Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073386 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073386
Unique NameTCONS_00073386
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1676

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073386 ID=TCONS_00073386|Name=TCONS_00073386|organism=Clytia hemisphaerica|type=transcript|length=1676bp
TTTTAAGTCACAAATGACTGAACAATCTTCTCTAGAAAAAATTGCAACTG
ATGCAATTAAGAAAGTTGATTCAAATTTCTCGTTGAAGAGAAAGCAGATG
GACTGCATCGATAATGTTGTTGCTGGTAAAGATACTCTTGCTATCCTTCC
TACCGCATATGGAAAAAGTATGATTTATCAGCTACTTCCTTCAATCTTCC
GGGCCCTTCCCAACAGTTCGAAGCATCCAATTGTTCTTGTGGTTTCGCCT
TTACAAAATCTGATACCGAATCAAATTGCTGAAGCTGAAGAACTTGGTTC
ATACCTCAACATCAAGGCATGCAGCCTTGACAAATGTTCAGACGTTGAAA
CACTTAAAATGAATGGGTACAACATCTTATTTGGAATTCCTGAAAAATGG
CTTTTGTCCTCAGTGAAAGATTTTCTCACCACTTCATTTCTTCGAAAGAA
CGTTGtttgtgttgttgttgatgaAGCCCATAAAATTTCGTGGGGTGTTC
CTGCTTCATCTTCTACAGAAAGCGTATTCAGAGAAGCCTTTTCTCGCATC
GGAGAGATTCGATCATTTTGTTCAGAGAAAGTTCCCGTTCTGGCCCTTAG
CGCAACAATTGAGATGGACTTCACTGAAATTTTGCGTGGTGCATGCAGTC
TGTCTAAATATGTAAAGTATATTCATTCTTCTCCTGATAGAAAGAATATT
AGACTATCAATCGTAGATGCTGGGAGCAAATCAATATCGTGCTTCAATTG
GCTGCTCAACATTATCAGtcaaaacagtgaaaacactccaAAAGTGTTGA
TATATTGTCGATCTCAGAAACTGGTTTCTTGGTTATTTGGGCAGTTTCTA
TCCAAACTTAGATTAGGAATCTACAAAAATCGGGAAAAGCATTATGATAA
TTTTCTTGTTGGCATGTTTCATGCAGACACATCACCACACAACAAAGAGA
AGTACCTTGCTTCGCTTACTTCTGTAGATGATACATTACCTCGTGTCATA
ATTGCAACAAGCACAATCGGGTGTGGTATCAATGCAAAAAGATTAAAGTA
TGTTTGTCATTTTGGGCCTGCTTTTTCACTGCCAGCAGATTGGGCGGGCA
GGACGGAATGATGAATCGGATTATCATGCCATATTATACCCAAATAAGAC
TCAGGGCAGCAGATGGCTCCATCTTAATACGAAAGAATGATTTTAAAACT
GTGTAGGCATATTTACTTCTTCCATAACACTTGAAATAAAGGACTGCAAC
TCGATAATGCTCAAACAGCCTTTCTCCATCCCCCTCTTTGATTGCATCAT
TTATTGACCTCAACAACAAATTGTAAGTAAACAATGCTTTCTGATAACTC
AATTTGTGATTGATAGTTTCCTTCTCTTCCTCCTCAGTAGGTTCGTTAGT
TGACTCCATAGCATTTCTAGAAATGAAGAAAttatttctatatatttttt
caaatattattgtATTTGAGTGATATTTTCTGCTAAACATTTTCTGTTAT
ATCAGATTCtattgtaactttttattttagcaCATTTTCGATAGAGCTTT
CAAAGATTATTTTATACTAAACTTTAGACAGGatatctattttttattac
cTGTCATATTGGTGCTTAGCAACTTCGTGGCTGTCTCGCCCGTTTTTTGT
CTTGTACggtttttttgttgtgtttt
Run BLAST on NCBI

protein sequence of TCONS_00073386-protein

>TCONS_00073386-protein ID=TCONS_00073386-protein|Name=TCONS_00073386-protein|organism=Clytia hemisphaerica|type=polypeptide|length=369bp
FKSQMTEQSSLEKIATDAIKKVDSNFSLKRKQMDCIDNVVAGKDTLAILP
