Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073412 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073412
Unique NameTCONS_00073412
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2399

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073412 ID=TCONS_00073412|Name=TCONS_00073412|organism=Clytia hemisphaerica|type=transcript|length=2399bp
AGGAAATCCCAGAATCgcaaaaaactttgaatttatGTGTTACTGGTGGT
TACTTAAACTGGTATAATGATGACATTCGTTCTAGGGATTGTTATATGAA
TTCATTGGCAACGAAGATTGAAGATAACTCAAAAACTCACCGGGACTGTT
ACATTTTGGCTGGACATTTTCGGTTTTCTTCTTGTCGTCGGCAATAACGG
CATTTTCATCTTTCAACTTATTTGTGGAAGATAAACTGTCTTTCGGTACA
TCTACTGATACTAATAAGATCGGCACGGATCAAGCCGTCggaaaattttc
ataaacatTAAACCATTTTTATCGAGTAAGGGGAAATATTTGAAGAACCG
TTACGTAACTATAAAAGATAGTCATCTTGTGTTTAACATATCTTATCGCA
ACTCTCTCAACATTACAAGAAACTCGTTTTTTACTTGAAACGGAAAAAAA
GCGTAAGCGCTTAAGTTGCTGTGACGGACAAAAATATTGGAGAAAGAATT
ATTGTTTTAATTCTTTGCAGAGTTAATAAAAAAGAAGGCATATTGCATTT
ACGAGTATCTCGCCGTGTTCACTCGATAATCGGAAACGTTTTGCATACAC
AAGGGACAGAAAATTTGGGGATATTTTTCATCGATGAACCCTAAGAATTT
ACGAATACTCGAAGCAGCATTCTAAAAAGGCATCAATTCAGTTAAACGGT
AAAAGACTTGAGTCtccaaaagatatttgtgaATTCTGTGGCGTTTTTGC
ATATCCGAGTGAACTCTACGGTGAAGATCAATGGGTTGTGAAATCTCTAC
ACATAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTG
AGAAGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGATCCAATA
CAATACAGTAACCAACCGCCTTCTgttcaaaagtttttaaatcCAACTCG
TTATAAAAGGGATGAAGAAGTTTATATCAACAGAACGATCGAACCAGACG
TGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCTCTAT
CAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTGGCGT
TGAAATTCCTAAAtatcggaaaaatgaagaagacagAtgGAATCACAACA
CACGAAAGCACAAAATGAAAGCTCAATACACGCATTTGAAACCTGACATG
AATTGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATCCATGTCG
TGTATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAAC
TCGACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAA
GGATGGAGTTGTTTTAATTGTGATAACTTAGTATTGGAATTATTTGAGGA
CGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACCCTG
AAACAGATACTGATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAA
CAATTTGAAAGTGAAAAAGTTGTGGATAAAGTtactgaagaagaagaaat
acgCGCCAAGCAAGAGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAA
AAATCACTGAAGAAGAAATGATAAGAGCCAAACAAGAGTTTTGGATTTTG
GATTCAAAGAAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACGA
AGCGATTAAGAAGTTAGCCAAAAGACCGCAGAAAGATCTTGTCAATTTGC
TCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGAC
AAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACAC
AAGATGGCtgaaaaatcttttggtggtTTCTGAAGGCATTTTACCAAGAA
CAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGCG
ACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGTTATGTAAC
ATGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTC
TCAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAG
CCGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCG
TATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTA
CTTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAA
GTTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGT
ACATAGGTGAAATGTTTGATTTAGGATTTTAACCGGATGACATATACTTC
ATGAAGTTTCAATCTGGAAAGCGCTGGAGGTTCAACTGTAACAGAGATG
Run BLAST on NCBI

protein sequence of TCONS_00073412-protein

>TCONS_00073412-protein ID=TCONS_00073412-protein|Name=TCONS_00073412-protein|organism=Clytia hemisphaerica|type=polypeptide|length=509bp
MGCEISTHNRVDDVSSTTTESEVEKGGVKQRLFLIPRDPIQYSNQPPSVQ
KFLNPTRYKRDEEVYINRTIEPDVVGERIAITDEEKPVLYQLEKERRQKV
WEYRPGVEIPKYRKNEEDRWNHNTRKHKMKAQYTHLKPDMNCFLCGVYTN
TKTYPCRVCLRSFHDACLQKFGKLDPVSRALMVNQAETEEGWSCFNCDNL
VLELFEDEVAELQQLAHKCNLNPETDTDITKEEYIEFRSKQFESEKVVDK
VTEEEEIRAKQEINDCLWSRNFVKITEEEMIRAKQEFWILDSKKTGSLGM
RDFLNHEAIKKLAKRPQKDLVNLLSEKEIYDLEMTFRELDKDGDGMITAE
EAQLVYTRWLKNLLVVSEGILPRTINAPIFVDDERKIGDATQAPVVQGAD
RGSGYVTWQEYLLDQAIYALASRLNKPAVHVVVNELEMKKPVGERKVVFA
ADNENIRIMHARIQAQQVADVGLTLDPVVTGPFRAAGLPEVTDERDIGQV
ATEQVLVHR
Run BLAST on NCBI

transcript from alignment at scaffold_91:370444..386796-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073412 ID=TCONS_00073412|Name=TCONS_00073412|organism=Clytia hemisphaerica|type=transcript|length=16353bp|location=Sequence derived from alignment at scaffold_91:370444..386796- (Clytia hemisphaerica)
AGGAAATCCCAGAATCGCAAAAAACTTTGAATTTATGTGTTACTGGTGGT TACTTAAACTGGTATAATGATGACATTCGTTCTAGGGATTGTTATATGAA TTCATTGGCAACGAAGATTGAAGATAACTCAAAAACTCACCGGGACTGTT ACATTTTGGCTGGACATTTTCGGTTTTCTTCTTGTCGTCGGCAATAACGG CATTTTCATCTTTCAACTTATTTGTGGAAGATAAACTGTCTTTCGGTACA TCTACTGATACTAATAAGATCGGCACGGATCAAGCCGTCGGAAAATTTTC ATAAACATTAAACCATTTTTATCGAGTAAGGGGAAATATTTGAAGAACCG TTACGTAACTATAAAAGATAGTCATCTTGTGTTTAACATATCTTATCGCA ACTCTCTCAACATTACAAGAAACTCGTTTTTTACTTGAAACGGAAAAAAA GCGTAAGCGCTTAAGTTGCTGTGACGGACAAAAATATTGGAGAAAGAATT ATTGTTTTAATTCTTTGCAGAGTTAATAAAAAAGAAGGCATATTGCATTT ACGAGTATCTCGCCGTGTTCACTCGATAATCGGAAACGTTTTGCATACAC AAGGGACAGAAAATTTGGGGATATTTTTCATCGATGAACCCTAAGAATTT ACGAATACTCGAAGCAGCATTCTAAAAAGGCATCAATTCAGTTAAACGGT AAAAGACTTGAGTCTCCAAAAGATATTTGTGAATTCTGTGGCGTTTTTGC ATATCCGAGTGAACTCTACGGTGAAGATCAATGGGTTGTGAAATCTCTAC ACATAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTG AGAAGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGATCCAATA CAATACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCG TTATAAAAGGGATGAAGAAGTTTATATCAACAGGTACTTTTCGTTTTATG TTTTTTTTCTCAATTGAAAAAAAAATCTAGCTTGTAGCTAGATTAAGTCG GAGACGGATAGCTGTTGAACTACCTTAAAGGAAGAAAATTTGGCGGATTT CCGGTTTCGCCAAATTGGTTTTTTCTACCATTTCTGCTAATTTCCCGCAA AATTTAATTTATGCCATGCATTCGCTAAATTCGTACTATTTCAGGTCTTC AAACATGTTTTTAGTTTATTTATAATGATTTTTAGCCAAAAACATCCTGC AACCGCCAAATTAGATTCCCTCTAAAATCCACTAAAACCCTGGGAATCGT GTGAAAACTCATTTTCAAAAATTTCAAATTTTGCTATCTCGATTTTGGAA AATTGTTGCACAAAATTACTTTGAGGTTTTACTAAGGACCGCAGAAGGTT TTTGTGATCTAAATATCTCAAACCATCTGATTATCCCTTTAAAGATCTTA AGATATACTTGAACCTCAAATTGTACTTGTTTAAGGGTTTACCACCGTTT TGCCGCTAGTCCAGGGGGGTCAGTGTACTAGAAGGCGGCATGTATGTGTA CTACAAGGTATTTTTCAAAACTTGCTTGACACCCACCCACCCCTGAAATA CACCATACTACATGGAAAAATCCCAAAACCACCCCATACCCCCTATTTAC TACCGGGTAGTACCTGNTGATTTTGGACCCAACACCCCAATTATAGTACA CAGGTAGTACATGACAAATTTTTGTTCTCAAACACCCACCCACCCCAGGA TACATGCCACCTTCTGGTACACTGACCCCCCCCCTAGCTAGTCTTCTGTT ACTGTAGGTTTTTTATTATCATGAAGTTATTAAAGGTTTCATTTTTAAAT AAAAGTGATATCATAAATTTTATTTTTCAGAATGCTGAGAAATGAATATT GTCTAAGTTTTTTTGAAAAATTCAAAGACCCTCTAAGGAATTGAATTGAT