Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073362 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073362
Unique NameTCONS_00073362
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1547

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073362 ID=TCONS_00073362|Name=TCONS_00073362|organism=Clytia hemisphaerica|type=transcript|length=1547bp
ATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGAC
CGATGGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGAT
TGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAATGT
TTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCA
CCTCATTGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTG
ATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAAC
TGGGACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGAAGCACA
AGACCACTTTGAAGAAGtttatttgaagaaaaacattGGAAAAGTCACAT
TACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGGTCAG
TTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGC
CGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGG
AGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGT
GATGACGATGAACTAGAAACAGCTTTGAAGTTACAATTAGCTGACATGTA
TTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGATTGCTCGTGATT
ATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTCAAGGAGGAAACTG
AGCAAAGAAGACAGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATT
CGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCAGagaaa
gagaattaaaagcACGAATAAAAGAATTGACAAAGTATCGGAGATACGGC
ATCAAAAAGTTAACTGGTTGTCAAGAATATGAAGATTTGAAAACACAACG
GGAacggaaaaaagaaaacagaaagcGAATGCAAGTTATATCACCTCCTC
GTACAACGAAAACATCTGGTAAAAAAGAGTTTTCATCGGACGATTCGAGA
AAGAAAGATGATATAGACATAGCAACGAAAGAATTTGAAGAATTCAAAGA
GAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCgataaagaaaaac
atCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAA
TCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAA
GACGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAG
AGTTCTTCATACAATGTGGTTGGATAAGTGAATAAAGATAATCTTCGATA
TAAATTGTGTAGTGCTTTCTTTTCTTAAATCACTCGATTTTTTTATTCAT
GAAAATtcatatatttatatttttgtttaataatttgtaaatttttttat
ccaTATTATAGCCAAATACCTTATAACACTAAATCATTTGTTCGATATTC
CATTTGTGTACAGGAGACTCCCGGTTATATTCGAAGGTACCTTTCTC
Run BLAST on NCBI

protein sequence of TCONS_00073362-protein

>TCONS_00073362-protein ID=TCONS_00073362-protein|Name=TCONS_00073362-protein|organism=Clytia hemisphaerica|type=polypeptide|length=444bp
MSGTLTTKMAAGNSSATDGAKYHCNYCHADCSGLRVSCAECPDFDACIQC
FASGAEMGNHKRGHDYHLIDNGTFYLIVKGWTADEEMLLLDAIEQHGLGN
WDDISDHVGTKSPQEAQDHFEEVYLKKNIGKVTLPKSVSHIPDHASVEGQ
LSPTLLKPMESLDLPVAEQQELGYMMFRDDFEREYDNDAENLIKTLVCSR
DDDELETALKLQLADMYWRVLHERSRWKKIARDYGLITSKHRLIASRRKL
SKEDREFKDKIRPFAQFVQPQQWEELVNNRIRERELKARIKELTKYRRYG
IKKLTGCQEYEDLKTQRERKKENRKRMQVISPPRTTKTSGKKEFSSDDSR
KKDDIDIATKEFEEFKEKMSSDTSFQLLSDKEKHLCATVQLRCSRYMTLK
SYLLNEYASSRMKIPHKTKPPHYLTPSLRLALQEFFIQCGWISE
Run BLAST on NCBI

transcript from alignment at scaffold_90:196096..241834-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073362 ID=TCONS_00073362|Name=TCONS_00073362|organism=Clytia hemisphaerica|type=transcript|length=45739bp|location=Sequence derived from alignment at scaffold_90:196096..241834- (Clytia hemisphaerica)
ATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGAC CGATGGTGAGTATTTTTATTTACAGTTTTAATCATTTATTATATGCAAAA ATGGGTTTGGTTACCTACCTACCTACCACNCAGTTTTAATCATTTATTAT ATGGATTAATCATTTATTATATGGAAAAATGGGTTTGGTTACCTACCGGG ACAAGTTGAAAGTACTAGATATGGTCATGCGACCGTAGACCTGCAATCAT GATCGAAATATATTGAGAATTTGTATTTTAACTCCAGTTGAGTTTAGCTA AAAAAGGGAGTCCAAATTTTCAAACAAAATAAAAAATAAAACTAGGCTCA TCTGATAGCCCTAAGCACAAGAAGAAATAGCCTACAAAGATTATGTCATA CTCATGCAGTCTGCTTGCATGAGGTTAAAAATCTGTCAACCAGCATTTTT AGGGGTCACTCACATATCGATTCTTCCCACGACTAACGTCAAATTGACGC GATATGAAGGGGTGGGTGGGTTTGAGTCTTTGACGCTAAGAAATTTTATC AGAAAGTTTAGAAATTATCTCCATTATTTTTTAAATGTAAACTGCCTGAG CAAGCCGTAGCGAAATTAAAGATGGCTGACGAAACAACGATGAAAGTGAA GGAGAAAATTTTCATCGATTTTTGATAATTTTTCAACTTTGACGTTAAGA GGTGGGGGTGGGGGGTTTTCAAATTAGCGTCAATTTGACGTTAGTCGTGG GAAGAATCGATATGTGAGTGACCCCTTAGAAGAATTGCAATCACATATAG CTGTCAACAACAAAGAAAACAAATCAAAGGCCAGGCCCACAGGGCTCGAA ATAACGGTCGGACATCGGACATTGTCCGACCCAATTGCTGAAATGTCCGA CCCAAATCGATTCTAGTCGGACATCATGTCCGACCCNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTCAGAAGCTTGTATTATACTTGAAATATACCCCACATAAAAAT CAATCGGACATGTCCGACCCATTTTACTTTAAAAGCCTTAGGACATGTCC GACCCAGATCAATTTTTGATCGGACAATGTGTCCGACCACCTAAATATCG TTATTTCGAGCCCTGGGCCCAATTGATTGTTTTGTCCTAGAAGCTTTGAA AAATGGGTCGGTCGGTTGGTAGCTAAAATTGGAACCTTTTTTTCCTTTTC CCACCAAAAACCCCAATTTTTGAAATTCCTCAAGCAATCGCACATACCTG GAATACATTTCGCTAAATGCTCAGAGCGCGACGGCCCATTTTCCCTTTCC TATCTTTCACCTTACCTGTTTATTCTACTTTCTGAGACCTAGTATCTCAT TTCTGACTGAGTTTTCATACCTGTCAATCATTTGTCCATCAATTTCGTCC AGTCTAATTTTCGCACCGAGTGGGATTCGAACCACCACCAAAGAAATACC TTCAGATTCGGAAACCAGCGCTCTATCTGTTGAGCCATCGCTGCACAGCA AAATTACGCAATTCATAACATATTATACCGCTATACCGAACTGGCAAAAG ACTGGGGTAATGTTATTATAATATGGGTAAAAGTACCCCTTTTTTAAACC TGACTGAAATTTGAGCCGTTACTAGCAACCCTGCGGGGCCCAAGGCGCCA AGTATGCACCCGGCACAGTCATGGCTGGAACCCCCCTGGCCCCCCTCAGG CTAAAAGGTCGAGCAGCAATTGGTACCTGATTTTAGCCTATGGCTAGGGG GGACTAACCATGTTAAGGGTCACCTAAATTTTTTCAGATGGACCTGGGGG CAAGATTCTATGTTTGGTGATTGAATTATAAGCAGCCTACCAGACCAGGT