Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073413 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073413
Unique NameTCONS_00073413
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2160

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073413 ID=TCONS_00073413|Name=TCONS_00073413|organism=Clytia hemisphaerica|type=transcript|length=2160bp
tcTTAGATAAaacaatgaattaaaaaaataaaacagaatTCAATGcatca
aaagaaaatcatatTTGAACTTGAACACAATCCAACATGCCGCTTCCAGA
TAACCGCCGAATCAATGGACCACGTGAAACTTATCAAATCACCTCATTTT
TGACGCCACAGCACAACGACGCCGATGTGCCAAGCACCGGGATTGTGAAC
GATAAAGGATTGAGGAAAGACACACGACGTACAGATGAAGTGCGTCCGAT
TTATTTGAAAGCAGGTGTTGTTCAAAGTGCAAATGGTTCCGCTTACTTGG
AGACGTCCGGTACCAAACTAACGTGCGCCGTGTATGGGCCACGTGATTAC
GCTAAACGTCATCAATTCCGATCTTCCGGTAAACTCACCTGTAGTCTCAC
GTTTGCTCCCTTCTCTAAACCGCAACGTTTTACTGAAATCCGGGACTCTC
TAAGTACGGAATACTCTAATTTCATAGCAGATTCTCTCATGTCCGCAGTA
TGTCTTGACGCTTATCCGAAATCTCAAATCGACGTATACGTTAATGTGTT
GGAAGATAACGGGAATACCTTAAGTTATGCTATAACGGCTGCGTCCGTTG
CGTTGGCTGACGCTGGAATCGAAATGGTAgatttggtgacgtcatcaagC
CTCGTTTTTAATGATGACGTCTTTTGTTTGGACCCAGACTCCAGCGaaca
aaaacacaaagacgttTATGGGAAAATGTCCATAGCTTATCTACCATCTT
TAAATAAGATTTCGTGTTTGCTTCAAGATGGCGCAGTGGAAGTTGAACGT
TCTATTGAACTTGTGAACACGTGTTTAGAGGGTTGCTTAAGGGTACATGA
CGTCATGAAAGAATGTCTTTTAAAGGCACCTAATACTGACGAGGAGAGTT
GAGAGGGGAATGGAAAGAAAGTTTTTAACATAATAACACGTCCGGACAGT
AGTTTATTTTCCCCCTTTTTCTTCggtttattttaatttaaaactTGATT
AAGTCGATGGCCCCTTCAGCTTGGAAAGACTCTCCGCCATCTGAATCGCC
TATAGTTCGAAAGAAATTGATTGTCTCTTACATAACGGCCAAGCTCTGGC
CTTACCTTGTAGCAAAAGTATGACAGGAAGAGAATTTTACCCGATGGTAT
CTAATTACAGGAGTAGCATATCAAAAGTTGATTGTTAATATACTCATTCT
TATAattttacctcattttacagCTAAAACCTAAAACAaattattaaaac
aaaaaataccttgTTGGAGAATTCAGTTTACCAACAAGACATTTGAACAA
AGACAACAAAACTGCCGATTATTATTTTCTTGACAAAATGGTGCTTCCAT
TGACTTTACTGCAGACCGCTCAAAATCATCCAATGTTGGTTGAGTTGAAA
AATGGAGAAACATATAACGGACATTTGGTCAGCTGTGATAATTGGATGAA
TATCAATCTGAGAGAAGTTATTTGCACATCAAGGGACGGTGATCGCTTTT
GGAGGATGCCAGAATGTTATGTTCGAGGAAGCACTGTCAAATATCTACGT
ATCCCTGATGAGGTTATTGATATGGTGAAAGAAGACGCCCTTCAAAAGAA
CCGACAACGCCATCATAACGCCAACAGACGAGGTGGTCCAAAGGGCGGAC
GCGGTGGTCGAGGTGGACATCGTGGTGGTCGTGGTGGCGGCAGAGGGCGC
CCTGATAATGCTGAACGATAATTTTCATCCTGAGAATTgctttgttgttt
attttataCCGTTGTTGTTGTTTTAGGGTTTCACGCCCTGGTATGATTTA
TGGGACGCCCCTAACGCCTGTTGCTTCAAAGAGACATGTATAAATGAACG
GCCCTTTTAACGGcagaatgaattaaaaaattcaTCTTGATGTTTCTAGA
TATAGAAAAACTATCATAATTACTATTCGTCCTTAATCAAAAGCATTATG
AGACGTTTTGTACTGGTTGAAAAGACCAAACAAAGTTGGAATTTTTATAC