TTTTTTGCAGATATAGATCATGTTAGCACGTAACGGTTCCGTTTCGCTCC GAAGCGTAATGAATGAAGCCATTCTGGTTACATTCAAGTTTTACGTCACT TCTAACCAATAGGATGGCTTCATTTTGTTTCGGAGCGAAACGGAACCGTA ATGTGTGAACATGGTCATAGAGTCAGTTAAGGAGAAGAAAATCATACGAT TTCTTGTTTATTTAAAGAACGATCGAACCAGACGTGGTCGGAGAGCGAAT AGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTGGAAAAAGAAC GTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAATTCCTAAAGTA AAATGTTTTCTGAACTGCTCTTCATTTTTTTCTGCAATTACACACAATAC TCCTCAAAACAAAAAACGTATTATGAAATTCTCTGTTGGATGCGACAAAA CTTTTCAAAGATTGCTTCACCAGATTAAAATACCATATCTGATAAAATTT TGAGCAACTTAAAGTCTCACAAGAACCTCAAAAAGTTTGATCATAATAGT TGATAATTGAAAATGTTACCGTAAGTTTGTCTGATGTTGGTGAATTTTCC TTTGTCAAGGTTATCACCTTTCTCGGAGAAAGAAAAGAATAGGTGCAACC AAACATCAATAACAGATTTGCAATCCCTTATTCTCAAATAAAAATCTGGC GGACTGTCTAAGCAAAAGCATATTACCATATACCACGGGGCCACTTAATT CCGCCATCCAGTCTATAAAAGAAACTTTAAGTGGACCCCGGGCTACCACC CAACATACATATTATATCATAATCGACTCTTCAATTTCTTTTCTTTTTTC AGTATCGGAAAAATGAAGAAGACAGAGTAAGGATTTCTTTCATCTGGTTA TATTCTAACATGTCATGTATTTTTAGTGGGGTGAACTTTTTGTGGAGATT AAATTTCACACATTCCTGGGATTCTGGTGTCATTCGCGAAAGTAAGTCCA AAAGGAAATTTTATAGATGCTAGAAACCCTCTTCGTGAGAATTATTGCCA TTTTAAAAGAATTGATGTTTTTCTCGTCTGCGAAAATAAGTCCCCGCGAT ATCTTGAAATTTCCAAGATAGGCTCATGTGTGAAATTTAATCAATCCCCA CAAAATTCCATCCAACTGAAGTCTTTTTAAATTCTTCGGCACCATCGATG GTAATTTCAGGGTCTCAAATACCAGAGGATTTTTATTACTTCTTCAGGAA AGATATTAAAGGAGGCGTTCAAATTAACCGTGTGAAAATTTGGTCATTTA GGGAAGTTTAGTCATTGGACTAATTTTGGAATGAATTCATTCTTTCTAGA AAGGGAGGAAAGGCTCTAATCTAAAGCTACCCAGAGTTTGGGAAGTACAA TGTATAGAGATATTTTTTCGGGGATAAGAAAGTCGAAGAAAAGTTTATCG GGTGATGAAAGTAGTGGAAAACTTGTTGTCACACCCTCTTTTTGGCTGCC TTCCCAACTTCCTCGGCCAACTTTTTTTCACCAAAAATATCTCAAAAGAT TATCTTCAAGCAGAGATTACTGCAGTTTGTAACCTTGATTCCATACCCCG GCTCTTTTTTTACCCAGTTCCCTTAATGTGTTATACGAGATTGCAAAACA TGGTATTTGCATTTGGTATTTTATTTTGATCATTGTTTTGTTGTTGTTTT TTTCAGTGGAATCACAACACACGAAAGCACAAAATGAAAGCTCAATACAC GGTATGTATGGAAAACCTTAAAAATTAAAATATTTGCATATGTAATCGGG ATGAATGTGTTGAAATGTCATTTTGGGGCGCTTTTTTCACACATCCTTTT TGAGTCCTTTTAATAGGCTAAATATACTTCTCTAAATATAGCTACCTGTA TTTAAGCACTCCCCCTGGTTAAAGGGGGAGTTTCTAAACGTCGACCAGAA ATGACGACCACGACCGGCGACCACGACCAGCGACCAGACAAGTTTGGGTT ATCGAGTTTTTTCCCTTTCTCCAACGTAGAGTGTCTCTTCTAATTATTGA ATATATATCATATAGAAGAGTAAGCTCACCCCTGCCTCGTCTATTTAAAA GCCACGTGCCAAATACCCAAAACAACCATCTCGACGCTCTTGGAGCTTGA TTATGTTGTCAATTTCTATCCTTTTGTATTATCAGCATCAAAGTGGCAGT TTTTTGAAAATTATTTGAGAAGCTTTGTATTTCATCATCAGATTGTTATT TCTGTCGAAATTCGTCATTTTGTCAGCATAAAGACAATAGAATAATTGAT TAGATTCAAATCTCTAAAACTGGTCTTCCCAATATTTTCCTACTGCCAAG TTCCATCTATTCATACTAAAGGCATCCCATTCAGCATAATTAAAATATTT GGTGTAACAAAGCTTACAAACATCATACTTACTGACCCAGTCGATATTTT TGTCAAATAGTGTCACTTTGTCAAGAAAATGACTGGTTACTTCAAAGGTC ACTTTTTAGTATTCTGCGAGGACTTGATTAAAATATTCTCTACGGTGGAG AGAGCAGATAAACTCGATAATCCAAATTTATCTGGTCGCCGGCATTGAGT TTAAAGCCCGAAGGGCTAGAGGTCAATCTTTAACCTTTCTTAGGCAAGAA AAATTGAAGCCTTAAAATATGCGCCGTATTTTTGATGACGGATNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNAAAACCAGGCGGGTCGCTCAAGGCCGCGCAACTTTGGTAGGATTTG TTGGCTTCAAATCCTACCAAGGAGATTGACCTCTAGCCTTCGGCTTGAAA CTCAATGGTCGCCGGTCGTGGTCGCTGGTCGCTGGTCGTGGTCGCCATTT CTGGTCGATGTTTAGAAACTCCCGATTAAAGGTTTTATCGGCGATCCAAA AAAATATCTGCAATCTGATTGGTTAAAAAGAGTACAATATATCTTGTATT TTACATGTAAAATATAAATTGACGAAAAGATGTTGTTGCATTGTAGCGGT AGAAGCAATCTAACGTCCCCTTGCCACAAAAGTGTCCTCCAACACAAAAA GTACATTTTTTGGGTCACCGATAAACCAGTTATCAGACATTTGCTCGTAA AATATGGAAATATTTCACTCGTTCCGGATTTTCCGTATATTTTCCTCGCC TATTGTACGGAAAAATCTCGGAACTCGTAAAATATTTCTCATATTGTACT CGCAACTGTCCGATAACTATTACTTATTTTTACATAAGAGTTCCTGTTTC ATATCAGACACATATTTCATATCAGAACAGTATCTGCCTATTGTTATACT ATTGTCGTGGTGCGCCAGCCGGTTTAAGCTGGGCCCACGGTAACAACATT TTTATTTAAAAGTTTTTCCCCGGATATCGGCCTGACTGCCGTTAGAAGAC AGGAGATGGAGTTCATGGAGTAGATCAAGGAGGTGGGAGACACAAAATGT TGAAGTCTAATTTCATTCGATAACTCATTATACAATATCCAAACATACAG TTCCATAAAGCATAAAAATTCAATAACGTTCAACACTTCGAGAAGACGGG AACGCACGATCGATTCTGCCTGGCCGGTGTCATTTCCGAACGAACTCTTT ACTCTTCCTGGTACCTGGATCTCTTCTCTCATGTTAATACTCCCCGACGG GAGGACTTGCCTCGCCCGAGGCTAAAAGCGAAGTGTTTTTTCTCCTAATA AAATTTCTATCTAACGTACTCAAGGTGAGCTTCCATTCAATGGTTACCAT AACTACGAACATAAATAATAAAATTGCGGAACTATGTCCTCGTGACACTA TGCTGATATAAGCAAAAAGTTTATTTTTTCCTCTTTCTTACCAATTTTGC TCCACATCTGTGTCAATTCAATGTGAAAACGCTTATGAATTAAAAATGAT GAGTAAGCAAACGATGTCACTCTTATTTAAAAACAAAACTTTTAAAGGTT AGACTGATGAAGAATTTTTAGGGCGGTTTGATTTTCTAAGAAACATAAAG AATTTAGTGGAAGGAAAAACGAATAAATTTTTCATCGTCTACTTTCCTAA TATTCTATTCGATTTCTATTAAAATACTTTAAAAATAATATGGTCTATGG TCCAACCTTTACATAGAAGAATATAATACTGTATTTATTATGCATCTAAG CATTGCCCAAATTAATCTTGACATCACGAAATTATAGTGTCAAGATAAAA AACAGAACAGAATGATAATGAAGAAAAATTCCTCTCATAGTCTACAGTTT TCATAGTATGTATTTTATGGCCTAATAGTAATACTACCTTTTCGACCGTA GTCGTGCTGTCAGACCCGTGTCACTTTATAATTCAATTATGCCCCTAAAC TCGATCCAGTCCTTTTTGGCACCTTTTTCTATTGTCTATAGGGACGAAAA AAAGACTGGGACGGTTTTAGGGTGGTAAAATGAACAAAAAATTGTCCACG CGGAAATTAGCAGCTACGGTCGAAAAGGTGTATTGTTAGATCTGTGTGTC CGCATTGCGAGCTAACAGGACAAGTATAAACCATAGCGAAGATAGTTCTA AAGAAACGATTCCTAGACCATTTTATACAGGACCAAACGTCAACCAATTT CTTGTTTTCTTTGATTGCCTTGCAGTGTTTTATTTCGGGCACGTCATAGT TTCTTCAGTTATTCAAATGGCCATTTAAAACTCCGGTATTACTCAAAGTA TATAAAAATAAAAATTTGATTTACATTACGACCAATGGATGATCGATTCT TGACAAAATCATTGATTCGCCTCAACCAAAACCTCCCGAGCAAAAGTATC ATCTCAAGCAGGGAACTATAATGAAACATCATATTTAAGTTTCTTGCTTC AACTTTACTAATTTTCATCAAGCTAAATTTTCCTTAAAAGCTTTTGGTCC TGTAGGCGAAGGACGGGCCAATCTCTGTCAGAAGTGGGGTGCGCCGCGGC CCATACCGCCCTGTTCTTGACTCTGTCTGAATATAAAAATTAAGGGCGGC ATTTCTTTCTTAGTTGCATTAATCAAAAAAATTATTTAAAATTACAGAGT GGTTGAATTTAAAGGGTTTAAGAAATTTCTAACAACTTTTAATTTATATT TCCAGCATTTGAAACCTGACATGAATTGTTTTCTTTGTGGCGTTTACACC AATACAAAAACATATCCATGTCGTGTATGTTTACGTTCTTTCCACGACGC ATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTCCAGAGCGTTGATGG TGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTTTTAATTGTGTAAGT TTTCATCAAAATTTATTTTTTTTCAAAAAATTAAAAACATTACAGGCTGA GACGATCATCAGATGTTGAATAAAAAATTTGAAACTGAGGAAGGATGGAG TTGTTTTAATTGTGTAAGTTTTCAAGATATTAACAAATTGTGGAAAATAG TTTTTAGGTTTTGGTACAGTACCGTAACTTGGTCTGATGTCGACACCCCT CCTCTAATTCCGACACCCTTTTTATCAGCTGAAATTTATAGAAAGGTTAA AACTGTTTTTCTTTGCTTAGTGGTCAGAGAAAATAATCCTTTTTCAATCA GTGATTCAAGCTTTCATATAGATAAATAGTGATAAATAGATTTTGGGTTT TGGTACGTATTTAAGAAAGCGGCAAGCAACAATAAACTACAATTTTAGCC CTTTTTATAAAAAATATGTAGAGCTTTATATCTAATCAATATTATCACTC AACTAGATTTTAATCGTTAGAAAATCGGTAACTAAATATCTTACCCTAGA ATATTTAAGCATGAGCATTCACCTGTTGATCATGTGATCTAGAGTTTACC