TGACACTTACTCATCTTATATTTTAATCTAAGCAATATGCTCAAAAACTG ACAATTTGGTATCTAATATATTATCTGCAGTGCCGTAGCAACTGGGGGGG GGGCAAGGGGGGCTATGCCCCCAATAATTTTTTCANNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT TTCTTTTTTAATTTGTCATAATTGTCTTATAAGTGCATGTTTTGAGTGCA TTTTCAAGCAATCTAGAGCTCAAATTTTCAAAATTTTCTCCCTCGGGCCA AACCGTGGTTGGCCCTTGCGGTGTTACTTAACTTCCGCCCCCTAATATGA AAATGCTTCCTACAGTACAGCACTGATCTGTAAAAATTCTTTAATCCTGT TGCATTTGCTTACATAAAAAATTGGTCTGGCAAGGGATCTGCACCCTGAC TTACAAAACCTTGATAATCTGGCACAAACTTTCAGTACTTAGCTTATCTC TTATTTTTTAGGGCATTTATTCTATTTAGCAATAAGCTAAACCAACGATG TAAAAATAATAGATAACCAACTTGCCTTGATTCTCAAAAAACATCCGTGT TACGGTTGTAAAAATATTAATGACATTTTAGATTATAAAAAGTGCAATTA AATAAAAACTTGCTTCATTTGCAACCTTCTATTGGACAGAATCGATCACG TGATGTATATTTTTCCAAAATTTGGGTTAGAAAAAGTNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNATTCGTGAGATATCGCACTTCAAATCACAC ATATATTTTTCAGATAACAGCATTTTATGAGCGTTTATTTATCCAGACGA AGATTAAGTGGTATCAGGCCGATCCTTAGTCAATTTGTCTAAAGATTGTT TGAAAACAATTCCAAAATTTGCAGTAAATAACAATTCAAATTTTCTATCA ATTCAGTGGATGTCAAAAAGTGTGTCAAAATCTAGCTAAAAGCATAACAC GCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNTTTGGAACTTTGAATTTGTCTAATG AAAATATTTAACAATGGATGATGATAAACCAGGAAAGGTAAATAAAATTA AATTCTACTATTCCTATGATGGCCCGAGCAAATCCGTATCAATTGTAAAT ACATGGCCCGAACATGGTCCAAACAAAAATGTTCAGGCCGATTCAATAAT ACTTTTTTGTGGCCCGAGCATGGCCCGAACATGTTCGGGCCATGCCGTGA TTCGTTAAAATAGCCTAAAGCCCGGATCCATAAAGGCATGCGTCGCGATC GCAAGATAATTCTAGTTCGAGATTAGGGCGTTCACGGCGTTGCTTAAAGG AATACAGCTGTGACTCTCTGCTTTTAGGTGCCTCATATTTGTTTTTAAAT ATGGGTTACACCGGGACATTTTCTGTGTGCGAAGTGAATGTTGTTTATAG AAAAATCAAAGCACTCAGTTAAAAAAGAATCACAGAGAAAGTTGTTATCA TGTAAAAGGAGGTAAAATTGTTTTGATTTCGTGATTTTTCTGACTCAAAG TGAAACACTTTTTCTCAAAAATTTAGAGTCGATCGGAGGACACGAACCAA ACTATCAATTGGGCCTGGCCAAACTTCGCCTCACAAAAATGTGGGAGAGC TCCAAGTGGGAAAAATTTCCCCCGTTAATCCATTTTTTCCAAATCTCGTT GGATGCAGTATTTGCATCACAAAAATTGTCATTAAAAATGAAAAAATACG CCCTCAAAAAAATCGCGAAACTATTTCTTTAGAAATCTTTGAGAATTTTA ATGTTATAAAGTCTTGATTATTTTGAATGACTTTACAATGACAATAACTT AATATTATGAGAATGATTTAATCCAAGACTATGCTAGTAAAGCGAGCAAG AAAACTTTACAGATTTAGTTATCGAGGTCTTATATATATTTTTAGAGTTT CCTTGTGTTTCAGATAATTATTTGCTTTTCACGTTCACGCTAAAAATCTC GATTCACGAATTCAGGTGGAAAAATCTTATTTTCACGTTCACGCTGATAT CTCAATTCACGTATTCACGTGCTAAAAAAGTCAAATTCACGCATTCACGT CAGAAAAAAGGCTCATTCACGTGTCACGCCAGCCCCTGGAGCCTTTGTTA CTTTCTTCTTGTTTCTAAGATCACTTTTATCAACCCGCTTTCTTTGTAAC TTTTAAGGGTGTTTCGGTGTTTCTAAAATTGCTTTTGTCATCTTGCTTTC TTCGTAACCTTCTTTATTTCTAAGATCACTTTTATTAATTAAATTTATCA ATTCGCTTACTGCATAACTTTCAAGGGTGTCTCTTAGTTAACTTTTATTA ATTCACTTTCTTCGTAACTTTCAAGAGTGTTTCTAACATCACTTTTATCA ACTCGCTTTCTTCGTACCTTTCAAGAGTGTTTCTAAGATCACTTTTATCA ACTCGCTTTCTTCGTAACTTTCAATAGTGTTTCTAAGATCACTTTTATCG ACTCGCTTTCTACGTAACTTTCAAGAGTGTTTTTAAGATCACTTTTATCG GCTTGCTTACTTCATAACTTTCAAGGGTGTTTCAAAGTTTACTTTTATCG ACTCGCTTTCTTCATAACTTTCAAGAGTGTTTCTAAGATCCCGTTTATCG AATTGCTTACTTCATAACTTTCAAGAGTGTTTCAAAGTTAACTTTTGTCA ACTTCCTTTCTTCGTAATGTTCAAAAGTGTTTCTGAGATCACTTTTATCG GATTGCTTACTTCATAACTTACTGAACAAGCAGAAAAAAGATTTTTAGAA TAAATTTGTACACGTGCGATTGATCACACGCCTGGCTAGATTTTCATGAT TTATGGCGTGTGATAAATTCCACACCTAAAAGGCTTTTAGGCGTGTGCGG AGGCGTGCGCGTGCGTTCGCACGCCTCGTATGCCGAAGCCTACTAGACAA TCCTCAAGGGACAAACACATAAATATACAAACAATACGGCACTATACAAT ACAATACACAACTCCCTAGACACATAATATAGACAATACACGTGGAACTA ATACAAATCATATAGTAATCATTTACAGTTTCACTACAAAAGTCCTATCA AATAATAAATCTAAGTACAAAGGAAATAATAAAAATAAACGTAAAACTAA AAGACAACTGCATTTTGGCAGTTACACTAAAACTTTGTATGTTTATCAGA AAAAGGGTGAGGAATTCAAAAATCACATTCACTAATTCTAGTTCTTTCAT TTTCATGTAGCTTTTTTCACTTTTTTGCTTCTTTAGCATGGGAATGTCCC AAAAAAAGTTTTTATTTATTTCTGTCGAATTGGATTTTCTTTTCATTTGG GGTTTCTCCTTTCAGAAAAACTTATTCTTTACTTATAACTTTTGTTCCTT CATTTCCAGAGGCTCCTTGAAAATGGGTCCTACCACTTTTTTTGACTCAT TTCAACCTTTTCCAAGCTGTTCCAAGCTAAAAAAGCTACAAAAGCTACAA AAATAAAACAATGCAATGCAGGGCTCGAAATAACAATATTTAGGTGGTCG CACTACTAGGTCTTAAAACATCAATTGTGGACACGGTTGATGTTTTTTAT CTACAGTCAATCATTTTTATGGACAGTCAATATCCAAACATCGACTGTCA ATATCCAAACATCGACTGTCAATACTTTTCATCAACTGTTGAGATTATTT AATTGACTGCTGATGTCTGGATATTGACTGTTGATATCTGGATATTGACA GTTGATGAAAAGTATTGACAGTCGATGTTTGGATATTGACTGTCCATAAA GAATGATTGACTGTCCATAAAAATGATTGACTGTGGATAAAAAACATCAA CCGTGTCCACAATTGATGTTTTCAGGCCTGGTAGTGTCGGACACATTGTC CGATCAAAAATTGATTTGGGTCGGACATGTCCTAAGGCTTTTAAAGTAAA ATGGGTCGGACATGTCCGATTGATTTTTATGTATGNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTCTATTAACAATTATGAGTAATCTTTACTTGAATGAAAATACAC CTGACAGACTGCACTTACTTCCAAATCTATATACTTCAAGTCTAATACAA GCTTCTTATAGAATTTCACATAGATCACGAAGAATCTAAACAAATGCCAA TTAATGGTCAGAAGCCTTTGATTTTTACTTGAAGCATGCTTTCATTTGTT GAGAAAAAGCATCACACAAAATGAATATCTAACACTAATGATCGCAACTT TGAGAGTGTGTGTAAATAAAGAAGTTACTAATTCTATGTAAATTATAATT TCTTTTGGAAATTTCACAACGCATCTGACAAATTTTCGAAGGCACCGGAA GTAATTGGGTCGGACATGATGTCCGACTAGAATCGATTTGGGTTGGACAT TTAAGCCATTGGGTCGGACAATGTCCGATGTCCGACCGTTATTTCGAGCC CTGGCAATGTCTTCTTTTTTCAACTAAATTACAAATATTTTTATATGATT ATATTCTAACACCATCAAAGAATTCTCCCTCCAAATTTCAGGTCTCTAGC TACACTAAAAAAAGAGATATGCAAAATTAAAGAAGCATGACTGGAAAATT TTTTTTTTCTTTTTAGACACATTTTTCGAATTATTACAAGCTATTTTCCT AACCCTTTTTTTGACACTTTTAGTCAAATTTTCGACACTAAAATTTGAAT ATCTTTACAACCACTTATCAACTGGAGGCCTATGACTCCTCATTTTCTTT CCTTTTCAAAGCTCTACAAGATAGAATAGGTTTTGAATTAGAAATTTCAA GGTTTTGAAATAGAATTTGGAAAATCTTCTGGAGTTGCTACACCAGTATC AAAAGAAAGCTTATTCTTTTGTATGTCTTCTCCAAAAAAAATTGGCACGA