Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073403 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073403
Unique NameTCONS_00073403
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3724

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073403 ID=TCONS_00073403|Name=TCONS_00073403|organism=Clytia hemisphaerica|type=transcript|length=3724bp
tactaaaaccgtcccagtccttttttcgcacctatagactgtagaaaaat
gtgtcaaaaaaggattggatcgagtttagggggatgattaaataataaag
tggcacgcgcctgaccgtgcgactacgtttttttttcaaggtaTCGGCGT
GGATGATGTCTTTGTCATTATTCAAAATTGGGACAACATTGGTGGCCCTA
AAAATCGTGACCGCTCGATCGCCGAAAATGTTTCTCTCGCATTGAGAACT
GCTGGCGTATCCATCCTGGTCACGTCAATCACGGACGTTTGCGCTTTCTT
GATCGGAGCAACTACAATCCTTCCCGCCTTACGATCGTTCTGTATTTTCG
CTGGCATTGGTGTTTTAGCCGTCTTCATTTTAACATGTACATTTTATGTG
GCTTGGTTGGCTTTGGATAGCAGGAGACAACGTGACCACCGTGACGCGTG
TTGTTGTTGTGCGTCTTTACCGACGGATTGGCAACCGTTGGAATGTTCAA
AGAGAATGTACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATT
CTCTCTACGCCTGGTCGGATTGTTTTGATGTTGGTATGGGCTGGTTTATT
AGCGGGAGGTGCATACGGTCTTTCACAATTGAAACAAGATTTCGATCCTG
AATGGTTTTTACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTGGAT
GATAAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGA
TGTTGactattttgcagaccaggaCAAGTTAGTGAGCATGTATAACACAC
TGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAA
ACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGG
TAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTTACGA
AAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAACG
GAACAAAAGATTGAGGCTTCTCGTATCAAATACAAACATATCAAATTGGA
AGGCGCTTCGGTTGAAGTCAAGGCAATGGACAGTGTGCAAGATGAGCTTG
CCAAAATCACATTCACTAATGACTTCAGTCCTTTCGGTTACACAAGGTTC
TACGTTGGCTGGGAAACAAATAAGGTCATTTCTGAAGAATTGATACGTAA
TTTGTTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCG
CCAACGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTG
ATCAACATTGCGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGT
GACCACTATCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCG
CTCATATCGGGCATGGTTTCATGGCTGCACGCGAAGGAAACAGAGTGCAA
CGAGCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACACGGAGG
TTTCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATCCTATG
TTTTCTCCACTTTCTTCAAGTTATTTTTCTTGGTCGTGGTGTTTGGTATG
TTTCACGGTGTAGTGTATTTACCCATCGTGCTTAGCTTGGTCGGTCCCGA
ACCGTACGCATCTTCCGAACCTTCAACTCCATCAGCCTCCACCACAAGCG
CTGGTAAACCTCCATTACCAAACAATGGTGTCGAAATGACTGATGACAAA
GAACCCGAAACTAAGACAGCTGGTGTTGACAATGCCTCATTCGTCGAAGC
AACGCTAGCATCTTGAAAAATTACAAACTTTGTTACTATGGTAATAATTT
AGCAAGGTATAACATTATTTagtgttattttttatttccttcTATATAAT
TATTTTAATACTTGAATATAAAGTCCATTCGCTTTTTTGATTATGTACCC
TTTCTTACTGGCATGTAGAAACCATGACATCATAACCAGACTTATTCCCT
AGAGAGCGGTTTCCACATGGCAGCAAATAAGATTATGTACCCTTTCATGC
TGGCATGTAGAAACCATGACAtcatactttaagggcagaaagtttcgcga
agtCGAAAACTGAccgcgaaaaaaactttcgcgtttttcaggtttaattt
cttacctggcagaaacccgcgaaaaaggatcaaaatcgcgaaaaacgcga
aagtttctgcccgcgaaagtaaCCAGACTTcttcccttgagagtggtttc
cacatggtAGCAAATAAGAGTGTACACTTGAACGAATGGACTTAAGTTAT
AATGAAGCTACcctaagggaactaattttagtggtttaaaaaaattgcga
aaaatcgcatttcgcgggaattaattttcgcagttttgccctatttttga
caaatttctttcattttcttaggtatttttcaatttttaataaaaaatgg
cCAAATATGCAATTCGTGGGttctaatttttgcggttttgtcaaaaaacc
gcgaaaaaacagcaaaaattaGTTCGCTTATGGTATGTTTGAAGGTAAGC
TGtatattttaatgttttgaatatgaaatttattttttaatatcaAAGTT
AAACCTTCctaaatttgatacctctttAGGTTACGCCGatgttttcaatt
tgaaatagcTCGTTCTCGGCTGAAAACTGAGCCCGGTAAtttgaaagaac
taaaaaaaaCATTAGGGGCTGATGCACAATTTACGGGTTCATATAAAAAC
AGTGTAATTTGATCACAATTAACGTTCTTGAGAGACTTTGAACGTTTAAT
TACGTTGTatccattgacttccaagcccgaagggctagacacAAGACTCC
TgtatgggaaatgaaaccacctATTTCTCACCCTAAACGCGTAACCGCGT
GGTTCTCACACGAACGCTAGATTTAAAATAAAACCCATCGCCATATTTCG
ATTATGCCtggtgaaaacaaagaaagtgctagattTAATCCGTTATTTTA
ATCTTAggacttcactttttcttgcttgagaaaggttgaagatttaTCTC
TAGCCACTTCGgggttttaaactcaatggttgtaCACGNtcactttttct
tgcttgagaaaggttgaagatttaTCTCTAGCCACTTCGgggttttaaac
tcaatggttgtacacgattttttttttttttaagtatagTGTACTTAGGA
Tgtgggtcaagtattcttaagaaagtgccaaaattgagggtgaaatattc
ttaacgtatacttacttttttagacttgacttttttacaaacatgagaaa
ttatcaatttgagagttttcgacttttgagtgaacatttgggttagaatt
acatttcttcctcaaagcttcattatctctaacaaaggaagcagtttttt
ctgttgaccaaatacaaaatgactttattcttatcaaattctgtgaaatt
cacccccgagggtattcttagggtattcttacgatttggccaattttcac
cctaatattcttatagaacatattcttataaaaaaagcgtgtacctggCC
GTATCACTAAAAGTTAAAATCATTGTTTGGTGATTGTGTTGTACAGTATA
CCATTGTATTcgtatttttaaagattttttttgataatcttGTTGGTTTT
GTATTTAGTTCAATTGTATAATATTTTCACTCTCTTTCAAGAAAGTTTTa
tatttaaagaaatatttatcGTGT
Run BLAST on NCBI

protein sequence of TCONS_00073403-protein

>TCONS_00073403-protein ID=TCONS_00073403-protein|Name=TCONS_00073403-protein|organism=Clytia hemisphaerica|type=polypeptide|length=436bp
MYLQEFMRGTYSKAILSTPGRIVLMLVWAGLLAGGAYGLSQLKQDFDPEW
FLPEDSNARIYSSVDDKYFSNDGIQAYAYIEDVDYFADQDKLVSMYNTLE
NNQYTVKGETQSWYQTYIAWMAANHAADLTNGKPSTKDIFYNRLDEFTKT
QVGKVFEKEIKGNITEQKIEASRIKYKHIKLEGASVEVKAMDSVQDELAK
ITFTNDFSPFGYTRFYVGWETNKVISEELIRNLLLAGVIVFLVTLFLIAN
VWVSLLVLTCVVFTLINIAGYMHFWGLTVDTVTTIQLILAIGLSVDYSAH
IGHGFMAAREGNRVQRAAHALEEIGPAVVHGGFSTFLAFVCLGASQSYVF
STFFKLFFLVVVFGMFHGVVYLPIVLSLVGPEPYASSEPSTPSASTTSAG
KPPLPNNGVEMTDDKEPETKTAGVDNASFVEATLAS
Run BLAST on NCBI

transcript from alignment at scaffold_91:309920..339741-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073403 ID=TCONS_00073403|Name=TCONS_00073403|organism=Clytia hemisphaerica|type=transcript|length=29822bp|location=Sequence derived from alignment at scaffold_91:309920..339741- (Clytia hemisphaerica)
TACTAAAACCGTCCCAGTCCTTTTTTCGCACCTATAGACTGTAGAAAAAT GTGTCAAAAAAGGATTGGATCGAGTTTAGGGGGATGATTAAATAATAAAG TGGCACGCGCCTGACCGTGCGACTACGTTTTTTTTTCAAGGTATCGGCGT GGATGATGTCTTTGTCATTATTCAAAATTGGGACAACATTGGTGGCCCTA AAAATCGTGACCGCTCGATCGCCGAAAATGTTTCTCTCGCATTGAGAACT GCTGTAAGAACATTACAATTACATGTTAATTTTTTCCTACATTAACAACA TTAACAATTTCCAATTAACACACACTCGCTCGAAAAGGAGGAAACTTCTA ATTAGCGGACAGTTTCATTTTCTCCGGCCGTTTGAGTCGAGTCGATATTT TACGTGGATAACCCAGTAATCTAGGACTTTTCGACAGTCTTTCGATTGTT TCGATTTCGATTCACGGGGTCCACGGCCAACCGGCTCGGCTATCTATGAA CTGAACAGGACATTGAAAGGAGCGGGGATTCGAACCGTGAATCCCTGGTT TGAGACGCTGATGCCTTTGACCACTTGGCCATCGTTCCTTTCCTAGAAAT ACTTATAAAACAGTTGGCGGTCACTGACCTGTTTGCACGCCATGTGTCCA TTAATTAGAAGTGTCACTCTATTCTTAAGAAAGGGGACCCCGCAAGAAAG GGCTCGAAGAACAGACTTTTTTTCAAATGGAATTTGCAGATTTGACAAGA TCTTGATACTTAGATCTATAGCTACACACAAGGTTTTGCTATCAATTAAA ACATTTTCTATTCCCTTAAGCGTCTTAGCTTTAAACCTTTAAAAACTTAA GTCAAATTACACAAAAAGCGTTATTATTGCAAATGGAAACATTAATCTAA TAATTTAATTAACGACTACCTATTTTAGGGCGTATCCATCCTGGTCACGT CAATCACGGACGTTTGCGCTTTCTTGATCGGAGCAACTACAATCCTTCCC GCCTTACGATCGTTCTGTATTTTCGCTGGCATTGGTGTTTTAGCCGTCTT CATTTTAACATGTACATTTTATGTGGCTTGGTTGGCTTTGGATAGCAGGA GGTAAGGTTTCCTTAAAGGGACATAAAAGTACTGACGAAATTTGTAAACA AACCGTATGCAGCGAGATACAAAATCAAAACAAATATCACATGTCAAAAT AAAAATAAAAACAAATGTTACATGTCAAAATAAAAAATAAAGACAAATAT GGCTGATTTTGATTGTTTCTTGAAATTATTGTTTTACAAGTTTGTTTTGA ACACGTGATTTTAATTGTTCTCTTTTAATGACACATGGTTCGCGCAATGC TTACATTTTACTACTCAGTGACTTGGACAAAATCCAATTTATTTCTTTAA