CAGAatttatttgtgtttttttagctCTTATAAATTTTAGGGGGaatttt
ccctctttttttaattatttaaatcaagaaattgaatttttatcaaCTTG
AAAACTTTAAACGTTTCAATTTGTCTATACCTAGAAAATAAATAGTTTTT
ACAATTCCAC
Run BLAST on NCBI

protein sequence of TCONS_00073413-protein

>TCONS_00073413-protein ID=TCONS_00073413-protein|Name=TCONS_00073413-protein|organism=Clytia hemisphaerica|type=polypeptide|length=271bp
MPLPDNRRINGPRETYQITSFLTPQHNDADVPSTGIVNDKGLRKDTRRTD
EVRPIYLKAGVVQSANGSAYLETSGTKLTCAVYGPRDYAKRHQFRSSGKL
TCSLTFAPFSKPQRFTEIRDSLSTEYSNFIADSLMSAVCLDAYPKSQIDV
YVNVLEDNGNTLSYAITAASVALADAGIEMVDLVTSSSLVFNDDVFCLDP
DSSEQKHKDVYGKMSIAYLPSLNKISCLLQDGAVEVERSIELVNTCLEGC
LRVHDVMKECLLKAPNTDEES
Run BLAST on NCBI

transcript from alignment at scaffold_91:392060..397118-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073413 ID=TCONS_00073413|Name=TCONS_00073413|organism=Clytia hemisphaerica|type=transcript|length=5059bp|location=Sequence derived from alignment at scaffold_91:392060..397118- (Clytia hemisphaerica)
TCTTAGATAAAACAATGAATTAAAAAAATAAAACAGAATTCAATGCATCA AAAGAAAATCATATTTGAACTTGAACACAATCCAACATGCCGCTTCCAGA TAACCGCCGAATCAATGGACCACGTGAAACTTATCAAATCACCTCATTTT TGACGCCACAGCACAACGACGCCGATGTGCCAAGCACCGGGATTGTGAAC GATAAAGGATTGAGGAAAGACACACGACGTACAGATGAAGTGCGTCCGAT TTATTTGAAAGCAGGTAAAACAGATGAGATTCAGGTGCCATCATGCACAT TAATAGTAGTTTACTGTTATGTTACTTGTGTATGATTATATAACTTTACT GTTTTAGTTTTTACCTTATAAGCCTCTAGGCTAATAAGCCTCTATAGCTG ACCACCATACCTTATCGGGGAAAAAATGTCGGGATTTTGATTAGTCGGGG AAAAAATTCGTCGGCGAAAAATTTCGTCACCCCCTTAAAGTTTTCGTCAC TTTTCCCCGACATTTTTTTCCCCGGTAATGTACCATGGACACAGTTTCTC AATCCCGGTAAAGCAAAATCTTTGGTCGGAGCTTTTTGGAATTGGTAGTT ACCCTAATGGTAGCACTACTAAATGTTGATAATGATAGCATTACTCTACT AATGTTTATGAAGATAGTTTTAAAAACGAGCAATTTCATTGAATTGTAAG TTTACCCACATCGAGTAATGGTACCAATGAATAGGGCACTGCTTTTCTAA AAACTCCGATCAAAGACGGCGGGCTTACTACCAGAGAACTTCAATACCTC AAAAGTGCACTCCTGTGAGCTCTTACCCTAATCCTTATTAATTATATTGA TATCTCTAACTGAAAAGAAGGAATTAAGATTGGGAGATTTAGTCACAACT CTTGGTACAGGGTATATATAGAAAATGGTTGAAATTGACGTAGTGTCAAG AGAAACCGTTACAGTGTAGGTGGTTTTAGACCATCTCGTAGCTTATCAGA TGAAGAGATTTATAATTGTAATTGCATTGTCTTTTAACGAGTGTTACACT CCTTCGCATGCTTCCGACGTACTTGCTCTATTGCCTTAAATCCGCCAATG TACAGGGGTGTATTTCTTAGTGTGTTTTTTTCTAGGTGTTGTTCAAAGTG CAAATGGTTCCGCTTACTTGGAGACGTCCGGTACCAAACTAACGTGCGCC GTGTATGGGCCACGTGATTACGCTAAACGTCATCAATTCCGATCTTCCGG TAAACTCACCTGTAGTCTCACGTTTGCTCCCTTCTCTAAACCGCAACGTT TTACTGAAATCCGGGACTCTCTAAGTACGGAATACTCTAATTTCATAGCA