AAAAACAATCACTTCAAGCGCGACGACCGTTTGAAGGCAAACTGTTGGAA CTTCATTCTTTTTTTATTGTATTCTCTATTGTATTCTCTGATAAATTTTC TACAGATTGAAAAAAAGAATGAACCAGTTTGAGTGGATTATGGTAAAGAT ATGAAGAAAGGAAAATAAGAAATATATTTTTTTATTTTCATGCACGCAAA AGATCGTGACTTCTGAGGTCAGTCGAAATTTCAGACTCATTTGCAAAATG TCAAACCAAGTTTAATGACAGCCCTTATCCTCAGAAAAAAATGAGGGGTC ACTTATCTTTCAACTTTTAGTAGTTTTTCAGATATTCCATTCTGAAGTTC CTTTTTTTTTTTATTTCTATACAAAAACCTCCCGCCATCTTGTAACATCC CCACAGCACCAAAATTCAAGAGTGTTTTTTCGTAGCCATAGACGGGGTAC AATACCATTAACTTTCCCTTAGCGGAAAGAAAGAACATTTATATCTTTTT GAAATATTAAAGTTGGTTTTAAAAAAATTGTAAATTTAGAGGAAAAAGGT TGCTCTAGTCAGGCAACATGGTACGCTTCGAAAGCTAAAATATCACGGGG GAAAATGCAAAAAAATCAGGCCAATATCTGTATCTGGTGCCAAACACTTT TGATTTTAGTGTCCCCTGGTAAAAACTTTCCCATGCTGTGAACAAGAAGT TTGAAAAAGCGCACCCGCGAGTACTCATTTTCAAATTTTGAAAGAACGAA AAGACATATCTTGATAATTTCTTTTGCAAAAGAACGCTGAATTGAAGTTG GAAAAAACACTTATGCTAAAAAAAGTTTCCTTACTGGAGTTATGTAAGTT GGAAGATTTTTTCAAAAATTCTGTTTTTGTTACTGCCGCAGGCACAAGCT TAAACTTCCTTATCTAAGACCTATTGCCCGATTTTCACACCTCTTCCCAT TGTTACTTTATTCTCGCATATAGCTCAAAAGAAGCATTTAAACGAGATGG TTACGGAAAGTGCTGGGTCAAAATTTAGATTAAGCTAATTTCAAGATATT GAAAAAACACGTCATAGGTAAGATTCAAGTTGGACGTATTGAAAAGCGGT GATAACTTCAAATATATTTAATGCAATCAACACCAAATTTTGACTGGAGG CATTGATTATTAATTCTGAAATATTTCATGAAAACATTTTTGAATTTTTT AATGACATCATCCAATGGTTGGCGTATTTAAATTATTAGATATTACCGAC AATAAAATGGTGTCAACCAAAATTTAAGAAAATACCATTTTTGACACAAT ACATTGACAGACAANGCAATAAAATGGTGTCATCCAAAATTTAAGAAAAT ACCATTTTTGACACAATACATTGACAGACAATCCCTGTGAGAAATTTATA TCAAAATCTGCAACAAAAACAAAAGTGGTCTATCTCTTCTAGTTATTGCT TCCGGGTGCTCCTTCATGGACTGTTTATGAAATTTCCAACAACGAGATTC CTCATTTCATACGGCCCTTCTTTTTTTGGCAACCGTGGTCATTCAGTGCT TTGCATGACTGGCAGCTGTAAAATGTCACTTTATAAAATGCCTCTTTAAT ATGTTTAAAGTCTGTGATCCTTTAGAGGTAGGCTTTTTCTCATCTTCAAT TCTCTAAGTAGCAGTGGGCTATAGAGACCTTTTTTTTCAAAATTAAGTTT GCATAATTTTATTTGGTAGGTTGGGACCCAAATAACATAAATCTAAGATA TTTTTGGATATTTCCAAAAAATGGCGGTTCTCCGCCCTTTTTTATGCCCA AAAATGCAAAATGGGCCATTTTCGGGCCATTTTGCTTGGAAAAAAAATCT AAAACCTGCTGTGTTGGTGCTACAACCATCAAATTAGGCTCAAAATGATC CTTGGAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNTATATCCGCCATTATGGAATTGAAATAT GTGTTAAAACTGGCTAAAATACAACGTTTCAAGCAAAAGCCCCGTTTTTG AATAAAAATTGCTCTAAAATGGCAATAGACATGGACCAAATTTTTTTGAA GTGATAGTATTCTGTGAATATTCCTGGAAAAACAAAATCATTTCAGTCTG AGATTTGTTTACATCCACCCTTATGGAAATGAAATCTCTGTTAAAATGCT ACATATTTCCATCTGATACATCATAATTGACTAAATATTTTGTATATTAT ATTAAGCGAGGAATGTGAATTTAAAATCCTTTAATTTAGAAATACTAGTT GAAATATATTATTTAAAAAATCCCATTTCACTCAACAATTCTTTATAGCC CACTTACATTTCAATTTTCAAGACTTGTTTCGTCAAAAAAGATTGAATTT TAGCTTGAAATATTATATGCATTTTAAAACTGGCTTCAGTTTACAAATTG CGGTCCCAGAAGCATGTTATACCTGAATAGTTTTTACCCCTAGAGTATTA CAGAACACTATCACTGCAAAAAGATTTTAGGTTCATGTCTATTGCCATAT TAGAGCAGTTTTTAAGTCAATATGGGATTTTTGCTTGAAATGTTGCAATN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGGGA AAAAGTAGGAATCGAATGTAGCAATTACATACCTCTACCACATATATAAA ATTCAAAAATTAGCTATTTAGGCCGAAATGGACCGAAACCAGGAAGCGAC ACTTGTTTTTGCCTGGAAATAAAACCTAAAATCTGGCGCTGTTCGTGCTA CAAACCTCAAATTAGGCTTAAAATGTTCCTTGGAAAAAAGCAGGATAAGA ATGTAGCAATTATGTACCTCTAACCATGTATATATATAAAATTTAAAAAA TTAGGTTTTCAGGTCAAAATGGACGGAAACCGGGAACCGTCAATTTTGGC CGAAAAACCTAATTTTTTAAGTTGAGGTATATAATTGTTACATTCTAATC CTACTTTTTTCCAAGGATCGGTTTGAGCCTAATTTGATGGTTGTAGCACC AACACAGCAGGTTTTAGATTTTTTTTCCAAGGAAAATAGCACGAAAATGG CCCATTTTGGGCATAAAAAAGGGCGGAGAACTGCAATTTTTTGGAAATAT TCAAAAATATCTTAGATTTATGTTATTTGAGTCCCAACCTACCAAAAAAA ATTATGCAAACTGAATTTTGAAAAAAAATGTCTCTATAGCCCACTGCTAC CTAAGCTGAAGAAATTGGGAATTTGATGCAGAAGTTAGATTGTCAGTGCT GCAAAAAATCCTCTAATTGAAGAAGAATTTACAGTCATATATATTTTCAT TTTTGAAGATTAGGTGCTAAAAAGTGAAACATGGAATAGTTTCATTTTTT ATTGTTTTGTTTTTTTGTGCAAACTCTCCCTTCTTAGATGAGAAGGATGT CAACATTATTAGACGAACTTAGGTATACAGGGCTGCAAATAAATATGTTT GGCCACTCGGACATTATGTCTGACTAAAATCAAATCCAGTCGGTCAGACT CAAAATCCTCTCAGTCATTCAGTCGTCATAATTTTTCAATTAGCAGGATA TATTTTCTAACCTCAATAAGAGGACAGTTTTTGAAAGTTAGATAGAAAGC TAATATGTAGATAAGAGTGACCTTGGAACAACTCGTACATATACAGTAAT TAGAGAAAGTGGTAAGTTGATAAAAGTGAAATTAGAAACACTCTTAAAAA CTACAAAGAAGGCGATTTGATAAAAGTGATCTTTGAAAAACTTTTAAAAG TTACAAAGAAAGTGATTTGATAAAATGATCTTTGAAAGACTCCTAAAAAA GTAACAAAGAAGGCGATTGGATAAAGGTGAACTTAGAAACACTTTTAAAA GTTATGAAGAAAGTAATTCGATAAAAGTAAGAAAGAAAGAAAGAAAGAAA GCGATTTGATAAAAGTTGAACCTAAAAACACACTTAAAAGTTAGGAAGAG GCAATTTAAAAAAGAATAGAGCAATAGAGTTTAAGAAACAGGGATGTACA GGAAATTTTCTCTCAAATCAAAATAATGGTTTTATTCATTTTTTCATTCG GACATCATGACCGACACAAAAGATTTTCAGTCGGTCAAATGGCCTTTTCA GTCGGACATTGACCAATGACCGACACTTATTTACAGCCCTGGGGTACGTG GTGTTTCAACAAAAAGTGCTATCAATTAAATCTCTTCAAAGAGGAAATGC TTATATTTTGAGCTAAAGCATAGAATTTGCTTCACCCCTTCAAAAATTAT AACAAGAATAGGAAGAAAAAAAATTGTTAAAAATGAAGGCTGGTATTTTA ATGCTCAAACTTATCATCAGCAACATCTAAAGACTCAAGTAACTTTTGAA TGATATGATCATCAAAGTCTANATCATTCTAACTTTTCTTTGTAATTTTT ACAAACGTCTCGTGACCAATTTCATTGAAAAAGCCTTATCATTTTTAGCA GTACAATTTATCGATAGAATTTTTTAACAATAAAACTTTATAGAGGAAAG ACTNGAAGTAACTTTTGAATGATATGATCATCAAAGTCTATGAAAGAAAG AAGAAATTTTATTTACAACACAACAGTTAAAACTTTTAAGTGACTAAAAA AAATCAGTGTAAATGAAACGATTGTACAAGAGTCATAATTCAAGGAAGAT CTCCCTTATCTAAGAAGACCCCCCCCCTTAGGTAAGAAGACCCCCCCCCT TAGGTAAGAAGAACCCCCCCCCCCCTTCACTGACAACTCCCCCTTAGCAG GGACCGAATTAGCGTATTGCATTTCGCAATTCGCGATGCGTTTTTGGATT ACTTACAAACTAAAAATTGAAAATTGATCCATTTTAGGATGCAAAATCAT GCTTATCAAAAAGTTGCGATGCACTTGGTTGCATGAGTTACGATAACCAA GTTTTTAACACCCCTGTTTCTTAGCCACAACTTTTGTTTTGCCGATCCGT