TAYGKSMIYQLLPSIFRALPNSSKHPIVLVVSPLQNLIPNQIAEAEELGS
YLNIKACSLDKCSDVETLKMNGYNILFGIPEKWLLSSVKDFLTTSFLRKN
VVCVVVDEAHKISWGVPASSSTESVFREAFSRIGEIRSFCSEKVPVLALS
ATIEMDFTEILRGACSLSKYVKYIHSSPDRKNIRLSIVDAGSKSISCFNW
LLNIISQNSENTPKVLIYCRSQKLVSWLFGQFLSKLRLGIYKNREKHYDN
FLVGMFHADTSPHNKEKYLASLTSVDDTLPRVIIATSTIGCGINAKRLKY
VCHFGPAFSLPADWAGRTE
Run BLAST on NCBI

transcript from alignment at scaffold_91:82369..87649+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073386 ID=TCONS_00073386|Name=TCONS_00073386|organism=Clytia hemisphaerica|type=transcript|length=5281bp|location=Sequence derived from alignment at scaffold_91:82369..87649+ (Clytia hemisphaerica)
TTTTAAGTCACAAATGACTGAACAATCTTCTCTAGAAAAAATTGCAACTG ATGCAATTAAGAAAGTTGATTCAAATTTCTCGTTGAAGAGAAAGCAGATG GACTGCATCGATAATGTTGTTGCTGGTAAAGATACTCTTGCTATCCTTCC TACCGCATATGGAAAAAGTATGATTTATCAGCTACTTCCTTCAATCTTCC GGGCCCTTCCCAACAGTTCGAAGCATCCAATTGTTCTTGTGGTTTCGCCT TTACAAAATCTGATACCGAATCAAATTGCTGAAGCTGAAGAACTTGGTTC ATACCTCAACATCAAGGCATGCAGCCTTGACAAATGTTCAGACGTTGAAA CACTTAAAATGAATGGGTACAACATCTTATTTGGAATTCCTGAAAAATGG CTTTTGTCCTCAGTGAAAGATTTTCTCACCACTTCATTTCTTCGAAAGAA CGTTGtttgtgttgttgttgatgaAGCCCATAAAATTTCGTGgtaagtaa tttttatttctatgaAAATGCCTAAAGCAAGGCCTTTTTATTTGCTAGCA AATTGAAACAGAAAAATCTTTCATCCTGCATATATGTTCCatgtattttt taaatcaaaatttcaatttgtgACATTCCCAGGCTCAATCATGATATATC ATGATATATCTTAACAGAATCAATGCcaagaaaaaagcaaaacgaATTTC GACATTCGATTTTGCAACACTGTACACAACCCTTCCACACGATCTTCTCA TTGAATTCTGGGTTGTACAAAATTCTTCGCCTGTTATTGGACATCTTAAC AGAATCAATGCcaagaaaaaagcaaaacgaATTTCGACATTCGATTTTGC AACACTGTACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NATAAGCATGAGGCTCAAAAAATTCGTTTTGCTAAGCATAGAGGCTCACC AAAATTTACCCTTACTGCATTGAGAagttttttactctttttttcaGGGG TGTTCCTGCTTCATCTTCTACAGAAAGCGTATTCAGAGAAGCCTTTTCTC GCATCGGAGAGATTCGATCATTTTGTTCAGAGAAAGTTCCCGTTCTGGCC CTTAGCGCAACAATTGAGATGGACTTCACTGAAATTTTGCGTGGTGCATG CAGTCTGTCTAAATATGTAAAGTATATTCATTCTTCTCCTGATAGAAAGA ATATTAGACTATCAATCGTAGATGCTGGGAGCAAATCAATATCGTGCTTC AATTGGCTGCTCAACATTATCAGtcaaaacagtgaaaacactccaAAAGT GTTGATATATTGTCGATCTCAGAAACTGGTTTCTTGGTTATTTGGGCAGT TTCTATCCAAACTTAGATTAGGAATCTACAAAAATCGGGAAAAGCATTAT GATAATTTTCTTGTTGGCATGTTTCATGCAGACACATCACCACACAACAA AGAGAAGTACCTTGCTTCGCTTACTTCTGTAGATGATACATTACCTCGTG TCATAATTGCAACAAGCACAATCGGGTGTGGTATCAATGCAAAAAGATTA AAGTATGTTTGTCATTTTGGGCCTGCTTTTTCACTGCCAGCAGATTGGGC GGGCAGGACGGAATGATGAATCGGATTATCATGCCATATTATACCCAAAT