GATTCTCTCATGTCCGCAGTATGTCTTGACGCTTATCCGAAATCTCAAAT CGACGTATACGTTAATGTGTTGGAAGATAACGGGAATACCTTAAGTTATG CTATAACGGCTGCGTCCGTTGCGTTGGCTGACGCTGGAATCGAAATGGTA GATTTGGTGACGTCATCAAGCCTCGTTTTTAATGATGACGTCTTTTGTTT GGACCCAGACTCCAGCGAACAAAAACACAAAGACGTTTATGGGAAAATGT CCATAGCTTATCTACCATCTTTAAATAAGATTTCGTGTTTGCTTCAAGAT GGCGCAGTGGAAGTTGAACGTTCTATTGAACTTGTGAACACGTGTTTAGA GGGTTGCTTAAGGGTACATGACGTCATGAAAGAATGTCTTTTAAAGGCAC CTAATACTGACGAGGAGAGTTGAGAGGGGAATGGAAAGAAAGTTTTTAAC ATAATAACACGTCCGGACAGTAGTTTATTTTCCCCCTTTTTCTTCGGTTT ATTTTAATTTAAAACTTGATTAAGTCGATGGCCCCTTCAGCTTGGAAAGA CTCTCCGCCATCTGAATCGCCTATAGTTCGAAAGAAATTGATTGTCTCTT ACATAACGGCCAAGCTCTGGCCTTACCTTGTAGCAAAAGTATGACAGGAA GAGAATTTTACCCGATGGTATCTAATTACAGGAGTAGCATATCAAAAGTT GATTGTTAATATACTCATTCTTATAATTTTACCTCATTTTACAGCTAAAA CCTAAAACAAATTATTAAAACAAAAAATACCTTGTTGGAGAATTCAGTTT ACCAACAAGACATTTGAACAAAGACAACAAAACTGCCGATTATTATTTTC TTGACAAAATGGTGGTATGTATCATTATCTTGTTTTTGAAATATTCCTAA TGATTAAGTGTGTTGTTACTAAATGCCTATCCAACGAAAAAGGAGTATTA ATATAGAGGGGAGAGGAGACACCGGGTGGAGGGGGGCACTCAAGGTAAAT GACATACCAGACGTGCGGCACTTAAGGGTCGGTTTTTGAGGAGACAACCC AATCGAACTACATGTAACAAACTATTCATGGACAGTCTCCTGAACTTCAA ATTAAAGCCTCTTAAGATTCTTTCACCGCTATTTGTTTAGCCAAATTTGA TTAGCCAAATTTGATTAATTTCTCCGTTATTTTTTCTTGTACTTTCAGCT TCCATTGACTTTACTGCAGACCGCTCAAAATCATCCAATGGTATTTATGT TGCATTTTCTCTCGAAGGTTAATTCAGCGAAAAATTCTGAAAACCTGATT TGCGAAGTTTATTCTTCTTGAAAAAAAAAGAAGTTTTATTATAGCCGACC AATTAGTGAAAATTAGTTGACAAAAGAAACAAGGAAATTCGAAATTCGCG AAAGTTCTTTCCCGCAAGATATTTTGAAAAGCTCGATTTGCAAAAGTTAA TTTTTACGAACTGCCAAAATGCCGCGAATTTACTCGTCAAAGTAAAAAAC GAAAGGTGGGGTTAATATCTTGATTTTAGGGGGTGAGATCAACACCATGA AGTACACTTCCTTTGTTTAAAATTGTCACTATATTTTTGGAATATTTTGT TGCTTTAAGTTGGTTGAGTTGAAAAATGGAGAAACATATAACGGACATTT GGTCAGCTGTGATAATTGGATGAATATCAATCTGAGAGAAGTTATTTGCA CATCAAGGGTAAGGGAAAAATTGTGCTCAAGTAGTATTTTAAAGTGTCAT TCATTCTGATTCATTAACCTTTGACTTTCTACCAACTTTTAACCAAGAGT ATCCAGAAAGTATCAACTTTGCGCCTGGAAAAAGTTTGCGGATTGTTTTT TTCTATGAATATGAATATTTATTGCCAGCTATTATTCGTAGAAAATTGGG TGTTAACACACGTTTTTTTCTTTCGTTAAGAAACACACTTTTAAGAAACA TGAGGCTCAGAATGCCTAAAAACTAAGAAACATCTATCAAGCATGTTGAG GCTGAGAATGAGAAAATAAATTTTTTAATTCGGCTTTTTTTAAGAACCTT CCAATCAAAATAAATGTTTTTTTTCTTTGCATGAAAAATAGGCTGATTAT GTCAAAAATTTAGAAACATGTAAGAAACATTTAGGCTCAAAAGGCCGATT TCTTAAGAAACATCGAGGCTGCTTGGTAAAACTAGTTTCTTAAAAAAACA ACGTGTATTTAATAAAGAATGGTCCTTTTAATTTAAATAACTACAAGAGT ATTGAACTCTGAATGAAGTTGCACAGTCCATCAACGACATCTTACGTTTT ATCCTTCTGTTTCTCCACCTTCAGGACGGTGATCGCTTTTGGAGGATGCC