TTGTAACATTTTGCTTCTCTAAAGCATTGTTTTTTTGTTCATAAATTTAC CTACAGTTTCTAATGCACACTTTTATCAACTTGTTTTTCTTTGTAAGTTT TAACAATAAAAGTCAACAAATGTCAACTTGCTTTTTTTATAAAATTAAAT TTTCACGAGCGTCTCTTATGCATACTTTTATCAAATCGCTTTCTTTGTAA TTAAATTTCCACGAGCGTCTCTCAAATGCTTAGTTTGATCAATTTGCTTT CATTCTAACTTTTCTTTGTAATTTTTACAAACGTCTTGTGACCAATTTCA TTGAAAAAGCCTTATCATTTTTAGCAGTACAATTTATCGATAGAATTTTT TAACAATAAAACTTTATAGAGGAAAGACTTTCCAACGATAGATTTCATTG AACTTGCTTATCAATACAAGCCAGCCTATCGATGAAGAATCTACAAATCA ATAAAATCGATCGTGGTAAGATAAGTGGTAAATATTAACTAGTTTTTCTC ACTGTTTTTAATGAATTTTGTCATTTTGGATAGGTCAAAATTTTCAGTTT TTTCAACTTCTGATTGAATGAACCGATTTTAAAGTTTTACATACCAAAAT AAAAGTTAGCCTTTCCTAATAGAATAATAGAATAAAAAAAGAATTAGCAA AAAACCTTTAACCTTAAGATCGCAATAACTTTACAAAACTGAATACTTTT TTTGGTGCACCTGGTAGTTTTTTCTATTAAATAACATCATTTTCATCACA TTTTTTGCCACCCTAAGTAAAAACTTTACAAATACAATATTTTTTAAATC AAATATATTTTACCAAATCACTTGTCTTCATCAAGTATCCAAAACTGTCC AAAAGGCAATTATTTAAAAGACTCATAAATTATTTACAAATAAGTCATTT TCTCCTAAATTATGTGGAGAAATCGTTTAATTCTTTTGCATATATCATCT TCTTTAAAGATAAAGTACTTGTGGTACCCATATTAGATGTGCATACTTCT TATTTGAAGTTGCAATAAACTTTACAAAAAGTCACTTGTTTCGTTGATTT CCAAGTACTAGACTTGCACTTTGTTTTGTCATGCATGAAGAAATTTGTTG TCGAACAACTGTCACATTATTCTCTTTACGATCCAACAAATTTATGATAC GCTGTGTGTTCATGATCAGCAAAATTGAGAGGTGGGAAAGAACCAATGTG AAATTTAAAACATAGGTTTGGAGATGTTTGTCTTGGCGTTGAACATTGAA CAAAGTTATGAAAACAATTTGAATGACAATATTTGTGTACATGGCATAGA TGATGTATCTTGTACTTTTGAATGATTCTGGTAACCTCCTTGAACGGACT CCTTGTACAGTGCAAATGATTGATAGGAACATTGTGTAGATCAATTGGAT GTGTAATTGATTTCCAACATTGCAGTAATGGAATTTGGTCAATAGCTCAT GGTCATAAAGAATCATTGTTCTTGAATCATTTTGCATCATAGAGACCATT GTTACCAAAAAAGATACTGATGTGATTGCAGTGACGATCATAACAAGCAC TGTTGTTTGTTTACGTTTTTCTCCCATTGAAATACGTGTGTTTGATTCGA AAATCCAAATGACCGTCTGCGTTTTTACCAATATAATACTAAATAAGAGA ATAGTTGATGGACCTACTACCAATCCCACTATCCAACACGATACATTAGT TGGGGTGATACTTCCTAATATTATCAAAATAAATACATTACAATGTAGAA GAAGTTGACCAAGTGTCAGTTTTAATTGTGAGGACTTTGCAACAGGGGTA TTCCTGTGGCAAACATAACATGTGAAGTATGAGAAAGAAGTTAAGATGCC AACCAATAATGAAATGAAAAGCATAATTCCTTCAATTGTATCAAAGTTAA CAGGTTTGAAGTTCTTGTATGGGCTATAACAGCCAGTATGTAGAGCATTT GCTTTCGTGTATTGAGGACATTTTTTGCAATTGAAATCTCCATATGCATC CTTGTAAAAACCTTCTTCACATTGTCTGAGAAACCAGCTTACTTGATGAT CCCATCGAGTTTTGTTTGATGGTACCGTGCCACATGCCTGATAAAAACCA GGGGGTATATTACTCTGGTTTCTGCATACTATTTTAGGAGGTTTTTTTAG GTTTCCAGGCCATATGACGCTACCATATAACCAGGATAAACCATCCAAAA GTGTCTTTCCTTCTTGGTATAGGTTTTTCATGTTGGTTACTGCAAACATT TTAAGATTGACTAGAAATCGAGTATTTAGGTAGCCTGCAATGTTATTTAT AGTGAACCATTTATAAGCTTTAAGTAGTTCAAGCTCATATACCCGATTTA AAAGTAGCTGAAGGTTTCGTATACAGCATATTTTAAAGTGATGTCTTCAT ACTTTTGGAGCCTTTGGAGAGCTGAGGTCTTACTTTCATTTTTTTGAGAA TCCCAAGTAGGATGATATCCAATTTTCAAAACCGGTTTTGTCAAATAGCT ATGGTTATAATCTCTTGGAATGTCTTTAATATCATTAGTTAGACCAAAAT TACTGATATAGAACAAACCTTTAGCTAAATTCCTTGGTATTGACCAGCTC TTTGAATCTGAATCTAAAAACAGAACACGGTTATAAACACCATTTTGATC AAGCGCCTTGAGAAATTGAAGTGTATCCTTTTTATTTCCCATTGCATAAA TTGCTTTCAAATCTGTTCGATTTTGAAGCAATCTGATTGTTTTGTCAAGT TTTGTTTTTGTCGCAACGTTGTCCATCCTGTAAATACAGGTAGATTTTGA TTGTTGGAGAGCTTCGTAAAATAGTTGTGTCCTTTTTTGATAGATTTTGC TTTGTGATAGAGTTAAGATAACAATGGATTTCCATTCTGAATAATCAAAG AAGACTTTGGTTTTGTATGCTATTTGATGCTCCGTCCCTACTTGATGGAT CCTTTCTAAGTTTCTCAAATCTCCCCACGGTTCTTCCTGGAATCTAGTTT TGTTGTCTTTGGTATTTAAGATAACAAAGGGCGTTTTACTTCTTGGCACT TGAAATATTTTCTTTGCAAGCCATGTTAAATGTTCAGTCATGAAGCTGTA TATGACTAAGTATTTTGGTACCTCTTGTTCTGTCGACGAGGCTTCTCTTT GAAATAACTCCTCTCTTAAATACAGATCTAAGAATGCTGAAACCAATAAA TTTTGACTTGCACACACATCAATAGAAATCGTTTCAGCAGTTACATTATA ACGTTTGAGAAATAACTGATTGTAATATGCACTTGTTCTTTCAAATGCTA AGAAAGTTTGGTAAGCTCTGTTGTAAAACTTCTGATCCTGTAAATCATTT GGGTTGGTTGAATTTCGAGTTTCTTCTGATGAGCATGTTGAAAACAAGCC AATGATGTAATAGTCTGGTTCTGGTGTGGTAGTGCTGTTCGCAAAACAGC AACAAATCATTGTTAACAAAATGTTGTATTTGAACCATGGCCCCAATGAC ATCGTACCAATCATTTTATTATATTTTCCAAAACAAAACCAAGCCTTTTC AGAACTGGATACAAAGGGAAAAAGATTTAGCTTCTTTGATCTGGTTTGAT TGTAGTTTATTAGATCAATCCATAAACTCAAAGTCCAAATGTTTTAAAAG TTGAACTGAACGTGTCTTACTTCAGTTCGTTTGACTTGATCGAAGAAAGG ATGATAATCTTGGCGAGTTTTATATCTGTAGGTTATCCATTTAACAACTT TTCATCTGCTTCTGTTCTCAATTTCCCCAGCTGCTTCATTTTATACCTCC TCCTTATGGATGTGAGAATTAGCAAGCTTTTCGATGTTATTTATCGCCTC TTTTATTTAAACTTTATTCTTCTTTTGACTGGGAGTAATAATTAATGTTT ACAATAAAAAGGAAGTCATAATCTGAGTATCCAGGAACTAAACGAGTTCT GTAAATACACTGGTACATATTGCTTTAATTATAAGAATATGAAAAAATAT CTGGTTTGATTTTTTCCAAATTTACTTTCTGATAACTATTTCCATTTGAT CACCGTATTTAAACTGTAATGTGTATTATAAATATTTGTGCAAGTTATCA TGTAGGTTGATTGATGATTTGCTGCTAGAATGAAGGCTAGGAACTGCTTG GAAAGATTTTATGATTCATGGTTTCTTATAGAAATTAAAGAAAGTCAAAT GTTTATAACGGTCTATTAAAGATTCATCCATATGAGTTTCTTGGAAATTA CTAACACCAATACTACAAACAAAAGTTTTTCATTACAACAAAAAACAATT TCAATCTTTATAAAGTTTTAAAAATTTGGGCTTTTTTATATATCTGAGCA AAAATTCTCGAGGAACAATTTCAAATCCACTGAAAAATTAAAAGGAAATT CCCAAAGGGAATGTTATCATTCACCGAAATTTCGAAAAAAAGACCAGAAA ATTGTTTTCGATCACCATGTCCCACATACTGTCAATGTTCCTCTCCTCCT GACTCCTCAGGATATTGAAAAGATTCAACAGAGCGCTTGATAATGATTCT ACTTTTTAAATAAAGACGAAAATGTTGTGAGTGAAATATTGAGAATTAAA AATACTTTATATGTTATGCTTCTGATAATTAGGTCGAAAATCGATCAGAA AATGAAGATAGAATGAGTTTAAATCTTGATAGAGATCTCTCATAATAGTG CTAATGTAATGTATTTTTGGCAGGTCTAAAATCTTTTTCATTTTTTTTAC AGGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGA GGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAGTACGA TTTCTTTTATTTTCATTTGTTTTCTCAATCTTTCATTTCTTTTCCCCTTT ACTATCAATAAAGAAGCTTTAAACCCCTGGTCTGTAAAATTTAGATTATC