AAGACTCAGGGCAGCAGATGGCTCCATCTTAATACGAAAGAATGATTTTA AAACTGTGTAGGCATATTTACTTCTTCCATAACACTTGAAATAAAGGACT GCAACTCGATAATGCTCAAACAGCCTTTCTCCATCCCCCTCTTTGATTGC ATCATTTATTGACCTCAACAACAAATTGTAAGTAAACAATGCTTTCTGAT AACTCAATTTGTGATTGATAGTTTCCTTCTCTTCCTCCTCAGTAGGTTCG TTAGTTGACTCCATAGCATTTCTAGAAATGAAGAAAttatttctatatat tttttcaaatattattgtATTTGAGTGATATTTTCTGCTAAACATTTTCT GTTATATCAGATTCtattgtaactttttattttagcaCATTTTCGATAGA GCTTTCAAAGATTATTTTATACTAAACTTTAGACAGGatatctatttttt attaccTGTCATATTGGTGCTTAGCAACTTCGTGGCTGTCTCGCCCGTTT TTTGTCTTGTACggtttttttgttgtgtttt

Coding sequence (CDS) from alignment at scaffold_91:82369..87649+

>TCONS_00073386 ID=TCONS_00073386|Name=TCONS_00073386|organism=Clytia hemisphaerica|type=CDS|length=2220bp|location=Sequence derived from alignment at scaffold_91:82369..87649+ (Clytia hemisphaerica)
TTTAAGTCACAAATGACTGAACAATCTTCTCTAGAAAAAATTGCAACTGA
TGCAATTAAGAAAGTTGATTCAAATTTCTCGTTGAAGAGAAAGCAGATGG
ACTGCATCGATAATGTTGTTGCTGGTAAAGATACTCTTGCTATCCTTCCT
ACCGCATATGGAAAAAGTATGATTTATCAGCTACTTCCTTCAATCTTCCG
GGCCCTTCCCAACAGTTCGAAGCATCCAATTGTTCTTGTGGTTTCGCCTT
TACAAAATCTGATACCGAATCAAATTGCTGAAGCTGAAGAACTTGGTTCA
TACCTCAACATCAAGGCATGCAGCCTTGACAAATGTTCAGACGTTGAAAC
ACTTAAAATGAATGGGTACAACATCTTATTTGGAATTCCTGAAAAATGGC
TTTTGTCCTCAGTGAAAGATTTTCTCACCACTTCATTTCTTCGAAAGAAC
GTTGtttgtgttgttgttgatgaAGCCCATAAAATTTCGTGGGGTGTTCC
TGCTTCATCTTCTACAGAAAGCGTATTCAGAGAAGCCTTTTCTCGCATCG
GAGAGATTCGATCATTTTGTTCAGAGAAAGTTCCCGTTCTGGCCCTTAGC
GCAACAATTGAGATGGACTTCACTGAAATTTTGCGTGGTGCATGCAGTCT
GTCTAAATATGTAAAGTATATTCATTCTTCTCCTGATAGAAAGAATATTA
GACTATCAATCGTAGATGCTGGGAGCAAATCAATATCGTGCTTCAATTGG
CTGCTCAACATTATCAGtcaaaacagtgaaaacactccaAAAGTGTTGAT
ATATTGTCGATCTCAGAAACTGGTTTCTTGGTTATTTGGGCAGTTTCTAT
CCAAACTTAGATTAGGAATCTACAAAAATCGGGAAAAGCATTATGATAAT
TTTCTTGTTGGCATGTTTCATGCAGACACATCACCACACAACAAAGAGAA
GTACCTTGCTTCGCTTACTTCTGTAGATGATACATTACCTCGTGTCATAA
TTGCAACAAGCACAATCGGGTGTGGTATCAATGCAAAAAGATTAAAGTAT
GTTTGTCATTTTGGGCCTGCTTTTTCACTGCCAGCAGATTGGGCGGGCAG
GACGGAATGATTTAAGTCACAAATGACTGAACAATCTTCTCTAGAAAAAA
TTGCAACTGATGCAATTAAGAAAGTTGATTCAAATTTCTCGTTGAAGAGA
AAGCAGATGGACTGCATCGATAATGTTGTTGCTGGTAAAGATACTCTTGC
TATCCTTCCTACCGCATATGGAAAAAGTATGATTTATCAGCTACTTCCTT
CAATCTTCCGGGCCCTTCCCAACAGTTCGAAGCATCCAATTGTTCTTGTG
GTTTCGCCTTTACAAAATCTGATACCGAATCAAATTGCTGAAGCTGAAGA
ACTTGGTTCATACCTCAACATCAAGGCATGCAGCCTTGACAAATGTTCAG
ACGTTGAAACACTTAAAATGAATGGGTACAACATCTTATTTGGAATTCCT