AGAATGTTATGTTCGAGGAAGCACTGTCAAATATCTACGTATCCCTGATG AGGTAAGTACTGAGAGATGGCTGTACATTTGATATTTAATTTGTTGAATA CAGCCGTTTTAAAAGTACAGTCTCTTCACAAAATTTACTCCGTGAAATCT GTTTGTGAAGCTAGATTATGCGCCATCTTTGATAGATAGACGTCACAATA ATGCTTTAAATTTGGAAGTCATTTCAATCAAAATACTTAGCAAGCAAGCA AGCAAGCTTCTACTGTAGTCTACTGCGCTTTACCTTTGTCGTCTTTTAGC AAAAAATAGTTCTTTATTTTGTTTCACTTGCCGTGGCTTAAGAAAGAAAG AGAAACTACAATCATGGTCGAAACATATTGAGGTTTTAGTGTATTTTCAT GTTTTTCACAATTTAAAGTTCGGGCAAGAAATGCTATTTTAGCACTTCCA CTTTCTTTCATTGAATATTTCGATTCAGGATGGGTTCGGTGGCTCCTAGG CTTTATTCCATGCCTTTTTGGAGCAAATTTTGAGCTTTTGAATCCTCAGA TCCTAAGGTCTTAAGTGTTAAGTCTCATGTTAAAACTCTACTTTCCAACT GTAGTTTAACGCGCTTAAAAATCATTTGTGGTGTTTAAAATTTCGGAGGG AAATCCCCTTTGTCTCAAATGCTTTGTCCATGATTGTAGTGGTTTATATA TGATATCTGTATTTGTGTTATCCAATTTATCACAACTAGCTCATTAAACC TCATTTAACAGGTTATTGATATGGTGAAAGAAGACGCCCTTCAAAAGAAC CGACAACGCCATCATAACGCCAACAGACGAGGTGGTCCAAAGGGCGGACG CGGTGGTCGAGGTGGACATCGTGGTGGTCGTGGTGGCGGCAGAGGGCGCC CTGATAATGCTGAACGATAATTTTCATCCTGAGAATTGCTTTGTTGTTTA TTTTATACCGTTGTTGTTGTTTTAGGGTTTCACGCCCTGGTATGATTTAT GGGACGCCCCTAACGCCTGTTGCTTCAAAGAGACATGTATAAATGAACGG CCCTTTTAACGGCAGAATGAATTAAAAAATTCATCTTGATGTTTCTAGAT ATAGAAAAACTATCATAATTACTATTCGTCCTTAATCAAAAGCATTATGA GACGTTTTGTACTGGTTGAAAAGACCAAACAAAGTTGGAATTTTTATACC AGAATTTATTTGTGTTTTTTTAGCTCTTATAAATTTTAGGGGGAATTTTC CCTCTTTTTTTAATTATTTAAATCAAGAAATTGAATTTTTATCAACTTGA AAACTTTAAACGTTTCAATTTGTCTATACCTAGAAAATAAATAGTTTTTA CAATTCCAC

Coding sequence (CDS) from alignment at scaffold_91:392060..397118-

>TCONS_00073413 ID=TCONS_00073413|Name=TCONS_00073413|organism=Clytia hemisphaerica|type=CDS|length=1632bp|location=Sequence derived from alignment at scaffold_91:392060..397118- (Clytia hemisphaerica)
GTGTTGTTCAAAGTGCAAATGGTTCCGCTTACTTGGAGACGTCCGGTACC
AAACTAACGTGCGCCGTGTATGGGCCACGTGATTACGCTAAACGTCATCA
ATTCCGATCTTCCGGTAAACTCACCTGTAGTCTCACGTTTGCTCCCTTCT
CTAAACCGCAACGTTTTACTGAAATCCGGGACTCTCTAAGTACGGAATAC
TCTAATTTCATAGCAGATTCTCTCATGTCCGCAGTATGTCTTGACGCTTA
TCCGAAATCTCAAATCGACGTATACGTTAATGTGTTGGAAGATAACGGGA
ATACCTTAAGTTATGCTATAACGGCTGCGTCCGTTGCGTTGGCTGACGCT
GGAATCGAAATGGTAGATTTGGTGACGTCATCAAGCCTCGTTTTTAATGA
TGACGTCTTTTGTTTGGACCCAGACTCCAGCGAACAAAAACACAAAGACG
TTTATGGGAAAATGTCCATAGCTTATCTACCATCTTTAAATAAGATTTCG
TGTTTGCTTCAAGATGGCGCAGTGGAAGTTGAACGTTCTATTGAACTTGT
GAACACGTGTTTAGAGGGTTGCTTAAGGGTACATGACGTCATGAAAGAAT
GTCTTTTAAAGGCACCTAATACTGACGAGGAGAGTTGAATGCCGCTTCCA
GATAACCGCCGAATCAATGGACCACGTGAAACTTATCAAATCACCTCATT