ACCTACCAAACCTGATAAGGTAATGAGATAGGAACTAAATTATCCAGATG AGATGGAGTTTTTATAAGATACTTTAATAATTAGTCATTTGAAGTAATAG AAATGACGCGTTCTTTAGAAAAAGTAACAAAATTGTTTTATTACTGGTTA GCGACCAACCAAATCAAATAAGAGCTTGTAAAAACTTCATCTCGTCCGAA TTACCTTCTCAACCTAAATTTTTTTTCTTTATCGAAACATAAAAGACTGG GTCCTTCTCTCCGCGGCATTTGATAACCATCCAATCTTTACAGCTCAAAA TACTCCTAAAATGGTGCAAGTTTCATGTTTTCATGTTTCAAATTTGAATA AGTATAAGCTTGTTCGCTTTATATTTGTAACCACTCCCCACTAAACCTTG ATACATTTTCGCCCAGCTAATTCTTTTGACCAATCAAAATTGTTCTTTTA GACAACGTGACCACCGTGACGCGTGTTGTTGTTGTGCGTCTTTACCGACG GATTGGCAACCGTTGGAATGTTCAAAGAGAATGTACCTTCAAGAGTTCAT GAGAGGAACTTATTCAAAAGCAATTCTCTCTACGCCTGGTCGGGTAAGCT AATTTTCTATTTCTATTCGGTTGAGTTGATGAGGATGCTCTGAGGCAACT GTTGATGCTTTCAAGAGTGTATCTCACGTTCGCTTCGTAGTACACTCTAT TCGCATTGTCTGTACAGAAACCTCTGCGATGAGGCTTGATTTATACTTAG CAACTCTTATCTCGTCGTCTCCCCTCTCTCACCAACACTCCATCGCAGCG GTCGGTTTGAAAAATCTTAAATGAGAAAAGACAATGACAACAGACCCTCT ACAGCATTGAATTTTGAAATAAGCCGTAGATACTGGGTTTGTGTACAGAC AATGAGCGCCCAATCAGCACCTTATACTGACAACCCGATTCCCCCGCCCC ATGCCACGCCTGAGTGAAGGTTATAAAGTGAAGCGCTGCTAGTGGGAATC GAACCATAGTCGCTTGTACAGCAACCAAGGTTAATAACTACCGTGGCTTG TTAGTGCCATGTGTAAGCTACTTATACTTATAGGTTCTTGCTAAGTCGAC TTAATAGGGCTAAGTTGTAAGTCAACTTATAAGTGCTAAGTCGACATAGA ACCTCTAAGTATAAGTAGTTTACACATGGCACTAACAAGCCACGGTAAAT AACCGCTTTGCCACAGCGCCTGTATACCATTTACGCTCTTCCATAGTACA GTTACCGTCTTCGAAAGAATTATATGGGTGTAGACACTCTTGGTGCTTTT GAAGTTGTACCCCTTAGGCGTACAAACTTTCGCGAGCAGAATTTTTTGCG AGCTCGAAAAATCGCGAAATTTACAATATTTGCTTTCGCGAATTTGAGGA AAAAATGTTTTTCGCGAATAAACTTTCATATTTAGAAGTTTTTTTACAAA ATTTGGAGGATGTACCGTGTTTCAATCCCGACTTATGGAAGATTTTGAAA ATCGTTAAAAATTCATTTTCGGTATTAACCACCTGTCACTCTTTTGTCAA TAACTTTTTTTGCCCAAGGTGTAAAAATTGACTCTACCTCACATCCGAAA GCTGATAAAATTATCTTTCCAACGGTGTATAGAAACCTTCTATTCGTTTT TTTTCTAGGTTGACTCTATTTTCGACAAAGTTCTACAGGACTAGAATCGT TGGTTAGAATGAGAATTTTCGAATGAAAAAGTGAAAAACATTCCTTAAAT CCGATAAAGACGGTTGCTCTTCGACTTTAAAAAGGGATTTTAGGATAAGA AAATGCTAAAATTTTGATATTTATTACGATTTCGAGGTTTTATAGAAACT TTCGCGAATTGCCCTGTTAAGAATTTTCAAAGACATTTACTCTCGCGAAA AAGGCCAAAATTCGCGTAAAGTTTGTACGCCTAAAGTGCTGTTTCAATCA GTTTTAAGGTTTCTTGCCAATGTGAGACTTTTCTTGACTCATGTGTTGGT TTTTTAAGCAATGAAATTAGTTGACAGCTTTATATCCAACTTTCATTTTC AAATCGTATTAGTATACTGTTTTCAGGCTTATTCGCGAAATTAAATCCAC GCGAAAATTTTCAAACCCTGACTCTCGAAATAAACTCCAGAAATACATGT CTGAGTTTCTGAACCCTCTTTTCCTTTCTGTTTAAGATTGTTTTGATGTT GGTATGGGCTGGTTTATTAGCGGGAGGTGCATACGGTCTTTCACAATTGA AACAAGATTTCGATCCTGAATGGTTTTTACCGGAAGATTCGAACGCCAGG ATTTACAGCTCCGTGGATGATAAGGTAAATGATAACCCTGGGTTAGTATC TGGTGCATATATTTCTTATACTAGATGGAGCTTCTTCTTTTATCTCTCTG GGTCAGGTTTCAGAGGTATCGGCCACTTTTTAATGTACTTTTTATGCACA GTAACTTCGTGTCATGCCGACATACCTTGTCTAATTCCGTCATAGCAACT ATCTGGTCTTTAAAAATGTTTATAAATAAAACATTTTAAGTAAGCTGTTA AAAAATTCACTTTAATTACTTTGCAGACCAGATAGTTGCTATGACGGAAT TAGACAAGGTATGTCGACGTTAGACGAAGTGACGGTACTTTTTATGTAGT GATTTGCTGGTCAACCTGAAATGGGCAGTTCCAGAAAAACCATTACCCCC CCCCCCCTGTGGACGACAGGGTTTTTTTGGATTCTTTTTCACTTGGAAAT CCTGAGAAATTTTGAAAAAGGTTACGGAAAAGGCACGATTTTCCTGATTA TTTGGTCATCCGTATCGGAAAATCCTTAAAATTTGCTCTATTTTCTTGTT AAGTATCGGAAAATCCAAGATTTAGAATTCCTTAAAAATTCTTTAAAAAT TCTTGAATAGCATAAGTGAATTGTTACGGAAAATCCATGTCGTCCACATG GGGTAACGAACTATAACTGGAACCGCCCAATCAATTCCAATAACGTTTCG TTTAATAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAA GATGTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCATGTATAACAC ACTGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATC AAACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAAC GGTTTGTTGTTGTACTTTTTGTTTTTCATTTGTGAGATTTTACTTAGGTG AGACTAATTTAATTTGTTGTTTTACGGGACAAGTAGCAAGCACATCATCA AAAACCGAGATTATTCATCCCGTTTCTACACTGTAACGTCTGTTCCACTT TGCGACTTTTTCGAATGTTTTGAGCCCAGGTTTTCGGGCTCTAAACATTC GATTTTTTGACGTCACTTTAAACGTTTGAAGCTCTTGTAGTATCAAAAAA TCGAATTTGCGTCAAAACACTTGAAAGGCTTCTTTTTTTTCGAAAATCGT GAAAGTGGAACTCACTAACACTAAGAAACGGGATGAAAAATCCCGGTTTT TGGTGAGGTGCTCTCTATAGTGAGTTCCACTTTGACGATTTTTCTCAAAA CATACGAAAAAGTCGCAAAGTGGAATAGACGTTAATTGTGTAGAAAAAGC GCGGGTGACGTCTAGTATAGTCTACGGGACAAGCTACCCAAAAAAGAGGG TCGGTCGGTCGGTCGGTCTGTCGGTCGGTCGGTCGGTCGGTGAAAAAATA AGAATAAAATATACTTCCACTTTTAAATGAGAGTAACGCATCAATACCAA CATCACATTTATTATGATGTCCTTTATCAAAATCTTGATTTATTTCTTTG TCTAGGTAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGT TTACGAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAAC ATAACGGAACAAAAGATTGAGGTTTGTATGATTACACGTTTTTTTATAAG GTACTTTAGCCCGGCTCCGAGCCTGGAGCTCCTCATTAGCGACATTATGT ATCAAAGATATTCTGCGGCTATGGTTGCGGGGCTGCCCATGCGGGTCGTC ACCAAAGGCGACATGTTGTTGTCTATTTTGCTCTGTACGGGAACAACACC AAAAAACCGTATAAGCAATAAGTCGACATAATGCCGTACGTCAAATATCG AACTTGCTTTCACCCGCCATTACTTGCCTCGCCGCTTTAACTGTAGCCGT AGAGAATTCCAGATACATAATCTCTTTATTTTTCCAGAGGGTTTAGCCTT AAAGTTCCCTATCGAGTTCCTTATTTACTTAGCTACTTAGTTTAGACTGA TATGATGCTTTGTTTAACAATGTTATACTACAATACATAAAAAAGACGTT TATTGAACGTTGTTTCGTCAATATTCTATAAATTTTTTTGTTTAGGTTGT TGTAAATGAGTGCAAGTCTAAATCGTACTGTTCCTTAACTTGTCTTGTTA TTCTCAGCCTGAATAATTCCTTAACAATTCCTTATTTTTTGGACCATTTC CAGCCTCAAGTTCCTTATAAACGTGTTCCTTAAAAAAAGATGTAGTGTCA AAAGCTAAAAATTGATCAAATCGATTAAGTAAAAAAGTCATTATAAGGGT AATTCTTATTGAACTACTTTCTTAACCAAAAAGGGGGGGTTTTATACTAA CTGTTAACACCTTCTCTCCGGGCCCGGCGGGGTACTACCCTTGCCGACCG ACGGGGGTGCTCCGCTGAGGTTCGAAAAATGGTCCCTACGTTGGACTCGT TTTTTCAAAAATTTTGCCCAAATTTGCGTAAAAAGTGACCCTGAATGGGG CTGAAATTCCAAAATTATCTCAAATTTTTTACTTTTTCCCCAAATTTTCC AAAAAAGACACCCTACGAGGGACTGATTTTTCTATTTTGAAGTTTTTGCG ACCCTAACCGGGACTCGTGGAGGTTAAAAAAGGTACCCTCACCAGCGGCG CATCCCCGTAACCCATTTTGCCCTAGTATCCCCCGGGACACCTCTCTTGG CACCCATAACGTGGTTCGTTTGGTTTGGTTTCGTTTACAGGCTTCTCGTA TCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGCA ATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAATGACTT CAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAAGG TATTGTCTTATTTGGTTATTAGGTAATCATCATCGAGTTTGAAAGCCCTG AAGGCTAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAAAAAATTGT ACCCCCTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCCTGGATTTT TTCAATTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCTTTTTACCA CCACTTTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTACCTCATTT TACTAACCACCCTGGATTTTTACACTCGAAAAACTAGACCCCTTTGATTT TTAATTTTACCGACCACCCTAGACTATTTCTGGAATAGCCACTTATTTAC CATATGAAACCTGTGACTCGCGTGGTTTTTGCACAAACGCCAAATTAAAA GGAAAATCCATTCACAGATTTTGAACACTATATGTCACTTCAAAATAAAA AGCGTTAGATTCAATCTCTCATTTTAAAAGCGGNAGGTAATTCTTATTGA ACTACTTTCTTAACCAAAAAGGGGGGGGTTCTATACTAACTGTTAACACC TTCTCTCCGGGCCCGGCGGGGTACTACCCTTGCCGACCGACGGGGGTGCT CCGCTGAGGTTCGAAAAATTTTGCCCAAATTTGCGTAAAAAGTGACCCTG AATGGGGCTGAAATTCCAAAATTTTATCAAATTTTTTACTTTTCCCCCAA ATTTTCCAAAAAGGACACCCTACGAGGGACTGATTTTTCTATTTTGAAGT TTTTGCGACCCTACCTGGGACTCGTGAAGGTTAAAAAAGGTACCCTCACC AGCGGCGCATCCCCGTAACCCATTTTGCCCTAGTATCCCCCGGGACACCT CTCTTGGCACTCCTTAACGTGGTTCGTTTGGTTTGGTTTCGTTTACAGGC TTCTCGTATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAG TCAAGGCAATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACT AATGACTTCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAAC AAATAAGGTATTGTCTTATTTGGTTATTAGGTAATCATCATCGAGTTTGA AAGCCCTGAAGGCTAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAA AAAATTGTACCCCCTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCC TGGATTTTTTCAATTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCT TTTTACCACCACTTTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTA CCTCATTTTACTAACCACCCTGGATTTTTACACTCGAAAAACTAGACCCC CTTGATTTTTAATTTTACCGACCACCCTAGACTATTTCTGGAATAGCCAC TTATTTACCATATGAAACCTGTGACTCGTGTGGTTTTTGCACAAACGCAA AATTAAAAGGAAAATCCATTCACAGATTTTGAACACTATATGTCACTTCA AAATAAAAAGCGTTAGATTCAATCTCTCATTTTAAAAGCGGCGCAAATCT TATTAAGGCTTTAAACCCAATGATCGTCTTATAAAAATGTTTTAAAACCT TGCCTTTTATTTTGCCTCAAACAAAGAAATAAACTTGCAAAAGTATACTT TAAGGAAAGAAATTTTAGCGGGAATTTAATCTGGCGTGTAGTCGAAAAAG TTTTTTCAGAGGGAATTTAATTTTGACGGATGGTGGGAAAAGTTAAAATA TCGGCGTTAACTTAATTTGGCGGAATTTGGCCAAATTTCACTTTCTTTCC ACCAAAATTTCTTCCCTTAAGGTGAATAATAGTGCAATCTGGATGTGCCA AAAAGTCATTAAAACATTGTGCACAAAGGTGAATGGTCCTGGAGTTTTTG CTGACGTCAACAATTACGTCATTTTTCAAAAAGCNTTGAAAGCCCTGAAG GCTAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAAAAAATTGTACC CCCTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCCTGGATTTTTTC AATTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCTTTTTACCACCA CTTTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTACCTCATTTTAC TAACCACCCTGGATTTTTACACTCGAAAAACTAGACCCCTTTGATTTTTA ATTTTACCGACCACCCTAGACTATTTCTGGAATAGCCACTTATTTACCAT ATGAAACCTGTGACTCGCGTGGTTTTTGCACAAACGCCAAATTAAAAGGA AAATCCATTCACAGATTTTGAACACTATATGTCACTTCAAAATAAAAAGC GTTAGATTCAATCTCTCATTTTAAAAGCGGCGCAAATCTTATTAAGGCTT TAAACCCAATGATCTTCGTATAAAAATGTTTTGAAACCTTGCCTTTTATT TTGCCTCAAACAAAGAAATAAACTTGCAAAAGTATACTTTAAGGAAAGAA ATTTTAGCGGGAATTTAATCTGGCGTGTAGTCGAAAAAGTTTTTTCAGAG GGAATTTAATTTTGACGGATGGTGGGGAAAATTAAAATATCGGCGGGAAC TTAATTTGGCGGAATTTGGCCAAATTTCACTTTCTTTCCACCAAAATTTC TTCCCTTAAGGTGAATAAAAGTGCAATCTGAATGTGCCAAAAAGTCATTA AAACATTGTGCACAAAGGTGAATGGTCCTGGAGTTTTTGCTGACGTCAAC AATTACGTCATTTTTCAAAAAGCCTTCCGCAATAACTTTTATTGGCTTCA TTTTCTGATGTAGGTAATGTATTTCTAAACGAGCATGAAAAACGCTTTCC AACGGTGTGTAAAATGACATACTTTGGAGAAAAAAATCATTTTAGCCTGG GAACCTGTTCTGGTCTGTAAAATACACAAACAGGTGCCAATTTTTCGGGT CTGAGATTTAAATCCATTTTTGACCCCTAAATTACAATTGTACAAAATCT CATGCTTGTACGCCTTTGTGCACAATTTTTACACAACTAGACCGTACTAA ATTTTTTTCTTCTTTGACAGGTCATTTCTGAAGAATTGATACGTAATTTG TTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCAA CGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGTAA GCAGAAAAAAAATTTACCCCTACTGTTTTGGATATTGACTTTTCGAAGTA TCGAACCCCCTGGCAGTCTGTGCCACTAACTCGATCGGGAAGATTTTTCC GAAATGGGAGGTTGAAAATTGACTGAATCTTCGGCGAAGCTTACGATGAC CTGCTAAAGTTGAAACTTTTTGGAGGTGAAAAAGCATCAAATTTTAAGAT TTTGCACTGAAAGAGAAATAAACTTTACCGTAGAAATCTTGTTAAATTGT GAAAAAACTGCGTAGGCTACCCGAACGGGAAGTTCCAACCCGATCGAGTT TTCCTTATTTTCTCGCTTCTTCCCGATCTGGAAGTCCGTTTTTTAACTCT TACCCATTCATTACCCGTTGGGTGTCAAGTTAATTTCCTGTTCGGGAAGG CTCTTCCCATTTCGGAAGAATCTTCCCGATCTAGTTAGTGGCACAGACTG CCTGGATATCCACTTTTAAAAATATGCTCAACTCCTTTGGATATCCTCTC TTATAAAGATGCTTACCTCTGGATATCGTACTTTTTACTTGAAAAGACAC TTTACCCCCTGGATATCCGCTCCCTTGTAGATATTTGAAATTTAAGATAT TTGAACAAAAATCGTTAAACCCCTTTGATATCCGATATCTTCAAAAGGAG GGGACGGACTTTTTCTGGAAAAGCTCATTATGGCGTAACATAAAAGTTGG TTAATTTTCGCGTGGGCGTTTTTCTTGAATTGAGAATCTAAAATTTTCGC ATTGACGAAATTTGGCGAATCGGCCTCTTTTTCACACTACAGTATATGGC CCCCAAAACGGAGACGGCCCCCAAAACGGAGGTTTTCATTAATATGAAGA TTCTGACTTGTAGATTTATCAGAATTAAACAATTGTTGTTTATTTTGAAA GAATGATGGTTATACTTAAAAATGAGCATGTTTTTGATGGTTTGATACAG ATTCAAAATAACATATTTGCGTCTAAAGGAAATATTTTAACACCATAATT AGATAAAAATTGGATATAACTCACTCTAGCTCCTTGGATATTGAAAATAA GTTATGAAAACGGGGTATAGAAAACTTTCTACACCTAATGCCGTTCAGAA ANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNGTATCTTAAAGATATCTCGAGAAATCGC TAAAATTGCAAACCTCCGTTTTGGGGGCCATTAGAAAAAAGCTACCTATC TTTAAGCGATTGAAAAAATTGTTGAAATTGAAAATTTTGAAAAAGAACTT CCAGGAAATAAAGTAGAGATGTTAAAGGGGTTCGTTCATGCAGCAAAAAT TTTTGTAAAAATCTCTTTTCCTCTAGATTTGAGAGAAATTTCAAATTTGA TCGCCGTTTTGGGGGCCACATACTGTATATCTTTCATTTTCCTAGGGGTT TTTGGCCAAAATTCGGATTTTAAAATTATTTCGCGAGGACTAATGTTTGC GAAAACCGCGAAGATTGATCAACGGGAAATTTGATTCAGTCAATTTTTTT AAAGAGGGTTTTGGTAAAGTCTTGTATTTTAACAGTTTCCTTATATTGTG ATCAATACTATGTGCTAGACCTTCGGTGAAATTGTTTTTGTGCTTCTCTT GGTAGGCATGCTTGACTCAAGGTGCCTTTTTCTTTATCGATGCCTTATCT TTCTGACATTCACAAGACCTTTTATTGTTTCAGCATAAAAAAGACGGAAT TGAGGAAATTTTTTCAAATAAATGATACATCCCCTAGTGTTTTATACACC TTTTCGACGGTAGCCGCCAATTGCCGTGCGGGCATTTTTATCCCACTAAA ACCGTCCCAGTCCTTTTTTTCGTACCTATAGACAATAAAAAAATGTGTCA AAAAAGAACTTGGACGGATAAAAATGCCCGCGCGGCAATTGGCGGCTACG GTCGAAAAGGTGTATTGAATGATTGTTTCGAAATTCTTTTAGATCAACAT TGCGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGTGACCACTA TCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCTCATATC GGGCATGGTTTCATGGCTGCACGCGAAGGAAACAGAGTGCGTAAGTAGAA GATTTTTTCGGGTAAACGTTAGCCACACATGGAATTAAAACACCTTCACA GTTGACTCTCTCTAATTCGATCTTCAAGGGACCAAGACATAGTTTCTACC CCCCTACATTTAGGGGGGGGGGTCTTGGGTTTTGATGAACCAAAAGCAAG GGGGTCTTAAAAGTATGACTTTTCTAAGGGGGTTGCCAGTTACTCTTAGG TGCCAAATAAACGGGGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTCTTCCTTGAATTATGACTCTTGTACAATCGTTC CATTTATACTGATTTTCTAAGGGGGGAGTGTGAAATTTGAAATGAATTTC CTAAGTAGGGGTTAGCACTTAAGGGAGGGGGGGGGTCCTCTTACCTAAGG GTCTTGACCCCTCTAGAAACTATGTAAGAATCTTTCTCGTAATTAAAGAA AGGTTCGAATTACAGAAAGCATTTTATACTAATTTCTAGCAGAGGTGACC AATGTTTTAGTTGAGGTTCAAATTAGAGAGAGTTTACTGTAGTGTGCGAT TCTCCCCAGCTGGCACACAACGTTATTTCAACGTTTATCTAATGTTCATA ACGTCCATATAACGTTAGATGAACGTTGAGACAACGTTGTGTGCCAGCTG GGTCGGTATCAGTCCATTGTTAGTTGGACGTAACTTAAGACCAGTTGATA GGCCTTATCGTAGCAATTCAAAACTTGCTATTGGTGAATAAAGTTATACT TTTCTAGAACAGATCACAGATTCCTTTCATGATCTTAAGCAAAGACTTCC AATTATTTTGTTCAAACTTTTTTGTACACTTTTTGATACTTCAAATTGTC ACACCTCGACTGTGAAAATGATGGGGCAAAGGAGTTGTTACTAGGGCGGT ATGATCATTCCCTTAAAACCTTTATTCATGATATGCACCATTGCAATGTC TTCCACGGACCCAACAGCTGATTGGTTGAAAGTGACGTATTGACTGATTT TACGACACTTGGAACCAATCAGCTATCGGGTCTATGGTATGATGTAATGT CAGAAGACATTGCAGTGGTGCATATCATGAATACCATTATTTTGACTTTG TGTTTTCTTCTTTTGATGTACAAGAAAAAACAAAATTTGAATTATAGTAC TTCAAGTTTCATCTTTTTCGAATCGTCAGCTATCAAATGAAAAAAGACAA ATGCTATGATTTTAAGTTGAAAAATTTGGATTGATCGTAAAAAAAATTAT ATTTGGAATGAATCCCTAGGGTCATGATTTCTTCTTTTTTCATATTTCGA CAGAACGAGCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACAC GGAGGTTTCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATC CTATGTTTTCTCCACTTTCTTCAAGGTAAGTTTGTGGGATTGTCTAAATA CATCTATTACCGTAAGTTGGTCTAATATCGACATCCCTCTTCTAATTCCG ATACCCTTCTTTAGAGAAAGGAGTAATATGAAAGCTTGAATCGCTGATTG AAAAAGGATTATTCCTCTCTAAGCACTAAACAAAGAAAAACAGTTTCAAC TTTTCTATAAATTTCAGCTGATAAAAAGGGTGTGGGAATTAGAGGAGGGT TGTCGACATTAGACCAAGTTACGGTAACCTTTAGCAGCGCTGTCAGCTTT TAAGGAGACTGGTATAACGAAAATACAAGGAAAACTCTTCGGACGACAGT ATTGAAAACACAATTGTAGGAAAGTGTAAAGTGTGAAAAGTGTAAGATAC CCTTGCATTGAAGTGAGAAAGTAACATCAAAATAGTTTAGCTATCTGAAT ACTAAAATAGTTTATACTCCACCTCAGATACTCGGTAAAATGCTTCTTTG CCTTGGCCGGGGATTTACTTGGTTTGATTCGTCTGTAGCCAAAATCATGC CGTCCGCTGAGAACAAATTTTTCTTGTAAGTTCATTACCAGTCCCTTAAA AAGCTGACCGCGCCGCTAAAGGTTGATAAAGTTGTATATTGTACTAAGTA ACATTTTTTTTCTCAATTCATAGGTAATTGGTAAATAAATGAGACATTTA TAATGCGTGACAATGACTTAATTTGTAAAGGTTTGCAATGTTGTGTGTTA