TGACCCGACCGAATATCCGTATATAGTCTGAGGTTTTCAAGTAAGTATGC CAAGCAAGGCTGCATTCATTCAAGGAAAATTTTGGAAGTTCTAATCTTGA ACTTAAAGAAGTGCACCTTGATGAATTTCGGTCTTGATAAGGTGTCCACG GCCTTCAGAAAATGATGCTCAAATATGCAAAATATCGATGAAATTGAACT GAATAGCTAAATTCTTCACTTGCATATTTATAATAGGGAAAAATGCAAAT ATATCTTATATAAAATACTTGATAGAGGCATCCTGTCTTTCTTAAGCCAT TGCCGTTGATCCAGGTTGATCAATGATGCTTCAGCCAGGGACAGGGTAGC GCTATCAAGTGTATTCATATGAGACTTATTACACGTGAGTAGCTATTAGT AGTAGTTATTAGTAGCTAAATTCCACACTTGGATACTTTAAAATGAGAAA AATTCTTTTCTTTCTAATGCGGCTTTTTTTATTTTTTCAACAGTGTTTCG CATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTC ATTGTAAGTTTGTTAAGACATTACCAGTTTCGTAATACACTCTATGCGCA TAGTCTGTTTGATAAAAAAAATTTATCTTTCATTTTTCGGAATTTTGACA ACGATTGAGGCTGTTTCTTAATTTACTTAATGATTGTCACCTGTGTGTTA AACCTGCTCGATAGTTTGATCTGAATCAAAAGAAAAAGCAAAGGCTCACG AATGCCTTCTTTCGAAGTCAATTCAATTATTGTTCGCTTGTCTGGATGTT TCATGTTCGCAGGCTAGATCAAAAAATAAATCACCTCCACGAAAGATGTT TGAGGATAGTGTATTCTGATCATACATCTACTTTTGAGCATCTTTTAGAG AAAGACGGTGCCATCAAAATCCACCATAAAAATCTTCAGTTGTTAGCAAT AGAACTTTTCAAATGTAAAAATAACATATCAGATCTAACTAAAGAAATTT TCAAAGATGATGAAAATATCAAAGTAAATCGCAAACATAGTGTGCAGACG GGTCTGAACCCCCCCCATTAATATTTCATCCCCCCTATAAAGGTATCCCC CCTATTTTTAAAATCTTTTGATCCCGCACCATTTACAGGGGTCCGAGCCC CCAGCATATAATTTGTACTCCCAGTATTGGGGAAGAATTTTGATGAATGA AATATATTTTTCAGTGTGAATTCGTACCAATAGTCAATGAACTTGAAAAC ACTAGCAAATAAACAGTAAAACTAATAATTTTTTAACCAAAAAGTTACTA TCCCCCCCCCCATTTTTATTTGATCCCCCCTATAAGCTCAAACCCCCCAT TTTAACTGGGAAATTGCCCATCCCCCACTATAAAGCCTTCCTTGAAAACT CGGATCCCCCCCTTAAAAAAGGGGGGGTTCATACTATGGCAAAACGCCTT TGCTTTAGATCAAGAGAAATAAACTCTGTTTTTCACGGTTCAGAGTCACT TTCATTTTTAGGGCCAAAAGTTTGGGAATTAATTCCGGATAAGTATAGAG ATATAGTCGATCTTAGTATTTTTAAGGAAAAGATTAAGCAATGTAGGCCT ACATCATGCCCGTGTAAAAACTGCCGGACCTATATTGACGGTGTCGGCTT TTTGTAATCACCTTACAAATTTTAAAGTAGCGTTGACTTTTATTAGCCTT TGTTGCTACCTGTTCGTCAACTTGAAATAAACTATTACATACATACATAC ATCTTGTGTGTAATTTATAGATACCACAGATAGTGTACCGGGTGCGCCAA AAAATATACAGTTTTGTGAAATTGTGTACCATTAAAGGCTTTTCGTTGAT TCTTTTTTTATTCTATAGAGGCAATAACCAAATTTATTTCTGGTTCATGA TATGTTTTGATTCATTCAAAAAAAATGGCATTACGAAACAACGTTGAAAC GAATTTACTTCGGATAAGTTACTACGCGTCGTAATTTTTTAAAATTCCAA TTTTTCTTTAAATCGTCTATCAAATTTATAAAAGGCGATTAAATTAAATN GTAATTTTTTAAAATCCCAATTTTTCTTTAAATCGTCTATCAAATTTATA AAAGGCGATTAAATTAAATGAATTTGATTGTTTGATTAGGAATATCACAC TCAAACACTAGACAGCTGATTGTTCTACCTATCAGATAACTTTGTTTTCC TTTATCATTATTTTATAAGAACTCTTAAAAAATTAGCGAAACCTTTGCCT ACTCTTTGGCTTCAAATCTTTAAAATGTAACATATTTAGTGCAGTTTTTA GAAAAAACTATTTCAAAAAAATCTGGGCGATATATGTTGATCCTATAACA AGTAGTATATGGACAAAGGTCTAATTTGGCTTCGAGACCCTTACAAAGTC AATTTTCGACTTTCTAAGGGTCTTTGGGAACCTACCGGCCCTCAAATGTT CTTTAAAAATTTCCTCCAATTTTGCTAGCTGGATTATGATGATGATTTCG GAGCCGGATTTTAAACATTCTTTTTTTGAGATATTTAGGATTTTCTCTTT TCTATATTGTATTTTAAAATATATCTCATTTGTCCAAAATCGTAGAAATT TTGTGATGCATACATAATTTTTTCTTAAACTAAAGGATGCTCTCATTTCA AACGACTGGAATTATTGTTTGAAGAGCAAAATTTTGGCGATTTTGGCTTT GTGACCAATATGAACCATCCATACCTTATTCTGCTGAAAATTCTGTTGTT TCAGGCTCACAATCATGCTTACTTTATTGGAACTAGTTTTCGCGGGAACT AATATTCCTAGGGATTTTTCAATTTTTTTGATAAAATTGGAAAAAATAGT ATTTTGCGGGTTCAAATTTTCACGGTTTTGTCAAAAAAACGCGAAAAATG CTAAAATTAATTCCCGCGAAAATTAGTTCCATTGAGGTTAATTATTTTTT TAAATGTTATAATCTTTGGCGATTCTAAGCCACCGTTATTCTTCTAAAAT TGTTTAACATTGATAAAAAAAAGATGAAGTAATATCCCCCTCGCCCTCCT TTCTTGAGCTTTACTGCAGTGTAGTTCGAAAGTTCTAGTTGATCATTGAG CAGAGACAAAGATTTAATTGCCACGCCTTGAAAATGTGTCCATGGTGTAA AAAAGAGTGTCTTGTCTTCACAACGAGATGTTAAAAAAAATGAAAAAGAT TGTGTTCCCTAGAGGACTTCTATTATTTTCCCAATCAGCTGATTCTCGCA TGTTGTCCCTTGTGAGGGCACCATTAAAAGAAAAACGAGGTTTAAAATCT CACTAAAACTTAGCAAAAGGATGTTAAAAATCCTTGAATACCACACAGTC TCCAGTCTGACTTACCAGACTTTTTACACAAAATTCTTAAAAATCAATAT TAACCCTACAAATATATACCTCTGTTTTTTTGTTGGGTTAATTCATTGAT TATAGTCACGCTTCAGGCTCGAGCTTTATTGAATTAGAATATTTTAATTC AATTTTTGAGTAATTTTTAAAGCTTTAATCAATGACTTTAATAAAATAAT TTGTTTAAAACATTTTTTCGAATTTAAATTTGATATTGAATGGAATTATA AACTCGCAAATAAGTGTTAATAGCACATTCGATAATATTTAAACACTGAA AAATGTTATATGAATTCGCGAAGGCCTGAATCAATACAGCCAGTCTTTCA ACGAGGAATATAGAAGAATCGAAAAACCACCCATAAATTGCCTTCAAAGA AAACTAGCACCCTCAGGCACTCTTCCAACACTTTTTATAAGAACCAAAGA GTTATTATAGAGAGTTTGCAGCATTTTATTTTTTAGTATTTTAAGCCTCA AACTGTTCTTATCCTGTTCTTATTTCAGGGCAAACTATAGATAGTTCCAG ATAGTTTAGTTCTTGTGTGTTTTCCTACTTAAATTCTTCTTCCTTAAACT TCAAAAATAACAGGCTTATGACCGTTCTTAAATTATTCTTATAATATGTG GCATTGTACAGTCTATTGTTCTTATGAAATTGTTCTTATAGAAATAGAGA GTGTCCAATTGAAATTTTAAGTCAAATTTGATCGTAATTTAATTTCTTCG TATTATTATTGCATGTCTTTTTACGGCCAATGTTTACTATTTGAACAGTG TTTTGATAATAACATTAAGAGGCTTTAATGGAATCAAGTCAAAGTGTGCC GGCTACTATCACTTGCTATATACAAAGTCTTGCTATGTTAGTACAGGCAA CCAAATTAAAGGGAATTAACATTTAATATCCATTTTATAAAAGAATTGAT ATAAATTATATAAAAGAAGTACCTTAACAAAGAGCTTTTTTCTATTGTGT TGGTTAGTTCTTGCGCGTGCGATGTTTCCATTTATATTGTATTATATTAT TGTCGTATACTATTTAAACGATTCTGGTGGCATCATTCCTTAATCATTTT CATTCCAAACGTCGAAATGGAATCACCTACAAGATCAATCACGCCCTCTT GTACGCCACCGCCATCTCTAGCGACGTTGAAGCGCCCTGACAGTTGTTAC TCAAGTGGTGGCGAGACGCCACCTTCAACTGATAGACATTGCAGTCCAAC TTTCTTCACAACAGATGACCAAGACGTCACTTTGGTTTGTGAAAATCTGA TAAATGCTGCTAAATTTGATCGCCTTGAACGTTTCATATGGGCTGTTCCA GCTACTGAGAAATCCCGTAATGCGGAAATTATATTGATCGCTAAAAGTTA TTTAGCGTTTCGTAGTGGACAGTTCGAATTGCTGTACGAGCTTCTACAAA GACGACCTTTCGCCAAAAAGTATCACCGGCAACTGCAATATCTATGGCGG ACCGCCCGCTACATTGAAGCCGAACGTGCACGAGGACGCGCGCTCGGTAG CGTGGGAAAGTATCGGATTCGCAGGAAATTCCCGTTACCTTACACCATCT