TTTGACGCCACAGCACAACGACGCCGATGTGCCAAGCACCGGGATTGTGA
ACGATAAAGGATTGAGGAAAGACACACGACGTACAGATGAAGTGCGTCCG
ATTTATTTGAAAGCAGGTGTTGTTCAAAGTGCAAATGGTTCCGCTTACTT
GGAGACGTCCGGTACCAAACTAACGTGCGCCGTGTATGGGCCACGTGATT
ACGCTAAACGTCATCAATTCCGATCTTCCGGTAAACTCACCTGTAGTCTC
ACGTTTGCTCCCTTCTCTAAACCGCAACGTTTTACTGAAATCCGGGACTC
TCTAAGTACGGAATACTCTAATTTCATAGCAGATTCTCTCATGTCCGCAG
TATGTCTTGACGCTTATCCGAAATCTCAAATCGACGTATACGTTAATGTG
TTGGAAGATAACGGGAATACCTTAAGTTATGCTATAACGGCTGCGTCCGT
TGCGTTGGCTGACGCTGGAATCGAAATGGTAGATTTGGTGACGTCATCAA
GCCTCGTTTTTAATGATGACGTCTTTTGTTTGGACCCAGACTCCAGCGAA
CAAAAACACAAAGACGTTTATGGGAAAATGTCCATAGCTTATCTACCATC
TTTAAATAAGATTTCGTGTTTGCTTCAAGATGGCGCAGTGGAAGTTGAAC
GTTCTATTGAACTTGTGAACACGTGTTTAGAGGGTTGCTTAAGGGTACAT
GACGTCATGAAAGAATGTCTTTTAAAGGCACCTAATACTGACGAGGAGAG
TTGAATGCCGCTTCCAGATAACCGCCGAATCAATGGACCACGTGAAACTT
ATCAAATCACCTCATTTTTGACGCCACAGCACAACGACGCCGATGTGCCA
AGCACCGGGATTGTGAACGATAAAGGATTGAGGAAAGACACACGACGTAC
AGATGAAGTGCGTCCGATTTATTTGAAAGCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045558XLOC_045558Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073413-proteinTCONS_00073413-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073413-exon-scaffold_91-1575043694:396855..397118TCONS_00073413-exon-scaffold_91-1575043694:396855..397118Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1575043694:394905..395983TCONS_00073413-exon-scaffold_91-1575043694:394905..395983Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1575043694:394529..394570TCONS_00073413-exon-scaffold_91-1575043694:394529..394570Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1575043694:394061..394159TCONS_00073413-exon-scaffold_91-1575043694:394061..394159Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1575043694:393367..393444TCONS_00073413-exon-scaffold_91-1575043694:393367..393444Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1575043694:392060..392657TCONS_00073413-exon-scaffold_91-1575043694:392060..392657Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:396855..397118TCONS_00073413-exon-scaffold_91-1510915933:396855..397118Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:394905..395983TCONS_00073413-exon-scaffold_91-1510915933:394905..395983Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:394529..394570TCONS_00073413-exon-scaffold_91-1510915933:394529..394570Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:394061..394159TCONS_00073413-exon-scaffold