CTTCTTCCTTTTATGCAAGCTATATTTCGGCTTGGAAATGTTAGCGTCGT TGAGAAATCTAAATCTTTACCACTTCTCGTTTTATTTCAGTTATTTTTCT TGGTCGTGGTGTTTGGTATGTTTCACGGTGTAGTGTATTTACCCATCGTG CTTAGCTTGGTCGGTCCCGAACCGTACGCATCTTCCGAACCTTCAACTCC ATCAGCCTCCACCACAAGCGCTGGTAAACCTCCATTACCAAACAATGGTG TCGAAATGACTGATGACAAAGAACCCGAAACTAAGACAGGTGAGTGGTTT ATCCAGAGTTATCTGTTGTAATTAGAAAGAAAGACGACCGTGAAATCTAA CTCTCTCTGATGTATAACTATACTACTAGGATGATTGCTGCATGGCAAAA GGCGGCAAAATTTCTGAATTGGAATAGTGATGCGGTTGGAAAATTCAATA TTCTATATCTAACTAATCCTAGGATAAAATTTAATTCTAAATTGCCATGA GGAAGGGCTGAATCACTAATACGTGTGCTACGATAGACCGTTTTTTTAGC TGCAAATCTTTTTAAAATCGCGTACATTTTTCATGGATTGATATTTAATT ATTATGGTTGCAAATGGCGGTGAAACACACATTATAACCATCTACTTATA ATTTGGGGTGGTCACAATCATTAAATCAATTTACTAACCACGCCCATTGC ACTACATTGCATAACATCAAACAACGCCCAATAATTTACGCCCGACAACG ACAAACTTGACAAATTGGTTGACGAACTGGATATTAATCTCACAACTAAC TAAATTTTTCTCTTGAAAGGTACTAATACTTTTTACTACTTATCTAATAT TTTTTTGTCTTTTAAACCTCCTTCTCACAGACCCGATAGGACTACTCTCA GTCAGTAGGGGTTAAAGTAACGGGGGATTGGGGATTGATATCCATATGTT TTTTATGGCTAGGGATTCGAATTCTATTGTTTTCATTGGCGATTGAAAAG ATAGCACACTATTTTGCAGCGAGGTTTTATTTATTTGATTATTTCCAGCG GAGACAAAAATTGTTCACTTTGGACGATATTTTGGCCAATTTTTCCAGTT GGAGGGTGTCCCACCGTATCTGTGAGAAAGTGGTGTTCTTTTGTTTCATT ATATACGCTTTGCACCCCTTACTACTAATATTTTTGGATGACCCGTGGCC ATTCCGTTCAATTCAAAACGATGTGAGCCAAATATTATTTTGTTCAAGGT TACAACCTTTTTTGAGCTAATTTTAGCAAAAAATTACAAGTAGAGAGGTC TAATTCTTTGATTCTACTAAACCCTACAGTAGCGTAGACTGGAGGAGTGC AAAATTTGTGAAGGAGAGCAGATTTTTATGACACTATAATTTTCCAATAA TACCATGAATACATGAATAGATAATTACAGTGTCATAAAGATCTGCTCTC CTACACAAATTTTGCGCCCCTCTTGACTATGCTACGGCGCTAAACAAATA ACCCATATAACCCAAATAACATTTGCTATTATTAATAATGACTAACACGC TTTTTTTTTTATAAGAATACACTTTATAAGAATGTCCATGATGAAAATGG CCAAAAAATTAAGAATATGCTAAGAATATCACCATCATGGAATTTTGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTCATTT TTAGAGCATTCTAAATCATAAATTGCCAATTACCCCCAAGTAATAAGAAT GCTGTAAGAATATTTTAGGATGATTTTCCCAAAAAAGTTAAGAATATCCA TGATGAAATGGATTTACACCATTCTTATAAAAAAGAAAGCGTGAATTTAA TGCATGGATTCAAATGACCAAATTTTTACGCTTTATCTGTTTCCAATTTA GCCAATAAATCGCTTTCATTGTTCTTTTCTTTTAGAAATGCTTCATTATT GAGATCCTTCACACAAATTTTTAAATCACATCATCGATTTTCACCCAAAG ACGAATCCGAAAAGACTGGCGTCATTGTTTTAACCCAATCGAAATGGCTT CATGTTCCACCATCCACATTTTTTTTTGTTGTTGTTTTTGCACTTTGGTC GAGTAGATTGTTGGGAAAATAGAATTTTGAAGGAATAGATGTTATCGGAG TTTTTTATTTTTCTAAAAAAACGATGCATTGTGGGATTGTTTCGTGAGGA TTACAATAGAATTCCCTCGAGGAATTCCTAAGAGATTTCTATTGTAATAC TCTGGAAACAATCCCACAATGCATCGCTTTTTTAGAAAAATCAAACACTC CGATATGATCTATTTATCGACACTGGGGAAAAGGAGAAGACTGACAAAAC CATAAAATATTTGGTAACTTGGGAAGCCACTTATTCTTTTTATACCCAGA TCTCTCAATAACGAAGAGGAAAATGTCGGGAGTTTTTGTGAAAATCTGGT ACGGCAGTCGACGTACCTGCCGTACCCGGTGCGTCGTACACGATTCTGGA TCATTTATGAGGAACTGCCAATATCTTTTTTGCTAAAATTCATAACATGG CGCAGGTCTCAGCAACCCATACCGTATGGAATTAATATTCAAATCCCTTT CAAATTAAATGTCAGTAAATTTACCAATATGAATAGGTTTTGATGAAGTT TGAATTTGAATTGTGATTTTATTCTCGTGGAAAAGGTAATTGTTAGTGGA ATACCTTCATTCTAAATGATCATTACGTAGAAATTAGTGTGCTTTTACGT TTCGCGATTTCTACTGATTTTCTTGAGCACTTCTTAACCTTATTCGAACT AAGGGGGCTTTTTCTGTTCGGGGCTTGAAACTAATGTTAATAGCTCCTGA AATGATTGAGCTTTTGGCATGAAATTTTCTGTAAATTCCTAACTTTTATT TTGCTTCAAAATAAAAGAGATTTTCACACCAAAAAATTCTCACATCTTGA GCATGATGACATTTCTGACAGTAAGGTGTCATAAAAATTGACAATTTTCC AATACAAATTTATTTTTACTGTCAAATATATCGTTGAAACCGTAATTTAT TGAATATTTAGAATGAAATAAGCATTTTAAAATCAGGAAACCTTTTACCA AAGCCTTTGTTAGATTACAATAGCTATTTTGAAGAACAAAGGAAATTTTC GATTTTGACTCACTTTGAGCATAATGAGTGACGTCATCGAAAAAAAATTT TTTGTCAAAAGTTACTTTATATGATAAGAATCTTGTGTGCCAAATTTCAT CCAAAAAGACCTACTAGATCAAAAGTTACGTGGTGGTACAGGAAAAGCCC ACCCTAGTTTTGGACCGCCCCTAAAAGCCTAGTATGAATAGGGCTAAGTG CGTTTTATGATATTTATCCTGTGTAAATAATTATTTGTTTTGTAAGTTTT TATATATTTAGCAAACTGATTCTCGGGTAGCGAGCACCTCACTAAAAACC GGGATTTTTCATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAGAA TAATTATTCGTCTCTTAATTAGGATAGATATTTAGATAATAAAAATTAGA TATACAGATGAACAGCAACAAAAGGCTACATCAACAACAGATTCATGAAG ATAAAAATCCTTGCAAGGAAGTTAAAAGCAAGGCATACTGTACTTATCAA AAATCACAAAATTGTATACACTTTTCATTTTTCACTAAGCTTAGAATTAT AATTATATCCAAGCCCAAGCTGGACAAAAAATCAAAAAATTTTCAAAAAC AAAGATGCTGTAAATCAGTACTGTACTGTATTTTCCCTAATCTGAGCCTA AATATGCTTAAAAGTGCAATATTTATCTATTAAAAAATATTTAATCCATT TATATACATTTATNATGGCGCAGGTCTCAGCAACCCATACCGTATGGAAT TAATATTCAAATCCCTTTCAAATTAAATGTCAGTAAATTTACCAATATGA ATAGGTTTTGATGAAGTTTGAATTTGAATTGTGATTTTATTCTCGTGGAA AAGGTAATTGTTAGTGGAATACCTTCATTCTAAATGATCATTACGTAGAA ATTAGTGTGCTTTTACGTTTCGCGATTTCTACTGATTTTCTTGAGCACTT CTTAACCTTATTCGAACTAAGGGGGCTTTTTCTGTTCGGGGCTTGAAACT AATGTTAATAGCTCCTGAAATGATTGAGCTTTTGGCATGAAATTTTCTGT AAATTCCTAACTTTTATTTTGCTTCAAAATAAAAGAGATTTTCACACCAA AAAATTCTCACATCTTGAGCATGATGACATTTCTGACAGTAAGGTGTCAT AAAAATTGACAATTTTCCAATACAAATTTATTTTTACTGTCAAATATATC GTTGAAACCGTAATTTATTGAATATTTAGAATGAAATAAGCATTTTAAAA TCAGGAAACCTTTTACCAAAGCCTTTGTTAGATTACAATAGCTATTTTGA AGAACAAAGGAAATTTTCGATTTTGACTCACTTTGAGCATAATGAGTGAC GTCATCGAAAAAAAATTTTTTGTCAAAAGTTACTTTATATGATAAGAATC TTGTGTGCCAAATTTCATCCAAAAAGACCTACTAGATCAAAAGTTACGTG GTGGTACAGGAAAAGCCCACCCTAGTTTTGGACCGCCCCTAAAAGCCTAG TATGAATAGGGCTAAGTGCGTTTTATGATATTTATCCTGTGTAAATAATT ATTTGTTTTGTAAGTTTTTATATATTTAGCAAACTGATTCTCGGGTAGCG AGCACCTCACTAAAAACCGGGATTTTTCATCGCGTTTCTTTTGTCTATAA AATATGCTGACAAAGCATATTTAAAGAAGGATATTTCCGACCATCAATTT TCCCACGATTTTGAAAAAATTCAAAGTTTTAGATATGTCCGACCATCAAA AGATATTTCCGAACATCTTATGATATTTCCGACCAATAAAATGATATTTC CGACCAATAAAATGATATTTCCGACCAATAAAATGATATTTCCGAACATC TTATGATATTTCCGACCAATAAAATTATATTTCCGAACATCTTATGATAT TTCCGACCAATAAAATGATATTTCCGAACATCTTATGATGTAACCGACCA ATAAAATGATATTTCGTCTAAGGGAAAAAAGCGAGTTTATGTATGTGTGT TTTCAGCGACGGAGACGGTAAGGTTCTAATTTGAGTAGATCCTGACCAGC TGAGGACGACGGTAAATCAGCACNTGCCATCAAATCACAGTGAAAAAATG CAAGTCTAGAAAAACATAATTTCTGTCAATAATTTGATGAAGAATACTTC AGCCTTTCTGGAATTTACATAGGAGCTTCACTTTAAATATATATAGTTAA TTAATTTCCATTTACGCTTGATCATAATTATCTCCAAGTCAAAAAGAACA AATGCAAGTGTCTGCTTTCAAATCGCAGTGAAAACTTTAAGTCTAGAAAA AATCATTTTTACGTCAATAATTTGATCAAGAACTTCGGTCTTTCTCAAAT TCACATAGGAGCGGTACTTTAATATACTNCGGGCGGAATTTCGGGTTTTT CCAAATCGCTTCAGTCACTCTACCGTCCTCAAAAGTGCAAATACATAAAC TCGGTAAATAATGAGCTGCGCCGCGAAAATGTTTCCCTTTAAAGAACTGT CGTGGTGTCAAATGGTTTGGATACAAGTTTAGTTAGATTTGTCCGAATTT TAACCCTGTTTTCATCTTCAAATTTTCTAAAAAATACGAATTGTCGGTAG ACCTCGGCTCGAAATTTAAAGTTATTAAATAGTGATCCTGGATGGCATGA AACTTTGAGTATGAAATTAACTTAAATCGTTTTCTTTACTCAAACTAGTT ATTAATAAACCAGCTGCGCTGGAAGGTCAGCCTAAATTGCTTAATATGAT TAGAAAGATATGTTGTTAAAAATTGATATGATTTACTAAAACGAGAGTGA NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTGC ATCAATAATTTGATGAAGAACTTCGTTCTTTCTCAAATTTACATAGGAGC TGTACTTTAATATACTTGATCAATTTCCATTTACGCTTTATCATAATTAC CTCCAAGTCCAGAAGAACAAGCATATAAAATGCCTATCAAATCTTAAGAT AGAAAACACTCAAGTTCGAGAAAACATTATTTTTGTGAATAATCAGATAA TAAAGCTGTGAACTGTAATATATATACACTCCATCAAATTCCAGTAATTG TTGGTGGTTATTCTATATTCAAGTCCAAAATGAAAAAATATGTTTTCATG CTACAAAATAAATAAATGAGGTCTAGCATGTAAAAAAATAACTCACAATT CAGGAAAAAACTTGAGCAAATAAGTTAAAATCTTCATACTTTAAAGAAAA GAACATCCTTATAATCTAACTCCAGTGTTGCATCTTCCTTAGTTATAAGT TTAAAAGCCATTTCAACAAGATGTAATGATTGTATAAATAAAAGCTGGCA AGAGATAAACACCGAACGAACGAAAAAGACTTTGCTTTTAAGCTGCCATC