffold_92-1575043694:42496..42625Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:43223..43306TCONS_00073437-exon-scaffold_92-1491911889:43223..43306Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:43223..43306TCONS_00073437-exon-scaffold_92-1510915933:43223..43306Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:43223..43306TCONS_00073437-exon-scaffold_92-1575043694:43223..43306Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:43579..43641TCONS_00073437-exon-scaffold_92-1491911889:43579..43641Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:43579..43641TCONS_00073437-exon-scaffold_92-1510915933:43579..43641Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:43579..43641TCONS_00073437-exon-scaffold_92-1575043694:43579..43641Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:43948..44029TCONS_00073437-exon-scaffold_92-1491911889:43948..44029Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:43948..44029TCONS_00073437-exon-scaffold_92-1510915933:43948..44029Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:43948..44029TCONS_00073437-exon-scaffold_92-1575043694:43948..44029Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:44153..44272TCONS_00073437-exon-scaffold_92-1491911889:44153..44272Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:44153..44272TCONS_00073437-exon-scaffold_92-1510915933:44153..44272Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:44153..44272TCONS_00073437-exon-scaffold_92-1575043694:44153..44272Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:44635..44723TCONS_00073437-exon-scaffold_92-1491911889:44635..44723Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:44635..44723TCONS_00073437-exon-scaffold_92-1510915933:44635..44723Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:44635..44723TCONS_00073437-exon-scaffold_92-1575043694:44635..44723Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1491911889:45010..45362TCONS_00073437-exon-scaffold_92-1491911889:45010..45362Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1510915933:45010..45362TCONS_00073437-exon-scaffold_92-1510915933:45010..45362Clytia hemisphaericaexon
TCONS_00073437-exon-scaffold_92-1575043694:45010..45362TCONS_00073437-exon-scaffold_92-1575043694:45010..45362Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073437-proteinTCONS_00073437-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:20801..45362 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
280.775 292.067 353.101 381.45 202.709 164.456 291.737 312.618 334.023 324.88 305.749 251.127 200.815 186.304 223.731 255.989 306.015 316.666 112.561 137.377 228.483 228.323 206.075 202.399 289.332 300.609 278.555 238.98 177.555 155.653
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001353Proteasome_sua/b
IPR016295Proteasome_endopept_cplx_B
IPR029055Ntn_hydrolases_N
IPR016050Proteasome_bsu_CS
IPR023333Proteasome_suB-type
Vocabulary: Cellular Component
TermDefinition
GO:0005839proteasome core complex
Vocabulary: Biological Process
TermDefinition
GO:0051603proteolysis involved in cellular protein catabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0004298threonine-type endopeptidase activity
GO:0004175endopeptidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0051603 proteolysis involved in cellular protein catabolic process
cellular_component GO:0005839 proteasome core complex
molecular_function GO:0004175 endopeptidase activity
molecular_function GO:0004298 threonine-type endopeptidase activity
Blast
BLAST of TCONS_00073437 vs. Swiss-Prot (Human)
Match: PSB4 (Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4)

HSP 1 Score: 269.24 bits (687), Expect = 1.011e-86
Identity = 121/226 (53.54%), Postives = 176/226 (77.88%), Query Frame = 1
Query:  295 KGESKRTLQPITTGTSVLGVKFDGGVALAGDMLGSYGSLARYPGVSRLIQVDDKTVVFASGDYADYQYLKEELQRMSIENDIEDDGHSYSSKSIFAYLRLLMYYRRNKFNPIWNTLAVGGYSNGKPFLGYVDKIGSAYEENAIATGYGAYIARPLIEKAIEEKGGKLTKIEAVKVLIECLKILYYRDARSINKFEIAVITEEGVNIESNMTADTNWEIAHYVKGYE 972
            +G   RT  P+ TGTSVLGVKF+GGV +A DMLGSYGSLAR+  +SR+++V++ T++ ASGDYAD+QYLK+ L +M I+ ++  DGHSYS ++I ++L   MY RR+K NP+WNT+ +GGY++G+ FLGYVD +G AYE  ++ATGYGAY+A+PL+ + + EK   L++ EA  ++  C+++LYYRDARS N+F+IA +TE+GV IE  ++ +TNW+IAH + G+E
Sbjct:   40 RGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVL-EKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE 264          
The following BLAST results are available for this feature:
BLAST of TCONS_00073437 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PSB41.011e-8653.54Proteasome subunit beta type-4 OS=Homo sapiens GN=... [more]
back to top