CTGATGACGAGTTAGTAAAGACTCGAAAAGCTTTGTTCAATAAAATCAAA ATTTTGATGTTGTTTATTTGTTTGAAATATGATTAAGTGGCTTGGAGAAA AAATGAAAAATTGATAGTTTTTTGGTATCAACTTGCCATGGGGTGGCAAA ATAACGACGTCGATATAAGAAAAATGTGACTGTTTTTCGGTGTTGGTGAC CCTAATACGCCCATCCCCTTGTAATTACGTACTATCTAACCGTTTGATGT TTTTATAATTTCTCAGGATAACTTAGTATTGGAATTATTTGAGGACGAAG TAGCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACCCTGAAACA GGTATTCTTTTACTTGTATTACTTTGTTTTGAAACTCTCAGTTCTCATAG ACTGGCACGCCAGTCGGTCTGGATCGATTTCACAGGGGAAAGTGAGCGTA GGAGTTAGGTAAGCGTAAAAAAACATTTGTGAGCGGGAGGGGCTGAAAGT ACTAATCACCCTCTCAATAACCTTTTCTTGCTCTCCGATGCAGCTTCTTT TTTTGCCAAATGCCCGTTCGCCCTTTAATTCTCGCCCTTTGACATGATTA ATTGAAAGTCTAGTTTCCTAGTGCATAGCTCCCGTGGTTTTATTGTGTCT TAGAATATCCCTGGGCTTAGAACAAAGGAAAAATGCCCGCGGCTGCAAGG GTTTGACCCTTAGATGGATTTTTTCACTACTGTTTATGCTTTTTTCTTCT TTGTCATTTTTGACCCGATAAAATTAAAAGCGACCATTAGAAATTCTGTC TTTGACGTTCTGTAAGTAAGCCTTATTAGAGAAACTACAATCATGGTTGA AACATATTGAGATTTTAGTGTATTTTGACGTTTGACTTGACTTGACTTAT CAGCACACCTCTGGTTGAGGCTTCGCCAACTTGTGAACTTTCTCTCGCCA TCTGGTTCTATCACGTGCGTATCGTTCGGCCGTTGCTAATGGAAGACCTG TGTCTTCCCTGATTTTATCTTGCCATCTTTTTGNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGTCTTGCTACATGCCCAAACCAAGACAAG CGTCTCTTTTTGATCATATAGACAATCGGCATTTTGAGCTTTGCTCTCTT ACGTAGCCGTTTGAGTGATATCCTGTCTTGGAGTCTAATCCCCAGTATGG AGCGAATACAATTGTTTTCAAATACTGAGAGCTTGTTTTCATCAAGCTTT GTTAGAGACCAGGTTTCCGCGCCGTATATTGCGATTGGGAGAATGAGAGC TTTGTACAGTCGAATTTTAAGAGCATTTGAGACATCTCTCCTTAACCAGA TCTTTTGTTTTAATTTTCCAAAGGCAATATTTGCAAGTGCAATTCGTCTT TTGACGTCCTTGGAGGTACTAGGAACATTTGATCCAAGGAAAATGAAGTC TTAACCAGACTCAACATTTTTATTGTCGATTACAACTTGCTGAGGGCTGG CTGTGATGGCTTTGCATTTTGTAGCATTGATTTTCATGCCGTATTACAAA CAGGCGTCCTGTAGTTGATTCGTGGAGAGTGACGTTTGACGTTTTTCACA ATTTAAAGTTCGGGCGATAATTGCTATTTTAGCACTTCCACTTTCTTTCA TTGTTTCTAGGCTACATTTCAAGCCTTATTGAAGTAAATTTGAGCTTTTA AATTCTGAGATCCTACATTCCTAAGGTCCTAAGTTTTAAGTCTCATGTTA AAACTCTACTTTCCAACTGTAGTTTAACGCGCTTAAAAATCATTTGTGGT GTTTAAAATTTCGCCGGGAAATCTCTTTTGTCTCAAATATTTTGTCCAAG ATTGCAGGTAAAGTGAAAACCGACCCTTTTAAGCACACTCATACCCCAGC AATAAAACACGTGTGTCCACTTTGATATTTCTCTTTTTATAGATACTGAT ATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGTGA AAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCAAG AGGTTGGTAAAATCCCTTAAGGCCGGTCTCCACTTTCGCGCGACATGAGC GAAAACTTTTTGACGTTTTTGTAAGGTCATTGGTCGGTTGAAAAATGAAG CAATTCCATTGGTCGAAATTGACATAACGGATGAAAAAAGAACTTCCTTC AACTTTTATTTTGTTCGCGCGAAACTTTTTTATGACGTAATCTTTTTTCA AGGTTAAGAAGAAAACTATCGCCCATTTCGCGTGAAAGTGGAGACCGGCC TTTAAATTTTAATTATTCCTTATTGTGGTGAAAATTTCCCAAGATTCTTA CTACAGTTGACCCTCTCTAATTCGACGTTCTACTATTCGATAGGCTAATA TAGAGATTCGTTGAAATTTAAAGTCCCCGTCAATAAGAAACTTGTAAACG GCGCTTCCTTATTCGATAAGCTCCCTTATTCGATGAAAATCCAATTCCCC TTGAAGATCGAATAGAGAGCTTCACCTGTACTTGCGAGTTAATTTTAGCG AGGTTTTTTTCGCGAGCCAAAACAATCACGTATAGAGTTTCTGTATTCAT TTTCGCAAATCAGCATTTTTAGAAATTTGGCGCGAAGTCGGCCAAAGATT TGTGAAAGCAAAATATAGCATATTTACAGTATGTTTCATGTTGAAAATCT GATTTAGAACATCTCGCATGGATTGAAATTTTTTTTTAAATTTGAAAGTT TGTAAGTCTGTAAAATTTGGGATTGGATCCAATCTCGTACTCATTGCTCC TTGTATGACTTTTTGTTTTACTAATTGACATGATGCAAACCTTTCGTGAA CGCTGTCAGAATTAAAAAAACGCGAACTGAAGTGCTAGATTCGAGTTTCG ATTGGATCCAGGGGAATCTTACTTGGGGATAAGCATCTAAAATCCCAACT GACACCTCTTAGTATATCCTTAATTTGGATCTCACAGAGACGCATTTCTA CGTACCGGGTCTAAGGTCCCACAATGTTAGTGTAACTTATTCATGATATT CATGATGTAATCTTTTATACGGAAGCACACAAAATAATCCGGAACTAGTG GCAAAATTTGCCACTAGTCTTTTGTTATTTTGCCACTAGTTTCGGGTTAT CTCGGGTGCTTCTGTATAAAAGGTTACGTCATGAATATCATGAATTAAAG ATAACCTAATGAAAGTTCAACATTTGTTTTATTAATAATATTAATAGCGT AATGTTTGATACGAAAATATCCAATAGCTCGGACGCTTGCCACTAGTTTC ATTATTTAGATTCAAAATCAGTGCCAAACGCCTGGTCTTTTTTGGGTGCT TCTGTATAAAACATTTCGTTAGGCGTACAAACTTTCGCAGAATTTACGAC ATTTACTTTCGCGAAAAGGGCTTAAAATTCGCGAAAATCGTGTGTAAAGT TTCACAAATGATATGCTTTTAATAATATGCTTTTCTCACAAACTGAAGTA TTATTAATTGTGATAAGGCACTGGACTACGAACGTTTCTGTTCGTAAAAA TTTGCACACCTAAAGTGTCTAAAGTACATCATGAATATAGTTTCTATCAA TATCTTCTTCGTCAATTCAGATAAATGATTGCTTGTGGTCTCGTAATTTC GTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACAAGAGGTGAGACA TCCTTATAGCTCTTCATAGATTAAGTTTCATTTTTTATGCAGGAATCCCT TTAAGGCATCGTCTACGTCTACCATAATCTGTTCTGTTTTGTCCTCAATA TTCATGTTATGCACACATTATGGAGCCAACAGCTGATTGGTTACCATAGT GACGTATTGACTGATTTTATGTCACTTACAACCAATCAGCTGTCGGGTCC ATGATGTAATGTCAGAAGACATTGATATGAAATTTCCTCTACGTGTTGCA AATTTCTGTTTTTGTAATGTCACTAAGGTAATATATTGTAGGTCTCTTCT GAGAGGCTCAAAGAAATACCCAAGGTTTGTCAAATGTCCTAAAAAGTTTG AACTAGTCCTTGCTAATTCCAAATCTTGGAATGATTATTTGATAAATAAT TTTACCTCCGACAAGGGAGATAATCCAGATTTACATCAAAGCTCCTCTGC CAAAATTGAAATCTGTTTCTTTCCCAAACAGGACATTGCGTTCTGACACC CTTTTCCATTTCTAAAAAAGGAAATAAACCTTTGATTTGGAACGTACAAC ACCACTCGGCTACGAAGTAATCGTGGTTGTCAATTCGATAAATGAGAATT GAAATAGCAAAGTTTGCCAGGAAAATTCTCGCAAATCGTGTTTTAACCTC ATATTTGGACAGCATGCTAGAAAGAAAGCACTCAATATTTTTTTATGAAC CATTGATATAGGAGTTGTGACTGGATAGATGATATAACATCCTTTCCATA CGCCTTGGCAATGCCGCTTAATATTAGGTCTTTCTTTTCTTTTCAAAATT CTCAGACCAAAAACTGTTATAGTTCAATTTCCCGTTGTCGAGAACCTAAG GTTTTCAAAAAAAAAAATTTTTTCAACGATTTGGTTTAAGGTCTGAACTC ACCTCCATCCTAAGTTGGTTCTACTTGTGAGCCAGACCATCACCTAGGGC GATTAGTGAGCGAGAGGTGACCTCGCTTACGTGATCCATCTGTGGGGCTC GAACCCATAACCTTCCGGTCAGAAGGCGAGCGCTCTACCACTGGACCACG CCCCCCCCCCCATTTCAACCTGATTTGCCGATTTAAAGCCATTAACTCCA TAGAAAATTTCAATGAATTTTGACCTAATTTACTCATTATCCTACCGGGG CTTAAAATTAGGTCATTTTTCGCTACTTATCCAGGTTATCCACCGGGGCG GATCTTCCCGGGTTACTGATACAGGGGTGTATAAAAAGCAATATCCACTG GGAATGAATAATATTGATGACAGAGATTTCTTGTCAAAGACGATATTTCC CTAATTTAAAGAATGTCTTTTAAGACTCAGATCTCTCGGTGTGTGTCTAA ACTCTATTTTTAGATTTATAAAAGCCCGAAGGGCTAGATATCGTGCTTTT ACTGAAAAGTGTGCCGAGGTTAGGTAGAAAATCCTACCTAGGTCACGTGA CATTACAATAGAATTTCAGCGCTTCACCAATCAGAAGCTTTGCGAGTTTT CGAAAACAATAGCAGCAATATTTTTTGCGATATTCACTTTTTTTTTTTGC TTGGAAGAGCTTAAGGCACGCCATCTAGCCCTTCGGGCTTTATAAATCTA TGGTCCAAACTGAGAAAAAAAATCGAAAGGTTGTAGAACGTTTTAACAGT ATGAATATATGATTAACTTTTTAGTTTTGGATTTTGGATTCAAAGAAGAC TGGCTCACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAAGAAGT TAGCCAAAAGACCGCAGGTTGGTGTGAAAGTATGAAATTCGATTTAGAAT ATCTCAAAGGAATGAAATTTTGTAGTTGTGCTAACTGAAATTTCCAAAAA AGTATATATATATATCTCATAACATCAGGATTAGATTCATTCTAAACATT AGTATCTGTCATAGGCGAAGCGAGATACCCTGCAAAATTTATGAGGGAGT GCAGACGTTTATGACATATTCATTACCTTTTGATAAAACAAAGACAATAA TTACAGTGTCGTAAAAACTGTTCTCATCCATAAATTTTGCAGGGTATCTC GCTACGCCTATGTCTGCGAAACTGGATCAAATTTAAATGTTAGATGATAA ATAAACGTCGAAAATAACGCTATGTGTGTGTGTGCTGGCAAACAAACGCT TTTTTTATCAAATAACTGTTTTAACCTGCTTTGATTCAGTAACAAATCCA ATTAGGTCCTGGAGAGAAGATATTTTTTACGGGGTTAGAACAATCAAGAA