GAAAAATGGCTTTTGTCCTCAGTGAAAGATTTTCTCACCACTTCATTTCT
TCGAAAGAACGTTGtttgtgttgttgttgatgaAGCCCATAAAATTTCGT
GGGGTGTTCCTGCTTCATCTTCTACAGAAAGCGTATTCAGAGAAGCCTTT
TCTCGCATCGGAGAGATTCGATCATTTTGTTCAGAGAAAGTTCCCGTTCT
GGCCCTTAGCGCAACAATTGAGATGGACTTCACTGAAATTTTGCGTGGTG
CATGCAGTCTGTCTAAATATGTAAAGTATATTCATTCTTCTCCTGATAGA
AAGAATATTAGACTATCAATCGTAGATGCTGGGAGCAAATCAATATCGTG
CTTCAATTGGCTGCTCAACATTATCAGtcaaaacagtgaaaacactccaA
AAGTGTTGATATATTGTCGATCTCAGAAACTGGTTTCTTGGTTATTTGGG
CAGTTTCTATCCAAACTTAGATTAGGAATCTACAAAAATCGGGAAAAGCA
TTATGATAATTTTCTTGTTGGCATGTTTCATGCAGACACATCACCACACA
ACAAAGAGAAGTACCTTGCTTCGCTTACTTCTGTAGATGATACATTACCT
CGTGTCATAATTGCAACAAGCACAATCGGGTGTGGTATCAATGCAAAAAG
ATTAAAGTATGTTTGTCATTTTGGGCCTGCTTTTTCACTGCCAGCAGATT
GGGCGGGCAGGACGGAATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045539XLOC_045539Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073386-proteinTCONS_00073386-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073386-exon-scaffold_91-1491911889:82369..82860TCONS_00073386-exon-scaffold_91-1491911889:82369..82860Clytia hemisphaericaexon
TCONS_00073386-exon-scaffold_91-1510915933:82369..82860TCONS_00073386-exon-scaffold_91-1510915933:82369..82860Clytia hemisphaericaexon
TCONS_00073386-exon-scaffold_91-1575043694:82369..82860TCONS_00073386-exon-scaffold_91-1575043694:82369..82860Clytia hemisphaericaexon
TCONS_00073386-exon-scaffold_91-1491911889:86466..87649TCONS_00073386-exon-scaffold_91-1491911889:86466..87649Clytia hemisphaericaexon
TCONS_00073386-exon-scaffold_91-1510915933:86466..87649TCONS_00073386-exon-scaffold_91-1510915933:86466..87649Clytia hemisphaericaexon
TCONS_00073386-exon-scaffold_91-1575043694:86466..87649TCONS_00073386-exon-scaffold_91-1575043694:86466..87649Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:82369..87649 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0323985 0.143642 0.035709 1.24629 0.686547 1.464 1.93904 0.375465 0.697982 0.262652 0.428243 0.296317 0.333575 0.115737 0.22506 0 0.0978057 0.0355812 0.0323005 0 0 0 0 0 0.103316 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR001650Helicase_C
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005524 ATP binding
molecular_function GO:0003676 nucleic acid binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073386 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top