TTGAAACACCACATTATGATCTGTAAAAACAACGCACGCTAAAAGTACGC AAAAAGTTAACCCGATCGGAAGAAAGTTTAGAAATCATCATAGTAAGATC GGAAAATCGGATTTTTTTTTGTCGTCTTATGGAACTGGAAAATTTTACCT ATTTGAATGCTCAGCTTCGGCTGACCAAAAAGTATTTGTTTCTCTAAGCC ATTTCTCGTGTGAAAATTTTCATTTTTAAGATTCCATGATCATTACAATT AACACATTTATAACCAATAACATTATTTTTATCTTTCCCATCCCACTCTT CTCCAAANATAGTAGGTATATAAATGTAAGTTTTCATAATCCGGTGTGTT TATTTTCGTTAGTTTATTTGGTTGTATAGTGAAAAAGTTATTTAATGTAA ATATAATTTATTCTTAATTTGTTTTTCTCCGGAACAAAAATCTCCTAAGA AACTTTTGCTAAGGACACTACACGCTTTTTTTTTTATAAGAATACACTTT ATAAGAATGTCCAGGATGAAAATGGCCAAAAATTTAAGAATATGGTAAGA ATATCACCATCATGGAATTTAGCAACTGAACCTAAGAATACCATTTTTAA TGCATTTTAACCTGTAGATTGCCAATTTCGATCTTAACCTAAGAATACCG TAAGAATATTTTTGGATGATTTTCTCCAAAAAGTGAAGAATATCCATGAT GAAATGAAAAAACACCATTCTTATAAAAAAAAAAGCGTGTACTCTCGGGT ACCTAATAAGGACCCCTACTTATTATTCTTTGGGAAATGTTTTTTGAAAA TTCCCTCTTTTGCCCTAATTCTGCTGTATTAGCCTTCCTTTCACAAATTT TCAGCCCGACACATTTTTATTCCAACACCCTTCCCCCGGTTAATAAGTTT TGCGAATTTTCTCATCAACTTCGCTTATTTAAAACCCCCCATTCATAATA CAATCAAAGTCATAATAATTGAGAAAAAAAAGGAAATTCCCACGAAATCT TAGGTTGGAAGGGTAGAGTTTTAACTCTGAGTTTTAACGCTAGACTTAAG ACTTAATAGGGCTAAGAATATAGCCTGGAAGTCTATAAACCCCTCCCGAA TTGAAATATTCGAATAAATTAATCCAAAAGCGACTTTCTCGCCCGAACTT TAAATGGCTAAAAACGAGGAATTAATCAAAACTCTCAATATATTTTGACC GAGATTGAGTAAATGGCTTCGTTTCCAATCCAAGAGCTTCATCTAGAGAA TGACCTGTGTGGTTTGTGCACAAACGTTGGATGGAAAGTAGAATCTATCA ATTCTTTGCCACGGAAAGTCATGTGACATCTTTTTCGACCAATAAGATTT AATAATTTCGAGGATAAAACAAAAACTATGGTTTAACTCACTAAAAGATT ATGTTTACTGAAAACACATAATTAATCTTTAGAAAGTGTTCTGTTGTACC CCAGTTCTGACGTCATGCCGTGGCGAAGAATAGATTAAACTACTCAAGAA CAAACTAGAACTAGATTCAATTTATTTTCTAAATGCTGTGCAAATTTTAA AGCGTCGCAGTTTCTTGCTTAGGAAAAGTTAAGTTTCTCTAGCCATACAG GCTTAAAACTCAAAATCCATATTCCATCCAAGAGATTCCCCTTAACTATT AACCCCAAGCTTTTTTGACTTTTGTATCCCCAGGGGGGGGGGTAGAATCT ACCACCCTCGATTATTTTGATCTAGGAGAGCTACGGTCATGAAATTTGGT ACAGATGTTCTCCATCATGACACAAATTTCCTGGAACAAAAAAAAATTTG ATGACGTCATTCAAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTC TTCTTTAACATAATTGCCGGTTTTGCAGTTTCCATGAAGATTTTATCTTA AAATTTGTGCTGAAGATGAGTTAAATTTTCAAAATTTGATGACGTCATTA AGTTTTTCTTGAAATTGGTAGTTTAAGGTCTGATAAAGATACTTATGCTT ATGGGTTTAATTTATGGCTGCAGGGTTTTCAATGGGCTTAAAATGTGGCC TCAATCATACTTCAATCACTAATTTATCAATTTACACATTCCAGGTTGGG TTTTGTTTTCGATACATGAATACTTGCAAAGCCTAAAGCAAAACAAACAC AATCTGACACAATACAGTGTTATTTTAAGAAAGAGTGTACATTTTGTGGC TGCAAATACCATTTTTTGTAAATAACCTTCTGAGCTGTTACATATAAGTA TTAGTTGGCATTTTTAGGGTTGGCTTATGTGCTGTCCTGCTTTAAGACTT CAATATTTTTTAACCATTTCTCTTGAAATTGGTAGTTCAAGGTCTTAAGA TACTTATGGGTTTAATTTGTGGCGGCATGGTTTTCAATGGGCTTAAAATG TGGCTTCAATCAAAGCATATATGAAAAAAATCGTCAACTTTGAGCCGCAA TTCTAGCCCAATGACCCGATAATTTTGGTTCCATTTTTGATTTTTACTCA TTGAACAAATTTGTGGCTGCTGTTTTATCAACATAGTGTTTTTCTTGATT TGTGCCGCAATTTTGGCCCATTTCACAAATTTTTTTTTCAACCTACTTTA GAACCAATATTGTGAAGTTTCCTTTGAAAAGAGTTATTTTTAAAAAGGAT ATTCAAATTTCTTTTTTTTTGCTGTTTTTGAAAACCTCACACAATTTTTG AATGCCATCATCTCCGGACTAGGCTTTTTAGTCTCAAAATTCGATTTTAT TCCTTATTATCTTTCAGCTGGTGTTGACAATGCCTCATTCGTCGAAGCAA CGCTAGCATCTTGAAAAATTACAAACTTTGTTACTATGGTAATAATTTAG CAAGGTATAACATTATTTAGTGTTATTTTTTATTTCCTTCTATATAATTA TTTTAATACTTGAATATAAAGTCCATTCGCTTTTTTGATTATGTACCCTT TCTTACTGGCATGTAGAAACCATGACATCATAACCAGACTTATTCCCTAG AGAGCGGTTTCCACATGGCAGCAAATAAGATTATGTACCCTTTCATGCTG GCATGTAGAAACCATGACATCATACTTTAAGGGCAGAAAGTTTCGCGAAG TCGAAAACTGACCGCGAAAAAAACTTTCGCGTTTTTCAGGTTTAATTTCT TACCTGGCAGAAACCCGCGAAAAAGGATCAAAATCGCGAAAAACGCGAAA GTTTCTGCCCGCGAAAGTAACCAGACTTCTTCCCTTGAGAGTGGTTTCCA CATGGTAGCAAATAAGAGTGTACACTTGAACGAATGGACTTAAGTTATAA TGAAGCTACCCTAAGGGAACTAATTTTAGTGGTTTAAAAAAATTGCGAAA AATCGCATTTCGCGGGAATTAATTTTCGCAGTTTTGCCCTATTTTTGACA AATTTCTTTCATTTTCTTAGGTATTTTTCAATTTTTAATAAAAAATGGCC AAATATGCAATTCGTGGGTTCTAATTTTTGCGGTTTTGTCAAAAAACCGC GAAAAAACAGCAAAAATTAGTTCGCTTATGGTATGTTTGAAGGTAAGCTG TATATTTTAATGTTTTGAATATGAAATTTATTTTTTAATATCAAAGTTAA ACCTTCCTAAATTTGATACCTCTTTAGGTTACGCCGATGTTTTCAATTTG AAATAGCTCGTTCTCGGCTGAAAACTGAGCCCGGTAATTTGAAAGAACTA AAAAAAACATTAGGGGCTGATGCACAATTTACGGGTTCATATAAAAACAG TGTAATTTGATCACAATTAACGTTCTTGAGAGACTTTGAACGTTTAATTA CGTTGTATCCATTGACTTCCAAGCCCGAAGGGCTAGACACAAGACTCCTG TATGGGAAATGAAACCACCTATTTCTCACCCTAAACGCGTAACCGCGTGG TTCTCACACGAACGCTAGATTTAAAATAAAACCCATCGCCATATTTCGAT TATGCCTGGTGAAAACAAAGAAAGTGCTAGATTTAATCCGTTATTTTAAT CTTAGGACTTCACTTTTTCTTGCTTGAGAAAGGTTGAAGATTTATCTCTA GCCACTTCGGGGTTTTAAACTCAATGGTTGTACACGNTCACTTTTTCTTG CTTGAGAAAGGTTGAAGATTTATCTCTAGCCACTTCGGGGTTTTAAACTC AATGGTTGTACACGATTTTTTTTTTTTTTAAGTATAGTGTACTTAGGATG TGGGTCAAGTATTCTTAAGAAAGTGCCAAAATTGAGGGTGAAATATTCTT AACGTATACTTACTTTTTTAGACTTGACTTTTTTACAAACATGAGAAATT ATCAATTTGAGAGTTTTCGACTTTTGAGTGAACATTTGGGTTAGAATTAC ATTTCTTCCTCAAAGCTTCATTATCTCTAACAAAGGAAGCAGTTTTTTCT GTTGACCAAATACAAAATGACTTTATTCTTATCAAATTCTGTGAAATTCA CCCCCGAGGGTATTCTTAGGGTATTCTTACGATTTGGCCAATTTTCACCC TAATATTCTTATAGAACATATTCTTATAAAAAAAGCGTGTACCTGGCCGT ATCACTAAAAGTTAAAATCATTGTTTGGTGATTGTGTTGTACAGTATACC ATTGTATTCGTATTTTTAAAGATTTTTTTTGATAATCTTGTTGGTTTTGT ATTTAGTTCAATTGTATAATATTTTCACTCTCTTTCAAGAAAGTTTTATA TTTAAAGAAATATTTATCGTGT

Coding sequence (CDS) from alignment at scaffold_91:309920..339741-

>TCONS_00073403 ID=TCONS_00073403|Name=TCONS_00073403|organism=Clytia hemisphaerica|type=CDS|length=13110bp|location=Sequence derived from alignment at scaffold_91:309920..339741- (Clytia hemisphaerica)
CTGGTGTTGACAATGCCTCATTCGTCGAAGCAACGCTAGCATCTTGATTA
TTTTTCTTGGTCGTGGTGTTTGGTATGTTTCACGGTGTAGTGTATTTACC
CATCGTGCTTAGCTTGGTCGGTCCCGAACCGTACGCATCTTCCGAACCTT
CAACTCCATCAGCCTCCACCACAAGCGCTGGTAAACCTCCATTACCAAAC
AATGGTGTCGAAATGACTGATGACAAAGAACCCGAAACTAAGACAGAACG
AGCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACACGGAGGTT
TCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATCCTATGTT
TTCTCCACTTTCTTCAAGATCAACATTGCGGGTTACATGCATTTCTGGGG
ATTGACGGTTGATACGGTGACCACTATCCAGTTGATTCTGGCTATCGGTC
TGTCAGTCGATTATTCCGCTCATATCGGGCATGGTTTCATGGCTGCACGC
GAAGGAAACAGAGTGCGTCATTTCTGAAGAATTGATACGTAATTTGTTGT
TGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCAACGTC
TGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGCTTCTCG
TATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGG
CAATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAATGAC
TTCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAA
GGTAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTTAC
GAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAA
CGGAACAAAAGATTGAGTATTTCTCGAATGATGGTATCCAAGCCTATGCG
TACATTGAAGATGTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCAT
GTATAACACACTGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGA
GTTGGTATCAAACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGAT
TTGACCAACGATTGTTTTGATGTTGGTATGGGCTGGTTTATTAGCGGGAG
GTGCATACGGTCTTTCACAATTGAAACAAGATTTCGATCCTGAATGGTTT
TTACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTGGATGATAAGAT
GTACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATTCTCTCTA
CGCCTGGTCGGCTGGTGTTGACAATGCCTCATTCGTCGAAGCAACGCTAG
CATCTTGATTATTTTTCTTGGTCGTGGTGTTTGGTATGTTTCACGGTGTA