CAATTACCCTTTTCACAACTTAGAGAAACTTGCGATGTTTGTCGATCTCA TTTGGGTTAGAGGGCAGAACGAGCACTGGGCGAAATAAGAGATTTCAAAT CCTGGAAATATCTTGAAAATATGATTTTTCCATATACATTTGTAAATGTT CTATATTTCCATAGTTTAGGATTTCATGATAAAAATATGATGTTTCAATC CTGGAAATTTTATGAAATATGATATTTCCTAAACTTTAGAACTATAGAAA AAGTCATATTTTCATATTTACAAATGTATATGGAAATATCATAATTTCAA GATATTTCCAGGATTGGAAATCTCTTATTTCGCCCAGTGGGGCGTCTAAG GATGAGTGGTAATGTCCAAATGTGAGATAAGTCCTCCACCCAATTTCTTT TCTAGAAGAGCCTTGAAAAGCCCTTTAAAAATTTACGCGACCTTGAACAT TTCTCTTTTGTTTTCTTCCGTAGAAAGATCTTGTCAATTTGCTCTCTGAG AAGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGG AGATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGC TGAAAAATCTTTTGGTGGTTTCTGAAGGCATTTTACCAAGGTAACGTTAA GACTGCATAGTTTCCATTTCTACAACGCTTATATAATTGTCGTTGAAAAT TCTTTGAAAATCTTTCAAGAAAATTTGTTAGACTCTTTATAAAGTGATAC CGAATTGCTTACGAAAAAGCTATCAATTTGAAAAAAATGTATTGTTGTTC TTTTGACTGAGAAACTTGGACTATTTGTTCAGATTTTCTAGAAATTCAAA AGCAAAATAGTCGAAACAAACTGAGTTACCTTTTCGAGTCTCTAGTATTT CCTTCGTTTTCGTAGAACAATCAACGCACCGATTTTCGTAGACGACGAAC GTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGT GGAAGTGGGTAAGACGATTCTTGTTATATTAGTCGAATTAAAATATTTTA TCGAAATGAAATAAGAAATCCTTAGGCAATTAATTAANCATTCGATTTAA AATATCTTATCAAGAAATCCTTAGGCAAGGCAAATTTGATTTGTTGTTTT ACGGACCAAGCTACCCAAAAAAGAGGGTCGGTCGGTCGGCGAAAAAACTA AATGTAAAAGTAGAATTTCACCTATAAAATCACCTAAAAAGGCCTCTTTA CAAATGCAAAATAGAAAATAAAAAGACACAAAAAGCTCGAATGCATGGAT AAAATGAAAAATTGAACTTGAAATTCTAAAAAAATGTAAATTAATAAAAA TAAAAATGTACTACCAAAATCAATTGTATTTTTATTTCGATTTTCGGAAA TTCAAGAACGTTTGGGAACTAATCAAATTAGTCTATCCCCATAGGGATTT CCATCGAAATCTTAACCCCCACTGTGGGACAAAGTTCCACCCTTGCTGTG AGCTAGGGCTGTAACATCCTGTATACGGTACAGATATACAGTTGACTCTC TTAAATTTGATGATGGCGAGGGAACGAAAAGATTTTACTCATAGAGAATA TAACTAAGGATGTCAATGTTTTAATTCCGAGATTGAACCGTTTGGATGAA CCGTTAAGAATCAGTGTAATACAGTAATATTGGTGTCATAAATGAATCTG TTACGGGATTAATTTAGTTTGTATAAATACAAATTGTTCCTTTCGCTATT TTTTGCTTATTTTCTACCATGTCTGAACTAATCATCTAGCATGCTGTTTT CACTGAGACTTTTACTTTCATTTTCACCTCTTTTCTTCTTCATAGTTATG TAACATGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGGCATCT CGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAAATGAA AAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACA TTCGTATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACGTTGGA CTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACC TGAAGTTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACAGGTTC TTGTACATAGGTGAAATGTTTGATTTAGGATTTTAACCGGATGACATATA CTTCATGAAGTTTCAATCTGGAAAGCGCTGGAGGTTCAACTGTAACAGAG ATG

Coding sequence (CDS) from alignment at scaffold_91:370444..386796-

>TCONS_00073412 ID=TCONS_00073412|Name=TCONS_00073412|organism=Clytia hemisphaerica|type=CDS|length=18360bp|location=Sequence derived from alignment at scaffold_91:370444..386796- (Clytia hemisphaerica)
TTATGTAACATGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGG
CATCTCGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAA
ATGAAAAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGA
GAACATTCGTATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACG
TTGGACTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGA
CTACCTGAAGTTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACA
GGTTCTTGTACATAGGTGAAACAATCAACGCACCGATTTTCGTAGACGAC
GAACGTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGA
TCGTGGAAGTGGAAAGATCTTGTCAATTTGCTCTCTGAGAAGGAGATTTA
CGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGGAGATGGTATGA
TCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGCTGAAAAATCTT
TTGGTGGTTTCTGAAGGCATTTTACCAAGTTTTGGATTTTGGATTCAAAG
AAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAA
GAAGTTAGCCAAAAGACCGCAGATAAATGATTGCTTGTGGTCTCGTAATT
TCGTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACAAGAGATACTG
ATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGT
GAAAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCA
AGAGGATAACTTAGTATTGGAATTATTTGAGGACGAAGTAGCAGAACTTC
AACAATTGGCTCATAAATGTAACCTCAACCCTGAAACAGCATTTGAAACC
TGACATGAATTGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATC
CATGTCGTGTATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTC
GGTAAACTCGACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAAC
TGAAGAAGGATGGAGTTGTTTTAATTGTTGGAATCACAACACACGAAAGC
ACAAAATGAAAGCTCAATACACGTATCGGAAAAATGAAGAAGACAGAAAC
GATCGAACCAGACGTGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAA
AGCCGGTGCTCTATCAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAG
TACAGACCTGGCGTTGAAATTCCTAAAATGGGTTGTGAAATCTCTACACA
TAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTGAGA
AGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGATCCAATACAA
TACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCGTTA
TAAAAGGGATGAAGAAGTTTATATCAACAGTTATGTAACATGGCAAGAAT
ATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTCTCAACAAACCG
GCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAGCCGGTTGGTGA
ACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCGTATAATGCACG
CACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTACTTTAGACCCT
GTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAAGTTACGGACGA
GAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGTACATAGGTGAA
ACAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGC
GACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGAAAGATCT
TGTCAATTTGCTCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTC
GTGAGCTTGACAAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAA
CTTGTTTACACAAGATGGCTGAAAAATCTTTTGGTGGTTTCTGAAGGCAT
TTTACCAAGTTTTGGATTTTGGATTCAAAGAAGACTGGCTCACTTGGTAT
GAGAGACTTTTTGAACCACGAAGCGATTAAGAAGTTAGCCAAAAGACCGC
AGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAAAAATCACTGAAGAA
GAAATGATAAGAGCCAAACAAGAGATACTGATATTACGAAGGAGGAATAC
ATTGAATTTCGTTCTAAACAATTTGAAAGTGAAAAAGTTGTGGATAAAGT
TACTGAAGAAGAAGAAATACGCGCCAAGCAAGAGGATAACTTAGTATTGG
AATTATTTGAGGACGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGT
AACCTCAACCCTGAAACAGCATTTGAAACCTGACATGAATTGTTTTCTTT
GTGGCGTTTACACCAATACAAAAACATATCCATGTCGTGTATGTTTACGT
TCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTC
CAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTT
TTAATTGTTGGAATCACAACACACGAAAGCACAAAATGAAAGCTCAATAC
ACGTATCGGAAAAATGAAGAAGACAGAAACGATCGAACCAGACGTGGTCG
GAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTG
GAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAAT
TCCTAAAATGGGTTGTGAAATCTCTACACATAATCGTGTTGATGACGTTA
GCTCCACAACGACGGAGAGTGAAGTTGAGAAGGGAGGAGTCAAACAGAGA
TTGTTCCTTATACCACGTGATCCAATACAATACAGTAACCAACCGCCTTC
TGTTCAAAAGTTTTTAAATCCAACTCGTTATAAAAGGGATGAAGAAGTTT
ATATCAACAGTTATGTAACATGGCAAGAATATTTACTTGATCAAGCCATC
TACGCGTTGGCATCTCGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAA
TGAACTTGAAATGAAAAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTG
CCGACAATGAGAACATTCGTATAATGCACGCACGTATACAAGCTCAACAA
GTAGCTGACGTTGGACTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCG
AGCTGCCGGACTACCTGAAGTTACGGACGAGAGAGATATTGGACAGGTTG
CTACTGAACAGGTTCTTGTACATAGGTGAAACAATCAACGCACCGATTTT
CGTAGACGACGAACGTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTC
AAGGTGCCGATCGTGGAAGTGGAAAGATCTTGTCAATTTGCTCTCTGAGA
AGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGGA
GATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGCT
GAAAAATCTTTTGGTGGTTTCTGAAGGCATTTTACCAAGTTTTGGATTTT
GGATTCAAAGAAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACG
AAGCGATTAAGAAGTTAGCCAAAAGACCGCAGATAAATGATTGCTTGTGG
TCTCGTAATTTCGTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACA
AGAGATACTGATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACA
ATTTGAAAGTGAAAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATAC
GCGCCAAGCAAGAGGATAACTTAGTATTGGAATTATTTGAGGACGAAGTA
GCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACCCTGAAACAGC
ATTTGAAACCTGACATGAATTGTTTTCTTTGTGGCGTTTACACCAATACA
AAAACATATCCATGTCGTGTATGTTTACGTTCTTTCCACGACGCATGCTT
ACAAAAGTTCGGTAAACTCGACCCAGTCTCCAGAGCGTTGATGGTGAACC
AAGCTGAAACTGAAGAAGGATGGAGTTGTTTTAATTGTTGGAATCACAAC
ACACGAAAGCACAAAATGAAAGCTCAATACACGTATCGGAAAAATGAAGA
AGACAGAAACGATCGAACCAGACGTGGTCGGAGAGCGAATAGCGATCACA
GATGAAGAAAAGCCGGTGCTCTATCAACTGGAAAAAGAACGTCGACAAAA
AGTTTGGGAGTACAGACCTGGCGTTGAAATTCCTAAAATGGGTTGTGAAA
TCTCTACACATAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGT
GAAGTTGAGAAGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGA
TCCAATACAATACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATC
CAACTCGTTATAAAAGGGATGAAGAAGTTTATATCAACAGTTATGTAACA
TGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTCT
CAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAGC
CGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCGT
ATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTAC
TTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAAG
TTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGTA
CATAGGTGAAACAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGA
TTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGT
GGAAAGATCTTGTCAATTTGCTCTCTGAGAAGGAGATTTACGATTTGGAG
ATGACTTTTCGTGAGCTTGACAAAGACGGAGATGGTATGATCACTGCGGA
GGAGGCTCAACTTGTTTACACAAGATGGCTGAAAAATCTTTTGGTGGTTT
CTGAAGGCATTTTACCAAGTTTTGGATTTTGGATTCAAAGAAGACTGGCT
CACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAAGAAGTTAGCC
AAAAGACCGCAGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAAAAAT
CACTGAAGAAGAAATGATAAGAGCCAAACAAGAGATACTGATATTACGAA
GGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGTGAAAAAGTTG
TGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCAAGAGGATAAC
TTAGTATTGGAATTATTTGAGGACGAAGTAGCAGAACTTCAACAATTGGC
TCATAAATGTAACCTCAACCCTGAAACAGCATTTGAAACCTGACATGAAT
TGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATCCATGTCGTGT
ATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAACTCG
ACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAAGGA
TGGAGTTGTTTTAATTGTTGGAATCACAACACACGAAAGCACAAAATGAA
AGCTCAATACACGTATCGGAAAAATGAAGAAGACAGAAACGATCGAACCA
GACGTGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCT
CTATCAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTG
GCGTTGAAATTCCTAAAATGGGTTGTGAAATCTCTACACATAATCGTGTT
GATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTGAGAAGGGAGGAGT
CAAACAGAGATTGTTCCTTATACCACGTGATCCAATACAATACAGTAACC
AACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCGTTATAAAAGGGAT
GAAGAAGTTTATATCAACAGTTATGTAACATGGCAAGAATATTTACTTGA
TCAAGCCATCTACGCGTTGGCATCTCGTCTCAACAAACCGGCCGTCCACG
TTGTCGTTAATGAACTTGAAATGAAAAAGCCGGTTGGTGAACGAAAAGTC
GTTTTCGCTGCCGACAATGAGAACATTCGTATAATGCACGCACGTATACA
AGCTCAACAAGTAGCTGACGTTGGACTTACTTTAGACCCTGTTGTAACCG
GGCCTTTTCGAGCTGCCGGACTACCTGAAGTTACGGACGAGAGAGATATT
GGACAGGTTGCTACTGAACAGGTTCTTGTACATAGGTGAAACAATCAACG
CACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGCGACTCAAGCT
CCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGAAAGATCTTGTCAATTTG
CTCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGA
CAAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACA
CAAGATGGCTGAAAAATCTTTTGGTGGTTTCTGAAGGCATTTTACCAAGT
TTTGGATTTTGGATTCAAAGAAGACTGGCTCACTTGGTATGAGAGACTTT
TTGAACCACGAAGCGATTAAGAAGTTAGCCAAAAGACCGCAGATAAATGA
TTGCTTGTGGTCTCGTAATTTCGTAAAAATCACTGAAGAAGAAATGATAA
GAGCCAAACAAGAGATACTGATATTACGAAGGAGGAATACATTGAATTTC
GTTCTAAACAATTTGAAAGTGAAAAAGTTGTGGATAAAGTTACTGAAGAA
GAAGAAATACGCGCCAAGCAAGAGGATAACTTAGTATTGGAATTATTTGA
GGACGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACC
CTGAAACAGCATTTGAAACCTGACATGAATTGTTTTCTTTGTGGCGTTTA
CACCAATACAAAAACATATCCATGTCGTGTATGTTTACGTTCTTTCCACG
ACGCATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTCCAGAGCGTTG
ATGGTGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTTTTAATTGTTG
GAATCACAACACACGAAAGCACAAAATGAAAGCTCAATACACGTATCGGA
AAAATGAAGAAGACAGAAACGATCGAACCAGACGTGGTCGGAGAGCGAAT
AGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTGGAAAAAGAAC
GTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAATTCCTAAAATG
GGTTGTGAAATCTCTACACATAATCGTGTTGATGACGTTAGCTCCACAAC
GACGGAGAGTGAAGTTGAGAAGGGAGGAGTCAAACAGAGATTGTTCCTTA
TACCACGTGATCCAATACAATACAGTAACCAACCGCCTTCTGTTCAAAAG
TTTTTAAATCCAACTCGTTATAAAAGGGATGAAGAAGTTTATATCAACAG
TTATGTAACATGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGG
CATCTCGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAA
ATGAAAAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGA
GAACATTCGTATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACG
TTGGACTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGA
CTACCTGAAGTTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACA
GGTTCTTGTACATAGGTGAAACAATCAACGCACCGATTTTCGTAGACGAC
GAACGTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGA
TCGTGGAAGTGGAAAGATCTTGTCAATTTGCTCTCTGAGAAGGAGATTTA
CGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGGAGATGGTATGA
TCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGCTGAAAAATCTT
TTGGTGGTTTCTGAAGGCATTTTACCAAGTTTTGGATTTTGGATTCAAAG
AAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAA
GAAGTTAGCCAAAAGACCGCAGATAAATGATTGCTTGTGGTCTCGTAATT
TCGTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACAAGAGATACTG
ATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGT
GAAAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCA
AGAGGATAACTTAGTATTGGAATTATTTGAGGACGAAGTAGCAGAACTTC
AACAATTGGCTCATAAATGTAACCTCAACCCTGAAACAGCATTTGAAACC
TGACATGAATTGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATC
CATGTCGTGTATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTC
GGTAAACTCGACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAAC
TGAAGAAGGATGGAGTTGTTTTAATTGTTGGAATCACAACACACGAAAGC
ACAAAATGAAAGCTCAATACACGTATCGGAAAAATGAAGAAGACAGAAAC
GATCGAACCAGACGTGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAA
AGCCGGTGCTCTATCAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAG
TACAGACCTGGCGTTGAAATTCCTAAAATGGGTTGTGAAATCTCTACACA
TAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTGAGA
AGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGATCCAATACAA
TACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCGTTA
TAAAAGGGATGAAGAAGTTTATATCAACAGTTATGTAACATGGCAAGAAT
ATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTCTCAACAAACCG
GCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAGCCGGTTGGTGA
ACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCGTATAATGCACG
CACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTACTTTAGACCCT
GTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAAGTTACGGACGA
GAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGTACATAGGTGAA
ACAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGC
GACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGAAAGATCT
TGTCAATTTGCTCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTC
GTGAGCTTGACAAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAA
CTTGTTTACACAAGATGGCTGAAAAATCTTTTGGTGGTTTCTGAAGGCAT
TTTACCAAGTTTTGGATTTTGGATTCAAAGAAGACTGGCTCACTTGGTAT
GAGAGACTTTTTGAACCACGAAGCGATTAAGAAGTTAGCCAAAAGACCGC
AGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAAAAATCACTGAAGAA
GAAATGATAAGAGCCAAACAAGAGATACTGATATTACGAAGGAGGAATAC
ATTGAATTTCGTTCTAAACAATTTGAAAGTGAAAAAGTTGTGGATAAAGT
TACTGAAGAAGAAGAAATACGCGCCAAGCAAGAGGATAACTTAGTATTGG
AATTATTTGAGGACGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGT
AACCTCAACCCTGAAACAGCATTTGAAACCTGACATGAATTGTTTTCTTT
GTGGCGTTTACACCAATACAAAAACATATCCATGTCGTGTATGTTTACGT
TCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTC
CAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTT
TTAATTGTTGGAATCACAACACACGAAAGCACAAAATGAAAGCTCAATAC
ACGTATCGGAAAAATGAAGAAGACAGAAACGATCGAACCAGACGTGGTCG
GAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTG
GAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAAT
TCCTAAAATGGGTTGTGAAATCTCTACACATAATCGTGTTGATGACGTTA
GCTCCACAACGACGGAGAGTGAAGTTGAGAAGGGAGGAGTCAAACAGAGA
TTGTTCCTTATACCACGTGATCCAATACAATACAGTAACCAACCGCCTTC
TGTTCAAAAGTTTTTAAATCCAACTCGTTATAAAAGGGATGAAGAAGTTT
ATATCAACAGTTATGTAACATGGCAAGAATATTTACTTGATCAAGCCATC
TACGCGTTGGCATCTCGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAA
TGAACTTGAAATGAAAAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTG
CCGACAATGAGAACATTCGTATAATGCACGCACGTATACAAGCTCAACAA
GTAGCTGACGTTGGACTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCG
AGCTGCCGGACTACCTGAAGTTACGGACGAGAGAGATATTGGACAGGTTG
CTACTGAACAGGTTCTTGTACATAGGTGAAACAATCAACGCACCGATTTT
CGTAGACGACGAACGTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTC
AAGGTGCCGATCGTGGAAGTGGAAAGATCTTGTCAATTTGCTCTCTGAGA
AGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGGA
GATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGCT
GAAAAATCTTTTGGTGGTTTCTGAAGGCATTTTACCAAGTTTTGGATTTT
GGATTCAAAGAAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACG
AAGCGATTAAGAAGTTAGCCAAAAGACCGCAGATAAATGATTGCTTGTGG
TCTCGTAATTTCGTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACA
AGAGATACTGATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACA
ATTTGAAAGTGAAAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATAC
GCGCCAAGCAAGAGGATAACTTAGTATTGGAATTATTTGAGGACGAAGTA
GCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACCCTGAAACAGC
ATTTGAAACCTGACATGAATTGTTTTCTTTGTGGCGTTTACACCAATACA
AAAACATATCCATGTCGTGTATGTTTACGTTCTTTCCACGACGCATGCTT
ACAAAAGTTCGGTAAACTCGACCCAGTCTCCAGAGCGTTGATGGTGAACC
AAGCTGAAACTGAAGAAGGATGGAGTTGTTTTAATTGTTGGAATCACAAC
ACACGAAAGCACAAAATGAAAGCTCAATACACGTATCGGAAAAATGAAGA
AGACAGAAACGATCGAACCAGACGTGGTCGGAGAGCGAATAGCGATCACA
GATGAAGAAAAGCCGGTGCTCTATCAACTGGAAAAAGAACGTCGACAAAA
AGTTTGGGAGTACAGACCTGGCGTTGAAATTCCTAAAATGGGTTGTGAAA
TCTCTACACATAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGT
GAAGTTGAGAAGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGA
TCCAATACAATACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATC
CAACTCGTTATAAAAGGGATGAAGAAGTTTATATCAACAGTTATGTAACA
TGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTCT
CAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAGC
CGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCGT
ATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTAC
TTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAAG
TTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGTA
CATAGGTGAAACAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGA
TTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGT
GGAAAGATCTTGTCAATTTGCTCTCTGAGAAGGAGATTTACGATTTGGAG
ATGACTTTTCGTGAGCTTGACAAAGACGGAGATGGTATGATCACTGCGGA
GGAGGCTCAACTTGTTTACACAAGATGGCTGAAAAATCTTTTGGTGGTTT
CTGAAGGCATTTTACCAAGTTTTGGATTTTGGATTCAAAGAAGACTGGCT
CACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAAGAAGTTAGCC
AAAAGACCGCAGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAAAAAT
CACTGAAGAAGAAATGATAAGAGCCAAACAAGAGATACTGATATTACGAA
GGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGTGAAAAAGTTG
TGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCAAGAGGATAAC
TTAGTATTGGAATTATTTGAGGACGAAGTAGCAGAACTTCAACAATTGGC
TCATAAATGTAACCTCAACCCTGAAACAGCATTTGAAACCTGACATGAAT
TGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATCCATGTCGTGT
ATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAACTCG
ACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAAGGA
TGGAGTTGTTTTAATTGTTGGAATCACAACACACGAAAGCACAAAATGAA
AGCTCAATACACGTATCGGAAAAATGAAGAAGACAGAAACGATCGAACCA
GACGTGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCT
CTATCAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTG
GCGTTGAAATTCCTAAAATGGGTTGTGAAATCTCTACACATAATCGTGTT
GATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTGAGAAGGGAGGAGT
CAAACAGAGATTGTTCCTTATACCACGTGATCCAATACAATACAGTAACC
AACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCGTTATAAAAGGGAT
GAAGAAGTTTATATCAACAGTTATGTAACATGGCAAGAATATTTACTTGA
TCAAGCCATCTACGCGTTGGCATCTCGTCTCAACAAACCGGCCGTCCACG
TTGTCGTTAATGAACTTGAAATGAAAAAGCCGGTTGGTGAACGAAAAGTC
GTTTTCGCTGCCGACAATGAGAACATTCGTATAATGCACGCACGTATACA
AGCTCAACAAGTAGCTGACGTTGGACTTACTTTAGACCCTGTTGTAACCG
GGCCTTTTCGAGCTGCCGGACTACCTGAAGTTACGGACGAGAGAGATATT
GGACAGGTTGCTACTGAACAGGTTCTTGTACATAGGTGAAACAATCAACG
CACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGCGACTCAAGCT
CCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGAAAGATCTTGTCAATTTG
CTCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTCGTGAGCTTGA
CAAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAACTTGTTTACA
CAAGATGGCTGAAAAATCTTTTGGTGGTTTCTGAAGGCATTTTACCAAGT
TTTGGATTTTGGATTCAAAGAAGACTGGCTCACTTGGTATGAGAGACTTT
TTGAACCACGAAGCGATTAAGAAGTTAGCCAAAAGACCGCAGATAAATGA
TTGCTTGTGGTCTCGTAATTTCGTAAAAATCACTGAAGAAGAAATGATAA
GAGCCAAACAAGAGATACTGATATTACGAAGGAGGAATACATTGAATTTC
GTTCTAAACAATTTGAAAGTGAAAAAGTTGTGGATAAAGTTACTGAAGAA
GAAGAAATACGCGCCAAGCAAGAGGATAACTTAGTATTGGAATTATTTGA
GGACGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGTAACCTCAACC
CTGAAACAGCATTTGAAACCTGACATGAATTGTTTTCTTTGTGGCGTTTA
CACCAATACAAAAACATATCCATGTCGTGTATGTTTACGTTCTTTCCACG
ACGCATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTCCAGAGCGTTG
ATGGTGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTTTTAATTGTTG
GAATCACAACACACGAAAGCACAAAATGAAAGCTCAATACACGTATCGGA
AAAATGAAGAAGACAGAAACGATCGAACCAGACGTGGTCGGAGAGCGAAT
AGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTGGAAAAAGAAC
GTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAATTCCTAAAATG
GGTTGTGAAATCTCTACACATAATCGTGTTGATGACGTTAGCTCCACAAC
GACGGAGAGTGAAGTTGAGAAGGGAGGAGTCAAACAGAGATTGTTCCTTA
TACCACGTGATCCAATACAATACAGTAACCAACCGCCTTCTGTTCAAAAG
TTTTTAAATCCAACTCGTTATAAAAGGGATGAAGAAGTTTATATCAACAG
TTATGTAACATGGCAAGAATATTTACTTGATCAAGCCATCTACGCGTTGG
CATCTCGTCTCAACAAACCGGCCGTCCACGTTGTCGTTAATGAACTTGAA
ATGAAAAAGCCGGTTGGTGAACGAAAAGTCGTTTTCGCTGCCGACAATGA
GAACATTCGTATAATGCACGCACGTATACAAGCTCAACAAGTAGCTGACG
TTGGACTTACTTTAGACCCTGTTGTAACCGGGCCTTTTCGAGCTGCCGGA
CTACCTGAAGTTACGGACGAGAGAGATATTGGACAGGTTGCTACTGAACA
GGTTCTTGTACATAGGTGAAACAATCAACGCACCGATTTTCGTAGACGAC
GAACGTAAGATTGGCGACGCGACTCAAGCTCCCGTCGTTCAAGGTGCCGA
TCGTGGAAGTGGAAAGATCTTGTCAATTTGCTCTCTGAGAAGGAGATTTA
CGATTTGGAGATGACTTTTCGTGAGCTTGACAAAGACGGAGATGGTATGA
TCACTGCGGAGGAGGCTCAACTTGTTTACACAAGATGGCTGAAAAATCTT
TTGGTGGTTTCTGAAGGCATTTTACCAAGTTTTGGATTTTGGATTCAAAG
AAGACTGGCTCACTTGGTATGAGAGACTTTTTGAACCACGAAGCGATTAA
GAAGTTAGCCAAAAGACCGCAGATAAATGATTGCTTGTGGTCTCGTAATT
TCGTAAAAATCACTGAAGAAGAAATGATAAGAGCCAAACAAGAGATACTG
ATATTACGAAGGAGGAATACATTGAATTTCGTTCTAAACAATTTGAAAGT
GAAAAAGTTGTGGATAAAGTTACTGAAGAAGAAGAAATACGCGCCAAGCA
AGAGGATAACTTAGTATTGGAATTATTTGAGGACGAAGTAGCAGAACTTC
AACAATTGGCTCATAAATGTAACCTCAACCCTGAAACAGCATTTGAAACC
TGACATGAATTGTTTTCTTTGTGGCGTTTACACCAATACAAAAACATATC
CATGTCGTGTATGTTTACGTTCTTTCCACGACGCATGCTTACAAAAGTTC
GGTAAACTCGACCCAGTCTCCAGAGCGTTGATGGTGAACCAAGCTGAAAC
TGAAGAAGGATGGAGTTGTTTTAATTGTTGGAATCACAACACACGAAAGC
ACAAAATGAAAGCTCAATACACGTATCGGAAAAATGAAGAAGACAGAAAC
GATCGAACCAGACGTGGTCGGAGAGCGAATAGCGATCACAGATGAAGAAA
AGCCGGTGCTCTATCAACTGGAAAAAGAACGTCGACAAAAAGTTTGGGAG
TACAGACCTGGCGTTGAAATTCCTAAAATGGGTTGTGAAATCTCTACACA
TAATCGTGTTGATGACGTTAGCTCCACAACGACGGAGAGTGAAGTTGAGA
AGGGAGGAGTCAAACAGAGATTGTTCCTTATACCACGTGATCCAATACAA
TACAGTAACCAACCGCCTTCTGTTCAAAAGTTTTTAAATCCAACTCGTTA
TAAAAGGGATGAAGAAGTTTATATCAACAGTTATGTAACATGGCAAGAAT
ATTTACTTGATCAAGCCATCTACGCGTTGGCATCTCGTCTCAACAAACCG
GCCGTCCACGTTGTCGTTAATGAACTTGAAATGAAAAAGCCGGTTGGTGA
ACGAAAAGTCGTTTTCGCTGCCGACAATGAGAACATTCGTATAATGCACG
CACGTATACAAGCTCAACAAGTAGCTGACGTTGGACTTACTTTAGACCCT
GTTGTAACCGGGCCTTTTCGAGCTGCCGGACTACCTGAAGTTACGGACGA
GAGAGATATTGGACAGGTTGCTACTGAACAGGTTCTTGTACATAGGTGAA
ACAATCAACGCACCGATTTTCGTAGACGACGAACGTAAGATTGGCGACGC
GACTCAAGCTCCCGTCGTTCAAGGTGCCGATCGTGGAAGTGGAAAGATCT
TGTCAATTTGCTCTCTGAGAAGGAGATTTACGATTTGGAGATGACTTTTC
GTGAGCTTGACAAAGACGGAGATGGTATGATCACTGCGGAGGAGGCTCAA
CTTGTTTACACAAGATGGCTGAAAAATCTTTTGGTGGTTTCTGAAGGCAT
TTTACCAAGTTTTGGATTTTGGATTCAAAGAAGACTGGCTCACTTGGTAT
GAGAGACTTTTTGAACCACGAAGCGATTAAGAAGTTAGCCAAAAGACCGC
AGATAAATGATTGCTTGTGGTCTCGTAATTTCGTAAAAATCACTGAAGAA
GAAATGATAAGAGCCAAACAAGAGATACTGATATTACGAAGGAGGAATAC
ATTGAATTTCGTTCTAAACAATTTGAAAGTGAAAAAGTTGTGGATAAAGT
TACTGAAGAAGAAGAAATACGCGCCAAGCAAGAGGATAACTTAGTATTGG
AATTATTTGAGGACGAAGTAGCAGAACTTCAACAATTGGCTCATAAATGT
AACCTCAACCCTGAAACAGCATTTGAAACCTGACATGAATTGTTTTCTTT
GTGGCGTTTACACCAATACAAAAACATATCCATGTCGTGTATGTTTACGT
TCTTTCCACGACGCATGCTTACAAAAGTTCGGTAAACTCGACCCAGTCTC
CAGAGCGTTGATGGTGAACCAAGCTGAAACTGAAGAAGGATGGAGTTGTT
TTAATTGTTGGAATCACAACACACGAAAGCACAAAATGAAAGCTCAATAC
ACGTATCGGAAAAATGAAGAAGACAGAAACGATCGAACCAGACGTGGTCG
GAGAGCGAATAGCGATCACAGATGAAGAAAAGCCGGTGCTCTATCAACTG
GAAAAAGAACGTCGACAAAAAGTTTGGGAGTACAGACCTGGCGTTGAAAT
TCCTAAAATGGGTTGTGAAATCTCTACACATAATCGTGTTGATGACGTTA
GCTCCACAACGACGGAGAGTGAAGTTGAGAAGGGAGGAGTCAAACAGAGA
TTGTTCCTTATACCACGTGATCCAATACAATACAGTAACCAACCGCCTTC
TGTTCAAAAGTTTTTAAATCCAACTCGTTATAAAAGGGATGAAGAAGTTT
ATATCAACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045557XLOC_045557Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073412-exon-scaffold_91-1575043694:385814..386796TCONS_00073412-exon-scaffold_91-1575043694:385814..386796Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:384500..384629TCONS_00073412-exon-scaffold_91-1575043694:384500..384629Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:383971..383994TCONS_00073412-exon-scaffold_91-1575043694:383971..383994Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:383096..383140TCONS_00073412-exon-scaffold_91-1575043694:383096..383140Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:379353..379541TCONS_00073412-exon-scaffold_91-1575043694:379353..379541Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:378446..378530TCONS_00073412-exon-scaffold_91-1575043694:378446..378530Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:376595..376704TCONS_00073412-exon-scaffold_91-1575043694:376595..376704Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:374955..375026TCONS_00073412-exon-scaffold_91-1575043694:374955..375026Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:373180..373272TCONS_00073412-exon-scaffold_91-1575043694:373180..373272Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:372057..372223TCONS_00073412-exon-scaffold_91-1575043694:372057..372223Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:371689..371781TCONS_00073412-exon-scaffold_91-1575043694:371689..371781Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1575043694:370444..370851TCONS_00073412-exon-scaffold_91-1575043694:370444..370851Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:385814..386796TCONS_00073412-exon-scaffold_91-1510915933:385814..386796Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:384500..384629TCONS_00073412-exon-scaffold_91-1510915933:384500..384629Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:383971..383994TCONS_00073412-exon-scaffold_91-1510915933:383971..383994Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:383096..383140TCONS_00073412-exon-scaffold_91-1510915933:383096..383140Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:379353..379541TCONS_00073412-exon-scaffold_91-1510915933:379353..379541Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:378446..378530TCONS_00073412-exon-scaffold_91-1510915933:378446..378530Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:376595..376704TCONS_00073412-exon-scaffold_91-1510915933:376595..376704Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:374955..375026TCONS_00073412-exon-scaffold_91-1510915933:374955..375026Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:373180..373272TCONS_00073412-exon-scaffold_91-1510915933:373180..373272Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:372057..372223TCONS_00073412-exon-scaffold_91-1510915933:372057..372223Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:371689..371781TCONS_00073412-exon-scaffold_91-1510915933:371689..371781Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1510915933:370444..370851TCONS_00073412-exon-scaffold_91-1510915933:370444..370851Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:385814..386796TCONS_00073412-exon-scaffold_91-1491911889:385814..386796Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:384500..384629TCONS_00073412-exon-scaffold_91-1491911889:384500..384629Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:383971..383994TCONS_00073412-exon-scaffold_91-1491911889:383971..383994Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:383096..383140TCONS_00073412-exon-scaffold_91-1491911889:383096..383140Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:379353..379541TCONS_00073412-exon-scaffold_91-1491911889:379353..379541Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:378446..378530TCONS_00073412-exon-scaffold_91-1491911889:378446..378530Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:376595..376704TCONS_00073412-exon-scaffold_91-1491911889:376595..376704Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:374955..375026TCONS_00073412-exon-scaffold_91-1491911889:374955..375026Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:373180..373272TCONS_00073412-exon-scaffold_91-1491911889:373180..373272Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:372057..372223TCONS_00073412-exon-scaffold_91-1491911889:372057..372223Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:371689..371781TCONS_00073412-exon-scaffold_91-1491911889:371689..371781Clytia hemisphaericaexon
TCONS_00073412-exon-scaffold_91-1491911889:370444..370851TCONS_00073412-exon-scaffold_91-1491911889:370444..370851Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073412-proteinTCONS_00073412-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:370444..386796 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.340198 0.236962 0.0917117 0.0897256 0.67724 0.552427 0.437378 0.428966 0.327632 0.186003 0.131301 0.161835 0.624894 0.492313 0.0827895 0.078974 2.55385 3.22839 1.06769 1.17132 3.61815 3.91924 0.798702 1.04699 1.2697 1.11765 0.244346 0.284479 0.161825 0.164875
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR031946KIAA1045_Zf_RING
IPR002048EF_hand_dom
IPR011011Znf_FYVE_PHD
IPR011992EF-hand-dom_pair
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005509 calcium ion binding
Blast
BLAST of TCONS_00073412 vs. Swiss-Prot (Human)
Match: PHF24 (PHD finger protein 24 OS=Homo sapiens GN=PHF24 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 6.254e-28
Identity = 82/295 (27.80%), Postives = 132/295 (44.75%), Query Frame = 1
Query: 1195 DMNCFLCGVYTNTKTYPCRVCLRSFHDACLQKFGKLDPVSRALMVNQAETEEGWSCFNCDNLVLELFEDEVAELQQLAHKCNLNPETDTDITKEEYIEFRSKQFXXXXXXXXXXXXXXIRAKQEINDCLWSRNFVKITEEEMIRAKQEFWILDSKKTGSLGMRDFLNHEA-IKKLAKRPQKDLVNLLSEKEIYDLEMTFRELDKDGDGMITAEEAQLVYTRWL-KNLLVVSEGILPRTINAPIFVDDERKIGDATQAPVVQGADRGSGYVTWQEYLLDQAIYALASRLNKPAVHV 2073
            D  C +C V+T    +PCRVC R FHD CL++ G +   S A +   A TE GWSC  CDN+ L L E+E+  L +   +C + P  D  +T E+++ +R +                  AK+   D         ++EE+  +A ++F  LD +  G +   DFL+HE+ +     RPQ  L+ LL+ KE       F  L +     ++  E +     W  K         +  +   PI           +Q   +   ++ S +V W  +L +  +Y LA+R N  A+H+
Sbjct:  130 DEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEEEMYSLTETFQRCKVIP--DCSLTLEDFLRYRHQA-----------------AKRGDRD-------RALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAF--LARGSGSTVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPASSSSKSQDKTLLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHL 396          
The following BLAST results are available for this feature:
BLAST of TCONS_00073412 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PHF246.254e-2827.80PHD finger protein 24 OS=Homo sapiens GN=PHF24 PE=... [more]
back to top