GGGACGGAGAATGCATGTCTTATTGTTTCCGTGAAGAAGCTCGTGAAATT TTGAACGCCATGTATAAAAGAACGCCTTATCCGACCGCCCAAGAGAAATA TAGCATCGCTCAACGTGCTAACCTGAGTGTAATGCAAGTCAGCAACTGGT TCAAGAATAAACGACAGCGTGCTCGAGCAAAGAAAGCTGAAGCTAAAGAC AGGTAATTGACGGATATATTCTGACTTTGATACTTTTAAAATCTTTGCGT TAAGGTGGTCGAACATTTCTGATTAATTTTTATTTCACAGAACTGCCTTC CCTATGTCTTGGTAACTATTTTAAAAAACTTTTTGTATCAAAAATTATAA TNTAATTTTTATTTCACAGAACTGCCTTCCCTATGTCTTGGTAACTATTT TAAAAAACTTTTTGTATCCAAAATTATAATCTGTGTATTTTTATTATATT TAGTACCGAAACCAGCATCAATGAAGATGCCAGTATCACCAGAACCAAAT TAGATGACAATTATCATCATCATCCTCACACTATCAAAATGGAAGATAAC CTTCCTTCTCCTACGATCCCCAAAAGATGTTCTTCTCCACAACAACTTTT AAAACCGATGATAAAAATGGAGTATCAGAAACCAACATCATCGTTCAAAC CTATTCCTCATTTACCAGCAATGACGCAGGACCTGCTTCACCATTCAAAA TCACCAAAGCGAAGACTATTCATGACTCCGACACCGTATCATCCATATCT AGCCTCACTTCATCATCTCCCACGTACAGAATACAGGCTAATGCCACCAG CATTGACGTCATCATATTATAAACTTAGTCGTGGTCACATCCAACCTTAC GTTGTTGTGCCAAGAAAACGAATTTTAGTCGATAGACCTCGTTTGGTACC AGACTTCTATAGAACACCTCTGGATTATCGGCATCATGCGATTTCTGATC GACATTGTGAACAATGCAACAAAGACCTACATTAAATTATGATGGATTTT TGAAAGCATGTCGTTTAAAACGATCCTTGTCATATTTATTAAAATATAAT TTATTTCCATTTTTAGGACTTTAGGTTTTGTTGTTCTTGTGAGAGTTTTT AAAATAATATTATTCTAGATATATCCTTGAAACATAATTTATTTGTAAAA TACAATATTAAAAATGAAACTTAAACTAAATTGAAAATTGTCATTATTAT TGTACGTGTCATAATCAATTGTAAAGTCTCCTTCTTCGTATGGAATTGTT GGTATAAAGAGACGGACTTACACTTTAAATCAGACGTCGTACCCCCTCCC TCCGCTCGTCCCGTACCCTCACTAAATATGTTACCGCCCATGTCTTAAAA ATCGGGAATTTTAGGGCTTTTTCATGGCTAATTTAGTTTTCCCCGTCATC AGGGTGTACTCTTAAGGGCGGCGTTTACCCGTACCCTCCATTTTCATAGG TACCCCCGGTAAGACTCGGTAACTAAATATGGGTCTTGGATTGAGAGGGA CTTATTCAAAATAAAAATGTGAAACGTAATTTCAATAGATTAGACACAGT CAGAATAAAGAAAACGCCAGTATGTATTGGTCAAGTACACTCTTTTTTTT ATAAGAACAATAAGGCTAAAAAAAATTGACAAAACTAAGAACTGGAACTA CTACTGAGTTTCAAGAATTTTAATGGTCGATGTATCAAAAAATATGTATG AATCCTATGATACCTCCATTTTTGCCTTAATTATAAGAGAGCAATTTGAG ACTGAAGGTGCCATTAATAAAACTTTTTTTCAATAAGAACAAACTGTATA AGAACATAAGGCTTAAAGAGGAATATGAAAAGAAGCATATGGCTAAAATG TTAATAAGTTAAGAATATTTTAAGGCTTTCCGACCCGATTCCTTAAAATA ATGGACAAAAATGCTCAAAAAATGGCGAAAGTAAGTATGTTAAGAATATT TTTAGGCTTAAAACTCAAAAAGCTAAGAACATCCCAAGGCTTCAAAAATT TTGGATGTTCTTATAAAACAAAACGTGTAGAAAAACCGAGCCGTAACAAA AATTTACGTGTTCTTATGAAAAAGCGTTGTAAGCGCTTAAAAGCAATATT TGATCTTCACGTTTCAGCGTGAATTGATCTTAATTTGACTCGTGTCCAAA AAGCAGTGTTTATTCAGTGGTTCGTTATACGATTACACGTTTTTTTTTTA TAAGGAACACGTTTATAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATA AGTAATTGTTAAGGAACTGCTCAGGCTGAGAATAAGTGGATTTGAAAATA ATGTACCTTATTGGGACTAATTTGACCAAAATTTGGTCTTTCAAGGGGCA AAAAGTTCAAAATTTCCTATGTAGTAAGGAACTCGATAAGGAACTTTGAG ACTGAAATTCTCTGTAAAAATAAGGAACTCCAGGCTCAGAGCCAAGTTAA GGTTCCTTATAAAAAAAAAACGTGTAATGAAAAAATACCTTATTTATAAG ATGGTCAATGGTAATTTGATATTTTATCTTGTTAGATATAGCAAAATAGT TATCAATCAATATTGTTTCATCTGTATTTACTGTATTCCTTTAACATTTA ACTTTTACCTATTTTGCTAACCTGAGAACAGATCATAATCCTTTTCTGCC TACTGCGCTGAAACTCTAAAGGGATAGGTGAAATCAAATGGTCTTAACTC TTCAAACCTGATTAACGTGTGGCCTAAACATAGAATGTTTTTTTGAAAGA GTATAAAGATACCAAAGCCGTTGTCTAACTAACTATCAAGTTTTGTAGAA TAACTTTATGAAAACCAGTCAGGCTAAAAACTCCAAGGGTTAACAAACAC AGGTCTTTTGCAAGAATTTACTCTATAAGAATGTACATAATGATGAAATT GTCTAAAACATTTAGAATATGCGAATAATATCAGCGTCATATATCTATAT CTGACAACAACACCTAAACCTTTTTCCTGTAAATTAACAATAATCCCCAA GTAATGTTCAAGACTTTAATAAAAATGTTAAATATTGCTGGTTGGGTTTG AATCCTATTCAAGGAATACATTTAAGAAAATTTTATGATGATATTTCTCA AAAAGTTAAGAATGTTCACGATGAAAAAACAATGACAAAATCTGGAGAAA CTTCTCTCAATTTTGAGCTTTTGCCTAGGTGGATTGTAAAATTGTCATAC ATTTTTGTTCATCGGAATGTTTTGTGTTTTTCATTCGAAATGGTGGCTAT TGAAATGGCTACCTCGTCAACTGCTTCTAGTCTACTTCACTAGATTCAGC GTCACCAAAAATTACCAAAAAAGCAAAGCTCATCAAGAAGTCCACTCTCT AGTCTATTCTATCGGATAGGTCACTTTTTGAGTACCTAAAACACTTCCTT TACCCTCGGGTACACGTTTTTTATAAGAATAAACTATTTAAGAACATAAT TGACCTTGATGACCAAAATTTTAAGAACAAGTTAAGAACAACATTTTAAG AGTTAATTGACATGGAAATTGCACAAAAGTACTCACAAAAATTATGAAAT TTAAACAGAATATGTTGAGAACATTTTTAGGCTTAAAACTTAAAAAGTTA AGAATATCCGCAGGGTTCAAAAATTTTGGATGGTCCTTATAAAAAAAGCA AGTGTAATTGTGAAGTCGTTTCGTTATTTTCACATTTTTGGTGATTCCAT TTCGTTATAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAG CTGATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGA AACTGGTAATTATCAATTTGAATAATTGTGGTTCCTTATGTTTTAACTTT ATTGGTCCAAATCATCCTGTCGAGTTCGTGTATCTATGTTTTTCTGTGAC ACAGACGGTTAGCTTATCATTCTCTAGATCCTGGTTTACTGAGGATGACT TTTACCGCTCTCGATTTCGCGGGTCAGAACTGCTGGCTTTCCTCAAAAGT GCAAATACATAAGCTCGCTATAGGCCATTTCACAGTCAAAATGAATCATG GGTAATAAGGACTGGTTACGCTCTAGTAACGACTTCCTGTTGGCTAAACG CAAAAATCTTCAAAAAGTTTCATCAAAACTTAATTTGGACCAATAGAAAG TCGTTATTAGCGCGCAGTTGTCTTGATTTCCCATTACGATTTGCGACTGT GAAATAGCCTTGAAAGTTTCGAGCACATCCTGTGTTTGTCATACAGTATC ACTTTTCCATATTTCTGATTTTCTGGAAGAATTACAAGCTCCATTTTGAA TTTAGAAAAAAAAATTTTAGATCATAAATATTTTTTGATCAATATTTTGA TAACAGGGACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGTA CTTAAATTCATTTGCCACATTATTAGTAACACATTGTAATTTATGGCCAA TAAGGCAAGACAAATTCAATTAGTTCTTGGATGAATTTACACTTTTTGAA CTTGTTCAATTAGAAATACTTTAGACGTGCAAATTTTCGCGAGCAGAAAC TTTCACGATTTTCGCGAATTTTGGCCTTTCTCGCGAAAGTAGATGAAATT TCTATGAAAATTCTTAACAGGGCAATTCGCGAAAGTTTATACTCGCAAAA AATTCTCAAAAAAAATTGGAAATCTATAAAACCTCGAAATCGTTATAACA AATATCAAATTTTCGGCATTATTTTAGAAAAAACAGGGTCGGTCGGGCCC GTTAATAAACAATAAATTAATTTGATCTCGCCTAATTGAAAAATATTTAA AGGGGTATAAAATTGTATTTAGATTTAACATTGAATTTATGAGCTTTTGA TTACAAAAAATATCTTTTTCAGAAGCACAAGACCACTTTGAAGAAGTTTA