GTGTATTTACCCATCGTGCTTAGCTTGGTCGGTCCCGAACCGTACGCATC
TTCCGAACCTTCAACTCCATCAGCCTCCACCACAAGCGCTGGTAAACCTC
CATTACCAAACAATGGTGTCGAAATGACTGATGACAAAGAACCCGAAACT
AAGACAGAACGAGCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGT
ACACGGAGGTTTCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCAC
AATCCTATGTTTTCTCCACTTTCTTCAAGATCAACATTGCGGGTTACATG
CATTTCTGGGGATTGACGGTTGATACGGTGACCACTATCCAGTTGATTCT
GGCTATCGGTCTGTCAGTCGATTATTCCGCTCATATCGGGCATGGTTTCA
TGGCTGCACGCGAAGGAAACAGAGTGCGTCATTTCTGAAGAATTGATACG
TAATTTGTTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGA
TCGCCAACGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACT
CTGGCTTCTCGTATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGT
TGAAGTCAAGGCAATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACAT
TCACTAATGACTTCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGG
GAAACAAATAAGGTAAACCAAGTACGAAAGATATATTTTACAATCGATTA
GATGAGTTTACGAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAA
AGGAAACATAACGGAACAAAAGATTGAGTATTTCTCGAATGATGGTATCC
AAGCCTATGCGTACATTGAAGATGTTGACTATTTTGCAGACCAGGACAAG
TTAGTGAGCATGTATAACACACTGGAGAATAACCAGTACACTGTTAAGGG
AGAAACTCAGAGTTGGTATCAAACCTATATCGCATGGATGGCAGCCAATC
ACGCCGCTGATTTGACCAACGATTGTTTTGATGTTGGTATGGGCTGGTTT
ATTAGCGGGAGGTGCATACGGTCTTTCACAATTGAAACAAGATTTCGATC
CTGAATGGTTTTTACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTG
GATGATAAGATGTACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGC
AATTCTCTCTACGCCTGGTCGGCTGGTGTTGACAATGCCTCATTCGTCGA
AGCAACGCTAGCATCTTGATTATTTTTCTTGGTCGTGGTGTTTGGTATGT
TTCACGGTGTAGTGTATTTACCCATCGTGCTTAGCTTGGTCGGTCCCGAA
CCGTACGCATCTTCCGAACCTTCAACTCCATCAGCCTCCACCACAAGCGC
TGGTAAACCTCCATTACCAAACAATGGTGTCGAAATGACTGATGACAAAG
AACCCGAAACTAAGACAGAACGAGCTGCGCATGCGCTAGAAGAGATTGGA
CCAGCAGTGGTACACGGAGGTTTCAGTACCTTCTTAGCTTTCGTCTGTCT
TGGTGCATCACAATCCTATGTTTTCTCCACTTTCTTCAAGATCAACATTG
CGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGTGACCACTATC
CAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCTCATATCGG
GCATGGTTTCATGGCTGCACGCGAAGGAAACAGAGTGCGTCATTTCTGAA
GAATTGATACGTAATTTGTTGTTGGCTGGTGTTATTGTGTTCTTGGTGAC
ATTGTTCTTGATCGCCAACGTCTGGGTCTCCTTACTCGTCCTCACATGTG
TTGTCTTCACTCTGGCTTCTCGTATCAAATACAAACATATCAAATTGGAA
GGCGCTTCGGTTGAAGTCAAGGCAATGGACAGTGTGCAAGATGAGCTTGC
CAAAATCACATTCACTAATGACTTCAGTCCTTTCGGTTACACAAGGTTCT
ACGTTGGCTGGGAAACAAATAAGGTAAACCAAGTACGAAAGATATATTTT
ACAATCGATTAGATGAGTTTACGAAAACACAAGTTGGGAAAGTTTTCGAG
AAGGAGATCAAAGGAAACATAACGGAACAAAAGATTGAGTATTTCTCGAA
TGATGGTATCCAAGCCTATGCGTACATTGAAGATGTTGACTATTTTGCAG
ACCAGGACAAGTTAGTGAGCATGTATAACACACTGGAGAATAACCAGTAC
ACTGTTAAGGGAGAAACTCAGAGTTGGTATCAAACCTATATCGCATGGAT
GGCAGCCAATCACGCCGCTGATTTGACCAACGATTGTTTTGATGTTGGTA
TGGGCTGGTTTATTAGCGGGAGGTGCATACGGTCTTTCACAATTGAAACA
AGATTTCGATCCTGAATGGTTTTTACCGGAAGATTCGAACGCCAGGATTT
ACAGCTCCGTGGATGATAAGATGTACCTTCAAGAGTTCATGAGAGGAACT
TATTCAAAAGCAATTCTCTCTACGCCTGGTCGGCTGGTGTTGACAATGCC
TCATTCGTCGAAGCAACGCTAGCATCTTGATTATTTTTCTTGGTCGTGGT
GTTTGGTATGTTTCACGGTGTAGTGTATTTACCCATCGTGCTTAGCTTGG
TCGGTCCCGAACCGTACGCATCTTCCGAACCTTCAACTCCATCAGCCTCC
ACCACAAGCGCTGGTAAACCTCCATTACCAAACAATGGTGTCGAAATGAC
TGATGACAAAGAACCCGAAACTAAGACAGAACGAGCTGCGCATGCGCTAG
AAGAGATTGGACCAGCAGTGGTACACGGAGGTTTCAGTACCTTCTTAGCT
TTCGTCTGTCTTGGTGCATCACAATCCTATGTTTTCTCCACTTTCTTCAA
GATCAACATTGCGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGG
TGACCACTATCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCC
GCTCATATCGGGCATGGTTTCATGGCTGCACGCGAAGGAAACAGAGTGCG
TCATTTCTGAAGAATTGATACGTAATTTGTTGTTGGCTGGTGTTATTGTG
TTCTTGGTGACATTGTTCTTGATCGCCAACGTCTGGGTCTCCTTACTCGT
CCTCACATGTGTTGTCTTCACTCTGGCTTCTCGTATCAAATACAAACATA
TCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGCAATGGACAGTGTGCAA
GATGAGCTTGCCAAAATCACATTCACTAATGACTTCAGTCCTTTCGGTTA
CACAAGGTTCTACGTTGGCTGGGAAACAAATAAGGTAAACCAAGTACGAA
AGATATATTTTACAATCGATTAGATGAGTTTACGAAAACACAAGTTGGGA
AAGTTTTCGAGAAGGAGATCAAAGGAAACATAACGGAACAAAAGATTGAG
TATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGATGTTGA
CTATTTTGCAGACCAGGACAAGTTAGTGAGCATGTATAACACACTGGAGA
ATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAAACCTAT
ATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGATTGTTT
TGATGTTGGTATGGGCTGGTTTATTAGCGGGAGGTGCATACGGTCTTTCA
CAATTGAAACAAGATTTCGATCCTGAATGGTTTTTACCGGAAGATTCGAA
CGCCAGGATTTACAGCTCCGTGGATGATAAGATGTACCTTCAAGAGTTCA
TGAGAGGAACTTATTCAAAAGCAATTCTCTCTACGCCTGGTCGGCTGGTG
TTGACAATGCCTCATTCGTCGAAGCAACGCTAGCATCTTGATTATTTTTC
TTGGTCGTGGTGTTTGGTATGTTTCACGGTGTAGTGTATTTACCCATCGT
GCTTAGCTTGGTCGGTCCCGAACCGTACGCATCTTCCGAACCTTCAACTC
CATCAGCCTCCACCACAAGCGCTGGTAAACCTCCATTACCAAACAATGGT
GTCGAAATGACTGATGACAAAGAACCCGAAACTAAGACAGAACGAGCTGC
GCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACACGGAGGTTTCAGTA
CCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATCCTATGTTTTCTCC
ACTTTCTTCAAGATCAACATTGCGGGTTACATGCATTTCTGGGGATTGAC
GGTTGATACGGTGACCACTATCCAGTTGATTCTGGCTATCGGTCTGTCAG
TCGATTATTCCGCTCATATCGGGCATGGTTTCATGGCTGCACGCGAAGGA
AACAGAGTGCGTCATTTCTGAAGAATTGATACGTAATTTGTTGTTGGCTG
GTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCAACGTCTGGGTC
TCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGCTTCTCGTATCAA
ATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGCAATGG
ACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAATGACTTCAGT
CCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAAGGTAAA
CCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTTACGAAAAC
ACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAACGGAAC
AAAAGATTGAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATT
GAAGATGTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCATGTATAA
CACACTGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGT
ATCAAACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACC
AACGATTGTTTTGATGTTGGTATGGGCTGGTTTATTAGCGGGAGGTGCAT
ACGGTCTTTCACAATTGAAACAAGATTTCGATCCTGAATGGTTTTTACCG
GAAGATTCGAACGCCAGGATTTACAGCTCCGTGGATGATAAGATGTACCT
TCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATTCTCTCTACGCCTG
GTCGGCTGGTGTTGACAATGCCTCATTCGTCGAAGCAACGCTAGCATCTT
GATTATTTTTCTTGGTCGTGGTGTTTGGTATGTTTCACGGTGTAGTGTAT
TTACCCATCGTGCTTAGCTTGGTCGGTCCCGAACCGTACGCATCTTCCGA
ACCTTCAACTCCATCAGCCTCCACCACAAGCGCTGGTAAACCTCCATTAC
CAAACAATGGTGTCGAAATGACTGATGACAAAGAACCCGAAACTAAGACA
GAACGAGCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACACGG
AGGTTTCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATCCT
ATGTTTTCTCCACTTTCTTCAAGATCAACATTGCGGGTTACATGCATTTC
TGGGGATTGACGGTTGATACGGTGACCACTATCCAGTTGATTCTGGCTAT
CGGTCTGTCAGTCGATTATTCCGCTCATATCGGGCATGGTTTCATGGCTG
CACGCGAAGGAAACAGAGTGCGTCATTTCTGAAGAATTGATACGTAATTT
GTTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCA
ACGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGCT
TCTCGTATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGT
CAAGGCAATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTA
ATGACTTCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACA
AATAAGGTAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAG
TTTACGAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAA
CATAACGGAACAAAAGATTGAGTATTTCTCGAATGATGGTATCCAAGCCT
ATGCGTACATTGAAGATGTTGACTATTTTGCAGACCAGGACAAGTTAGTG
AGCATGTATAACACACTGGAGAATAACCAGTACACTGTTAAGGGAGAAAC
TCAGAGTTGGTATCAAACCTATATCGCATGGATGGCAGCCAATCACGCCG
CTGATTTGACCAACGATTGTTTTGATGTTGGTATGGGCTGGTTTATTAGC
GGGAGGTGCATACGGTCTTTCACAATTGAAACAAGATTTCGATCCTGAAT
GGTTTTTACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTGGATGAT
AAGATGTACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATTCT
CTCTACGCCTGGTCGGCTGGTGTTGACAATGCCTCATTCGTCGAAGCAAC
GCTAGCATCTTGATTATTTTTCTTGGTCGTGGTGTTTGGTATGTTTCACG
GTGTAGTGTATTTACCCATCGTGCTTAGCTTGGTCGGTCCCGAACCGTAC
GCATCTTCCGAACCTTCAACTCCATCAGCCTCCACCACAAGCGCTGGTAA
ACCTCCATTACCAAACAATGGTGTCGAAATGACTGATGACAAAGAACCCG
AAACTAAGACAGAACGAGCTGCGCATGCGCTAGAAGAGATTGGACCAGCA
GTGGTACACGGAGGTTTCAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGC
ATCACAATCCTATGTTTTCTCCACTTTCTTCAAGATCAACATTGCGGGTT
ACATGCATTTCTGGGGATTGACGGTTGATACGGTGACCACTATCCAGTTG
ATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCTCATATCGGGCATGG
TTTCATGGCTGCACGCGAAGGAAACAGAGTGCGTCATTTCTGAAGAATTG
ATACGTAATTTGTTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTT
CTTGATCGCCAACGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCT
TCACTCTGGCTTCTCGTATCAAATACAAACATATCAAATTGGAAGGCGCT
TCGGTTGAAGTCAAGGCAATGGACAGTGTGCAAGATGAGCTTGCCAAAAT
CACATTCACTAATGACTTCAGTCCTTTCGGTTACACAAGGTTCTACGTTG
GCTGGGAAACAAATAAGGTAAACCAAGTACGAAAGATATATTTTACAATC
GATTAGATGAGTTTACGAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAG
ATCAAAGGAAACATAACGGAACAAAAGATTGAGTATTTCTCGAATGATGG
TATCCAAGCCTATGCGTACATTGAAGATGTTGACTATTTTGCAGACCAGG
ACAAGTTAGTGAGCATGTATAACACACTGGAGAATAACCAGTACACTGTT
AAGGGAGAAACTCAGAGTTGGTATCAAACCTATATCGCATGGATGGCAGC
CAATCACGCCGCTGATTTGACCAACGATTGTTTTGATGTTGGTATGGGCT
GGTTTATTAGCGGGAGGTGCATACGGTCTTTCACAATTGAAACAAGATTT
CGATCCTGAATGGTTTTTACCGGAAGATTCGAACGCCAGGATTTACAGCT
CCGTGGATGATAAGATGTACCTTCAAGAGTTCATGAGAGGAACTTATTCA
AAAGCAATTCTCTCTACGCCTGGTCGGCTGGTGTTGACAATGCCTCATTC
GTCGAAGCAACGCTAGCATCTTGATTATTTTTCTTGGTCGTGGTGTTTGG
TATGTTTCACGGTGTAGTGTATTTACCCATCGTGCTTAGCTTGGTCGGTC
CCGAACCGTACGCATCTTCCGAACCTTCAACTCCATCAGCCTCCACCACA
AGCGCTGGTAAACCTCCATTACCAAACAATGGTGTCGAAATGACTGATGA
CAAAGAACCCGAAACTAAGACAGAACGAGCTGCGCATGCGCTAGAAGAGA
TTGGACCAGCAGTGGTACACGGAGGTTTCAGTACCTTCTTAGCTTTCGTC
TGTCTTGGTGCATCACAATCCTATGTTTTCTCCACTTTCTTCAAGATCAA
CATTGCGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGTGACCA
CTATCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCTCAT
ATCGGGCATGGTTTCATGGCTGCACGCGAAGGAAACAGAGTGCGTCATTT
CTGAAGAATTGATACGTAATTTGTTGTTGGCTGGTGTTATTGTGTTCTTG
GTGACATTGTTCTTGATCGCCAACGTCTGGGTCTCCTTACTCGTCCTCAC
ATGTGTTGTCTTCACTCTGGCTTCTCGTATCAAATACAAACATATCAAAT
TGGAAGGCGCTTCGGTTGAAGTCAAGGCAATGGACAGTGTGCAAGATGAG
CTTGCCAAAATCACATTCACTAATGACTTCAGTCCTTTCGGTTACACAAG
GTTCTACGTTGGCTGGGAAACAAATAAGGTAAACCAAGTACGAAAGATAT
ATTTTACAATCGATTAGATGAGTTTACGAAAACACAAGTTGGGAAAGTTT
TCGAGAAGGAGATCAAAGGAAACATAACGGAACAAAAGATTGAGTATTTC
TCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGATGTTGACTATTT
TGCAGACCAGGACAAGTTAGTGAGCATGTATAACACACTGGAGAATAACC
AGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAAACCTATATCGCA
TGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGATTGTTTTGATGT
TGGTATGGGCTGGTTTATTAGCGGGAGGTGCATACGGTCTTTCACAATTG
AAACAAGATTTCGATCCTGAATGGTTTTTACCGGAAGATTCGAACGCCAG
GATTTACAGCTCCGTGGATGATAAGATGTACCTTCAAGAGTTCATGAGAG
GAACTTATTCAAAAGCAATTCTCTCTACGCCTGGTCGGCTGGTGTTGACA
ATGCCTCATTCGTCGAAGCAACGCTAGCATCTTGATTATTTTTCTTGGTC
GTGGTGTTTGGTATGTTTCACGGTGTAGTGTATTTACCCATCGTGCTTAG
CTTGGTCGGTCCCGAACCGTACGCATCTTCCGAACCTTCAACTCCATCAG
CCTCCACCACAAGCGCTGGTAAACCTCCATTACCAAACAATGGTGTCGAA
ATGACTGATGACAAAGAACCCGAAACTAAGACAGAACGAGCTGCGCATGC
GCTAGAAGAGATTGGACCAGCAGTGGTACACGGAGGTTTCAGTACCTTCT
TAGCTTTCGTCTGTCTTGGTGCATCACAATCCTATGTTTTCTCCACTTTC
TTCAAGATCAACATTGCGGGTTACATGCATTTCTGGGGATTGACGGTTGA
TACGGTGACCACTATCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATT
ATTCCGCTCATATCGGGCATGGTTTCATGGCTGCACGCGAAGGAAACAGA
GTGCGTCATTTCTGAAGAATTGATACGTAATTTGTTGTTGGCTGGTGTTA
TTGTGTTCTTGGTGACATTGTTCTTGATCGCCAACGTCTGGGTCTCCTTA
CTCGTCCTCACATGTGTTGTCTTCACTCTGGCTTCTCGTATCAAATACAA
ACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGCAATGGACAGTG
TGCAAGATGAGCTTGCCAAAATCACATTCACTAATGACTTCAGTCCTTTC
GGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAAGGTAAACCAAGT
ACGAAAGATATATTTTACAATCGATTAGATGAGTTTACGAAAACACAAGT
TGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAACGGAACAAAAGA
TTGAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGAT
GTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCATGTATAACACACT
GGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAAA
CCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGAT
TGTTTTGATGTTGGTATGGGCTGGTTTATTAGCGGGAGGTGCATACGGTC
TTTCACAATTGAAACAAGATTTCGATCCTGAATGGTTTTTACCGGAAGAT
TCGAACGCCAGGATTTACAGCTCCGTGGATGATAAGATGTACCTTCAAGA
GTTCATGAGAGGAACTTATTCAAAAGCAATTCTCTCTACGCCTGGTCGGC
TGGTGTTGACAATGCCTCATTCGTCGAAGCAACGCTAGCATCTTGATTAT
TTTTCTTGGTCGTGGTGTTTGGTATGTTTCACGGTGTAGTGTATTTACCC
ATCGTGCTTAGCTTGGTCGGTCCCGAACCGTACGCATCTTCCGAACCTTC
AACTCCATCAGCCTCCACCACAAGCGCTGGTAAACCTCCATTACCAAACA
ATGGTGTCGAAATGACTGATGACAAAGAACCCGAAACTAAGACAGAACGA
GCTGCGCATGCGCTAGAAGAGATTGGACCAGCAGTGGTACACGGAGGTTT
CAGTACCTTCTTAGCTTTCGTCTGTCTTGGTGCATCACAATCCTATGTTT
TCTCCACTTTCTTCAAGATCAACATTGCGGGTTACATGCATTTCTGGGGA
TTGACGGTTGATACGGTGACCACTATCCAGTTGATTCTGGCTATCGGTCT
GTCAGTCGATTATTCCGCTCATATCGGGCATGGTTTCATGGCTGCACGCG
AAGGAAACAGAGTGCGTCATTTCTGAAGAATTGATACGTAATTTGTTGTT
GGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCAACGTCT
GGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGCTTCTCGT
ATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGC
AATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAATGACT
TCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAAG
GTAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTTACG
AAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAAC
GGAACAAAAGATTGAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGT
ACATTGAAGATGTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCATG
TATAACACACTGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAG
TTGGTATCAAACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATT
TGACCAACGATTGTTTTGATGTTGGTATGGGCTGGTTTATTAGCGGGAGG
TGCATACGGTCTTTCACAATTGAAACAAGATTTCGATCCTGAATGGTTTT
TACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTGGATGATAAGATG
TACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATTCTCTCTAC
GCCTGGTCGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045553XLOC_045553Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073403-proteinTCONS_00073403-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073403-exon-scaffold_91-1575043694:339489..339741TCONS_00073403-exon-scaffold_91-1575043694:339489..339741Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:338641..338813TCONS_00073403-exon-scaffold_91-1575043694:338641..338813Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:337749..337890TCONS_00073403-exon-scaffold_91-1575043694:337749..337890Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:336018..336155TCONS_00073403-exon-scaffold_91-1575043694:336018..336155Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:335141..335333TCONS_00073403-exon-scaffold_91-1575043694:335141..335333Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:334371..334486TCONS_00073403-exon-scaffold_91-1575043694:334371..334486Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:333093..333251TCONS_00073403-exon-scaffold_91-1575043694:333093..333251Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:329896..330021TCONS_00073403-exon-scaffold_91-1575043694:329896..330021Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:326952..327099TCONS_00073403-exon-scaffold_91-1575043694:326952..327099Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:325417..325538TCONS_00073403-exon-scaffold_91-1575043694:325417..325538Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:324403..324601TCONS_00073403-exon-scaffold_91-1575043694:324403..324601Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1575043694:309920..311874TCONS_00073403-exon-scaffold_91-1575043694:309920..311874Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:339489..339741TCONS_00073403-exon-scaffold_91-1510915933:339489..339741Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:338641..338813TCONS_00073403-exon-scaffold_91-1510915933:338641..338813Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:337749..337890TCONS_00073403-exon-scaffold_91-1510915933:337749..337890Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:336018..336155TCONS_00073403-exon-scaffold_91-1510915933:336018..336155Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:335141..335333TCONS_00073403-exon-scaffold_91-1510915933:335141..335333Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:334371..334486TCONS_00073403-exon-scaffold_91-1510915933:334371..334486Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:333093..333251TCONS_00073403-exon-scaffold_91-1510915933:333093..333251Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:329896..330021TCONS_00073403-exon-scaffold_91-1510915933:329896..330021Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:326952..327099TCONS_00073403-exon-scaffold_91-1510915933:326952..327099Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:325417..325538TCONS_00073403-exon-scaffold_91-1510915933:325417..325538Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:324403..324601TCONS_00073403-exon-scaffold_91-1510915933:324403..324601Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1510915933:309920..311874TCONS_00073403-exon-scaffold_91-1510915933:309920..311874Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:339489..339741TCONS_00073403-exon-scaffold_91-1491911889:339489..339741Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:338641..338813TCONS_00073403-exon-scaffold_91-1491911889:338641..338813Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:337749..337890TCONS_00073403-exon-scaffold_91-1491911889:337749..337890Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:336018..336155TCONS_00073403-exon-scaffold_91-1491911889:336018..336155Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:335141..335333TCONS_00073403-exon-scaffold_91-1491911889:335141..335333Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:334371..334486TCONS_00073403-exon-scaffold_91-1491911889:334371..334486Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:333093..333251TCONS_00073403-exon-scaffold_91-1491911889:333093..333251Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:329896..330021TCONS_00073403-exon-scaffold_91-1491911889:329896..330021Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:326952..327099TCONS_00073403-exon-scaffold_91-1491911889:326952..327099Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:325417..325538TCONS_00073403-exon-scaffold_91-1491911889:325417..325538Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:324403..324601TCONS_00073403-exon-scaffold_91-1491911889:324403..324601Clytia hemisphaericaexon
TCONS_00073403-exon-scaffold_91-1491911889:309920..311874TCONS_00073403-exon-scaffold_91-1491911889:309920..311874Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:309920..339741 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.05006 0.843111 1.20045 1.33639 6.31716 4.69584 2.65485 5.68536 1.60546 1.53646 2.32806 2.1737 2.25646 2.63699 2.00873 2.14413 4.97534 4.87777 2.93835 3.29676 10.0715 9.88805 2.60799 3.13434 6.99168 5.93996 3.68682 2.17911 0.743123 0.457129
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003392Ptc/Disp
IPR000731SSD
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Blast
BLAST of TCONS_00073403 vs. Swiss-Prot (Human)
Match: NPC1 (Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 4.857e-33
Identity = 116/513 (22.61%), Postives = 232/513 (45.22%), Query Frame = 2
Query:  128 FFFQGIGVDDVFVIIQNWDNIGGPKNRDRSIAENVSLALRTAGVSILVTSITDVCAFLIGATTILPALRSFCIFAGIGVLAVFILTCTFYVAWLALDSRRQRDHRDACCCCASLPTDWQPLECSKRMYLQEFMRGTYSKAILSTPGRIVLMLVWXXXXXXXXXXXSQLKQDFDPEWFLPEDSNARIYSSVDDKYFSNDGIQAYAYIEDVDYFA-------------DQDKLVS-MYNTLENNQYTVKG-ETQSWYQTYIAWMAANHAA----DLTN---------------------GKPSTKDIFYNR-----LDEFTKTQVGKVFEKEIKGNIT-----EQKIEASRIKYKHIKLEGASVEVKAMDSVQDELAKITFT-----NDFSPFGYTRFYVGWETNKVISEELIRNLLLAGVIVFLVTLFLIA-NVWVSLLVLTCVVFTLINIAGYMHFWGLTVDTVTTIQLILAIGLSVDYSAHIGHGFMAAREGNRVQRAAHALEEIGPAVVHG 1498
            F    +GVD++F+++Q +      + +  ++ + +   L     S+ ++S ++  AF +GA +++PA+ +F +FAG+ V   F+L  T +V+ L LD +RQ  +R    CC     D   ++ S+   L  F + +YS  +L    R +++ ++ G+L+     L+++    D    +P+DS    Y     +Y        +   E  DY +             + D LV  ++N  + + YT  G    SW   Y  W+    +     ++T+                     GK   +   + R     L +    + GK         +        ++ A+     H  L+ ++  + A+   +   + +T T     + +  F Y+ FYV +E    I ++ I NL ++   +FLVT+ L+   +W ++++   +   L+N+ G M  WG++++ V+ + L+++ G+SV++ +HI   F  + +G+RV+RA  AL  +G +V  G
Sbjct:  692 FLVLAVGVDNIFILVQAYQR--DERLQGETLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQASESC-LFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILLGHGTRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTETMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEALAHMGSSVFSG 1201          
The following BLAST results are available for this feature:
BLAST of TCONS_00073403 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPC14.857e-3322.61Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE... [more]
back to top