_91-1510915933:394061..394159Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:393367..393444TCONS_00073413-exon-scaffold_91-1510915933:393367..393444Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1510915933:392060..392657TCONS_00073413-exon-scaffold_91-1510915933:392060..392657Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:396855..397118TCONS_00073413-exon-scaffold_91-1491911889:396855..397118Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:394905..395983TCONS_00073413-exon-scaffold_91-1491911889:394905..395983Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:394529..394570TCONS_00073413-exon-scaffold_91-1491911889:394529..394570Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:394061..394159TCONS_00073413-exon-scaffold_91-1491911889:394061..394159Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:393367..393444TCONS_00073413-exon-scaffold_91-1491911889:393367..393444Clytia hemisphaericaexon
TCONS_00073413-exon-scaffold_91-1491911889:392060..392657TCONS_00073413-exon-scaffold_91-1491911889:392060..392657Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:392060..397118 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
47.0066 44.438 31.2957 30.0943 27.539 22.2849 28.5223 33.5091 31.7659 29.7049 23.7107 21.9688 18.8543 21.5648 23.5323 25.4753 38.1817 33.7762 12.0622 13.2695 24.2979 24.9297 65.3852 54.1371 26.2595 28.6982 27.4777 23.3109 32.7171 34.4439
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001247ExoRNase_PH_dom1
IPR027408PNPase/RNase_PH_dom
IPR015847ExoRNase_PH_dom2
IPR020568Ribosomal_S5_D2-typ_fold
Blast
BLAST of TCONS_00073413 vs. Swiss-Prot (Human)
Match: LSM4 (U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens GN=LSM4 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.375e-50
Identity = 76/88 (86.36%), Postives = 85/88 (96.59%), Query Frame = 3
Query: 1341 VLPLTLLQTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDRFWRMPECYVRGSTVKYLRIPDEVIDMVKEDALQKNR 1604
            +LPL+LL+TAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGD+FWRMPECY+RGST+KYLRIPDE+IDMVKE+ + K R
Sbjct:    1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGR 88          
The following BLAST results are available for this feature:
BLAST of TCONS_00073413 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
LSM44.375e-5086.36U6 snRNA-associated Sm-like protein LSm4 OS=Homo s... [more]
back to top