TTTGAAGAAAAACATTGGAAAAGGTATTTCAATTTGATTTTCAGTTTTCT TCATTCCGCTAGCTTTCCATAAGTGTTAAACATCAAAGAAAGAAAATTTA ATTTTTTTCTACACCCATCCTTGTATCGATATACGTAAGTCATAGTTTCT ATTTTTAGTAAAAGAAAACGGTCAAATTCCGACTTTTTTCGGGTGTTCCC CCTAGAAAATAACTTTCGCTAGAATAACTGGTGATAGTAACTTAAGATAG AATAGAAACCATTATGGAAAAGAATACAGTGCTAAAATTTATTCAATCTC AGATGGATTTTTGTTTCAGTGAAGTATATGAAAAGGTTTTTTTTCTTCTC AAAATTCGACATAATGCACCAAAAGTATATGATTGGCTAATTTGCTATAT ATAAAATCCATTATCCGTCCCAGACGGAAAACCTTGCTTTGACCACTGAA AGAAAAATGAAAAGAAAGAAAAAAGGAAACAAAAAATGATATTTCATTCT TTTCTTACAGTCACATTACCGAAATCAGTATCACATATTCCTGATCATGC TTCAGTTGAAGGTGAGTCCCACTAATGAATTGAAAAGAACATTCAGAACG TTCCCAGCTGTAATCTCCGAGCAGCTCCTGATACTCCGCGCATAGCACGT ATTCGCTCTCCGTGAGAGAATCTGCCCTAGGTTGGCGCTCGAGTAGAGCG TGGGATGCGCAGAATGGACGATCTGTTATGAGATTATCCCAGCTGGTACA TAACGTTGTTTTAACGTTTGTTTAACGTTCGTTTAACGTTGATTGGACGC CAGATAAATGTTTTACAAGCTTCTATACAACTAAAGAAACACTGTCGAAA AATTCTTTCTAAATGATGCTGGAATAACTTTTTCATGATGTGCACCATTG CAATGTCTTCTAACATTACATCACGGACCCAATAGTTGATTGGTTGTAAA TGACGTATTGATTGATTTTATGTCGCTTACAACCAATCATCTGTTTGGTC CGTGATGTAATGTTAGAAGACATTGCAATGGTGCATATCATGAATAGGAA ACTTATTCTCGTGAATTCGGCGAATGATTTTATGGAATAAAAATCTTTGT TTTAAAGGCTAATTTTAAGGTTCAAAAAGAACCAATTTAGATTGCCATTC GCCGAAATCAGTTCTCGCGAGGATTAAATATTTTAGGAATTTTGCTGCTT GCGAAAGGTATTTCTCGTCGAAATTGGGTAAACTAATTTAAAGGTGTATA AAATTATTCATTTTACATGAAATCAGACTATAAAAGCAGCAAAGTTTGGA CCATTGAAGACCAAATTAAGTATTTTGAATGATAAACCAAGTTTTAACGC ACTTTAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGA TTTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATG ATTTTGAACGGGTATGTTTCAATTTGGTTTTTCTATTCATTTATTCAAGC TAGGGAATCTTACTGGATTATTTGCGCTTATATATTAGGTTCAAACTAGT CTGAATCGCAGACCTCTATAAAACCCCATGTAGTATATATAGTCATGTCA CCAGTGCACGAACGGCCCCAGTGCACGAACGAGCGTCTTTGAACTTGAAA AAAAACAACCAAAAACAAACTTCTATAGAACTTTATTTGTGCAGCAGAAT CCTCAAACTATCCCTTGCAATCTCTCCAAAAATTAAAATAAACGGAGCAC TAGAACAACACCAAACCGATTTTGAACGACGCCAAGTAAAAAAATCACGA AATTCGGGATTTTTGTAAACATGGCTGATCGCGAGAGAAAATGTTTTTTA TAAGAAAATTTGCGCAAGAAGAGTTCTGAAAATGACTTTCCTCTNTAAAA ACCTTTTATCTTCCATCACACAAAATTTCATTGAAACATGTTAGCTCATT AATTCAAAATTAATAGAAACATATCACCAGTAGTTGATATAAAAAAGGTT CCAGTTCGCGAACGATCCAAACACCATATTCAAAATGAAGACATTGCAAC GTCAAAACATTCGAAAGCGCTGGCGATCTCAATTAAAAAAGAACAAAATA AGGCAAAATAGAACAGATTTACGCTGTCATTCGCCAAAATTAGTTCCCAC CAAAATTAAAAAAAATCCCTATTCGCCAAAATAAGTTCGCGCCAAAATTA GTTCCCTTAAGGTACATTGCCGCGCTTTTCGATGAGCAAAACTTGAAAAA GAGAACAAAAAAATGGACGACAAGAAAATATTTACAAAAGTAAACAGGTT AGTAAAACGCTAAAGTTCTTTGGTGAAAAAGCGCGTGGTTTCGAAAAGTT CAAATACCCCTGTATCATCTCGGAAGAGAGTTAAAGTATTACCTACGAGC GGAGCTCTAATTTTTTCTTTCAAAAGATCGTTCGCGCACTGGTTCTTCGT TCGTGGACTGGGTCCGAATAGCGCTCGCTTTAACCACTTATTATTCCAAG AAGAAGGCTTCAAATAAAGTGAAAACAAACTGAAAGAAGGACTTCAACCT TGTCTACAAGATAGTCAAAAAGGATTTATGTAAAAACTAAAAGTAAGTGA AAAAAGTGAAAAATAAGTTTGGCGTTCGTGCACTGGGGACCCTCCTCTAT AGGAGCACGAATCTGTTAGTGGATGTCAGTAGCCTAGATACAGACTTGAT TTATACAGTGGAGTCTTCATAAATCGAACCTCTATAGCTGGAATGTCTCG TTAAATAAAACTCGATAAACCGATCTCCATAACTAGAAATAAATTAGGGT GTTCCAGTTATGGAAACTCACTTATATTATACAAGGGGTGTCGGCACGGC GTATGATAAGGTACGGGGAAATAGATGCCAATGGAAAGGAAATTGAAAAA AAAATAAACAAAACTGAATTTCAATGCTCGTCATATTTAAAGATACAGAG ATTTTTTAAATGCCATCTCTCTTTTGTATGTTGTTTATTTGCCATAACAT TGCAAAAGAAGATACGCCCTCCAATAGCAGTGACGACCCGTATTTGTCCA CACGCATTCAAGTCTGAATCGAGTCACGTAGTTGCAACCCCTCTTTTGCC CTAAAAAATGAAAAATTAAAAATGAATTATTATCTACCTATAGTATGACA ATGATTATGAGCTTTTTCCATTATATTCTGTATCCGTTAACACTTATTAC ATTGTCATCTGGATTACACTTAACTCTCTCTAATTCGAATCTCTATTATT TGAATGTCTCTCTAATTCGAACTGAAGCATTTGTCTGCTCAGCTGAAAGG TCATTCGTTATATTCGAATATTTCTCTTATCCATTGGAGAAAATTCTTGG TCCCTCGAAGATCGAATTAGAGAGAGTCAAAAGGCAATCATTCAATGAAA ACATGAAAACACCTTTTTTAAAAATTTTTGCTGTTTAAATAGGTGCACGG TTACAAGTCATTTACGGTTTTCCTTTGAAAATTTCATACAGTCAACGCTC TCTAATTCGATTTTCAAGGGGAATTGGATTTTCATCGAATAAGGGATCGT ATTGAATAGTAGAGCATCGCTTATGAGAGTTTCTTGTTGACGGTGACTTT CAATATTATCGAATAATGGGGTGTATTGAATAGTAGAACGTCGAATTAGA GAGCGTCAACTGTAGTTCATATGTACAACTTACTCGATTGGTCCTGTATG TTTTGTCCTTCTTCAGAAAGTCTGTAGATTGGGAATGATCCACAATATTG TTGGATGGTCAGAGGAATATTTCCTGGTTGAATGACAGAGCCAGTTCCTT TGAAATTCTTAGTGTCTTTCACATCGTCAGGAACTTTCCTACCCAGCTGT AAATGAAAAGATTAAAAGATATCATTATCTTAAGATAAATGTATATTCTT AAAAGCTAACAAAGACTAAATTTAATTATGTTTGTAATTTTTACTTTGTC AGGGAAGTCTTAAAAACAAAAAGTTTGAAACTATGGTTCATCAGCTAAAG CACGTGTGCAAAAAAGAGTCAGCTCTCAGCTCCCAGTAATTTACCGCCTA GATCAGATTATTTAATCTCAGCTACTCATTTGCCGAGTTGACGGTAGCCG GGGATCGAGCCCGCAACCTTTGGATTGTATGAGACGAAAGCTCTACCGAC TAAGCTATTCGAACAGTGGAACTTACTTTGTTCAATCGGTGTCTGATCTT GGCATTGGTGTCTCCGTACTCATCTTTCATTAGGAAACATTTCTTTTCAC CCGTAATCTTCATCACACTTAAACCCTAAACAAAATGAAGGTGGAGGTTG TATGACCAATATTTTTTTATAGAAAAACACTAATAGCTTTTGAAGAAGTA TTAGATTGATGGGTTTTTCGAAATTCAGCTTTAACGAAAAAATGAAAAAG TATTCTGTGTGATATACAGGGGTCGCGAAAATGCCGGGTAGGTAGAAAAC TTTCCAAATTTAAAAGTCGGGGGTCGGAATAAGAATGTTCTGAGTTAAAA ACTTCCGAAAAAAACGTAAAAATAAAGCTGTACAAATGAATAGCTTTCAA AAACATCTATCCAAGAGCTAATTAGAAAAGAGTCTAGTATAAGAATGTCC TAGGTTAAAGATTTTTCCAAAAGAAATAAGCGTGGGTGCTCGTTATGTTT TGTGTCCACAAGCGAACACATTATTTTTTATAAGCAACCAGTTTGCTCAG GCTCGAGGGCTCAAATTCGCCAATTTTAGTAAGTAAAGTAAAAGCTTTTC AGATAACCATGGCAAAAAATAGTCCTTGACTCAATAAGCATAAATATGGT ATAATATCAGGGGAGGCCAAAGCATTTTCGGAAAATGAGCTGGAATGCTA AGTAACCCAAGGGCTGGGAGTTGGTTATAAAAGATTTGTATGTACTGACT CACAGTTCTATGATCTACCAAAACCCGCGTTCCTTTTGCTTCGATCACAT ACTCCGTAGTTTCATTCTGGTCATCGAAAATCACTTTCTCGGTCAACTTT CTCCCATTTTCGTTGAATTCAATGTCAACATCTCCTTTTTGTGGAATACC AAACACAAATGCTGTCAGGGAAATTCCCACGATGAAGAATAATTTGAAGG CCTGAAAGTGTAGTGAAAGAAAAAGGTTCGTTTTAAACGAGCTCATAGAA TGGAGAAGAAAAGCTATTTCGAAATAACTAGCATTTTCATATTGTAGGGG CAAATTGAGAAATAATAAGCTGATGGCTAACCATTAAAAATTTCCAATTT AAAATATCTAGACTGGTGAGAAATGCATCTAAATATTAAGGATCATTTTC TTACCAAAATAAACAAATGAGATCTTTGAAACTATCAAATCGAAGGATTA TTTGAGGAATAAATGTTTCTGCTACCCACGCCTTTTTCCCCTGCTTGTTT TTACGGACTGTCGAATCCTTTATTGGGCTCTTCCATTAAATTTCCATAAA GGGGGGGTGGGGTGGACGAACCTTTTCAAGGCAAAAAAAGTTTCTTAGAA ATGTGGGGATACCTCCTGGAAAATGGCAAAATTTGCAAAAGAACCCTTAA AAGAATTCTTTACATACCTTAAAAGTAAGGGTGGACGAACTAAAATCAGT CTTTTACCCCCTAGAGGTTTTAGAATAAACTTTTACCTCCTGGAAAAATG AAAAAGTACTCAGTTATACCCCCTGGAAATTATTCCACCCCCTGCATGGA TAAAAAATGGAATGACCCATTAAAAGCTGTCCAGTCAAAGATGAAATTTT CTTTATCTTACCATTACTTCTTTTGGTTGTCTTGGTTACGTCTGCTTTCT GTTTCTTCACAAATAGACATACTTTTGCCCCGTACTCCTCCCTTATTTAT ACTGGAAGTTTCGACTAACTTCATTACCAGTGCCCTGGCACAGAAGAGGT TTGGGTTCGTGTTTTTCACTAATATTTCAAGTTTTACACGGAAGAATTTT CTGGGTAAAAAATGTGTTCAAATAAACTCCCTTGATTAAGCAAATACAAA GATGAAAAGGTGTTGTTTCAAATTTTATCTTCCTACTTCCTATTTTGAAC AGCAGTGACTGCTCCAATATAGCTGAAACCTTATGGAAAGACTCAAAATG ATGCGAAAACACCCCCTTCTCACAGACCCACTGGGACCCCTTTACACTGG AAAAATTGGCCAAAATATCGTCCCCGGTGGAATTTATCCTCCAATTTTTG TCCCTGCTGAAAGTAATCAAATAAACAAAGCCTCACTTCAAAATATTATG CTATTTTTCCCATCCCCACTGAATTTTCTGGATTGAAAACAAAAGAATTG AAATCCTCAGGCATAGAAAATATGGGAATATCAATCCTCATCGAGTTTCA GTCCGTTATTTTTATCCCCAAATGCTGAAAAAATTCTACCGGGTTTGTGA GCAGGGAGTGTGCGAAACTCTATTTTCTCGAAATACTAAATATCAATATG GACCGTAGATTGCCAGTCAAAGCCGGACGACATTATTTTGAGAGCATGAA GTAATGTACTGATAAACTCGAGTCAAATCCTTTGTTGCATTAGGGTTAAC ATTATAATAAAATTCTTGGATGGGATGTTTTAATATTCTCTTTTTCATTC ATGACAGGAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTT GTAGTCGTGATGACGATGAACTAGAAACAGGTAACATACCCTTTTACATA TACCCATAGAGGCTCGTCTTTACTCTAGCCTAGTCTAAGGCCCAGGGTTT TTGACATTATCCCAATGTTGGGTATGTGCGGATAGACCTTTAAAAGCCTT AGAGAGACTAAATTTTAGCGAAAAAATGGCACTCGGAGAGACAAAAATGG CGAAACAATGACCTTTAAAAAATAAATTTTCGAAAAATCTGTATGGGAGT GTACTCTAGGAAAGCCTTTTATCCCAATTTGAAAAACAATTGAATTTTTT GGGCCAAATCACCATCTCATATGGAGAAGTGTTGTCCGTGTTGGCAATAG CTTCTTCATTTTATGGTGACTGAATATGACCCGGACAGTATAAAATAGCT AAGCAAGCGGTCTGTAGAAAAAATATAATACTTATGTATGTTAATTCAAG CTTATGATCAAGTTTTTTTCTGTTTCAGCTTTGAAGTTACAATTAGCTGA CATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGTAATCTT TTCATGTTTTAATAGCCATTTCAGTTCATAATTTTCACGATTCTTCGTGA ATCTTTAACTATTTTGAAAACTGATATCACCCTTATTCACAGTATACGAA CGTGATTTTCATATTATTGTTCGATTATGTACCCTATTATTGTCAGGCTT TTTCGGATTTTGTATTCTCAAGGGGGGGGGGGGGGTTTTCCACCAGCCTT GTATAACTTTTGATCTAGAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGGAGATTTTTCAATTCT GTTTTGAATTTCTAAAAGCCAAAAAGAATACCTTTAACATATTTGCCGGT TTTTAATATACTAATAAAATCGAGGCTTAAAATCCGTGCAGAAAATGAGT AAATTTTTTCAAAAAACAATGACGTCATTTATGATGACGTCAGCAGTTTT TGAAAATTTTTAAAATATTTTTGAAAATTTATCATTGGTCCCTAAAACCT GTCAAAATTTGAAGTCAATTGGATGCCTAGATCAAAAGTTATGCTAAATT TAAGATTTTGGGATTTTACAGGGTTTTAGCTGGATTTTATGATATGCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCTGATAAAAAT AGGGTTAAGCTATACTGATCTATTCAAAGCGTTCGTTCTTTTAACTCTGA ACCTTATTCTTTTTAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAA CATCGGTTAATAGGTATAGCAGAGTCTCTATATAGGCTACGCGCATCCCG TCCGAGAATAGTATTTTCATTGCCACTACTACTAATTTGATAAGACTGAT GTGACTCCCCATTCGTTTTTCGATAGGGGGGTAACTCTCCGGACGGGAAT TTTATACATGATGCGCATCCCCTAAACCAAAACATATCATGCGTGCAGTC TACTATCTATGTTTCTTTAGATTGGGCTTTTCCAGAAAAAAATTGAATAT GTAGGTGGAGGATATAACATTTTTAAAAGTTTGCCCCCCCCCCCCCNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCGGAAAAGGCAAATTTT GTAGATTTTTCACTACCCCTCGGACACTATATCCTCCATCCCCTCCCCCA TATATGGACATTTTCTGGAAGAGCCCATTGAAGTCCTGTATCATTTTACT GACTGTGTTTTCTCAACACTTTACATCTGACTGTCTTGTAATATTTCAAA TTTTATTCAAAATTGGAAATAAACATGATTTTTCTTGCTTTTTTCTTTAG CTTCAAGGAGGAAACTGAGCAAAGAAGACAGGTATCGTCTTTTAGTTAGA CCGTTTGTGTCGTCTCCATTTTCATCTTATTTTTAAAAAACTAGTAAATT TGGCTTAATATTGGCTGTACTTCATTTTTCTGGACTTTAAGGTTTAATAT TTTAGGACTGTTCTTACGATGTTCAATGTGTATCCAGCAGCATCGACTAT TTATTCTCTTCGTTTAGGGAATTCAAAGATAAGATCAGACCATTTGCGCA ATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCAGTA GGTTACGTTATCTTGAAACACAATTATCTAATCTAAGACCATGCTCGGAC GTTACGGTTCCGTGTCGTTCCGAAACGGAACCGGTTTCGAAACAAGTGTG AACATCGAAAAAAAGAAGACGTTACAAAGCAAAACAGATCGAAACGGTTT CGCTCCACTTTTTTCATCGGAACGGAACTGTTCCGTTTTCTTGCTCCGAA ACCCTCCGAAGCCAATATAAACACTCTCGATTCATAACGGAAACCATACC GGAGCGATACGAAACCGTAACGTCTGAACATGGTCTAAATTTACAAGGAG TCTGGTTCGAGTTCATCACACTCGAATAACGTCAAATGTATCTGTGGCCA TGTCAGTGTAAAGAGTTTCTACATTTGACGTCACTTTTCCATAACGCACA TCCCTTTGACATGCAGTTTTCGATGCTAGGTGGATCGAAACCGTTCTGAA CTATAGATGAACACATTGAGGTCTTTGATCGATTTTATATTATTATAACA ACAGGTGATTAAAGGTCGCAAAAATGTAATGAAAAATGAAATGAAATGAA AAAGAAATTTCTTTTTTGATCAAGAGAGAAGAATCGTTAAATAAGATATT TACGTATCATATCTTCTAGGAAATTTAGTTCAGATCTGTTTCTACATATG AAAAGAAATGATCACTTAAGTCAAGGAAGAAAACTCATCATAATTTGATG GTATTTTCTTAGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACA AAGTATCGGAGATACGGCATCAAAAAGTTAACTGGTGAGTTTTACGTTTT CTTTGGTGAAAGTTCACTGTGTAATAAGTGGCAAGACAGTGAGTTTGCGC CCCAAATTCCTAAAATTTATAAACGATGTCAAAAATAACGCTAATGGCTC TACTGTAAGACCTCCAGAAGAAGGGGTACATTACGTCATGCTCATTCTTG ACTGGATACCGCTAGTAGTGAACTAGGAGCGCCGCTACCCATGGACCATT TGATGCGGTTCAATCGGGCATAGACTATCTACAATCGTGCTCAATAGTTT CTTGGAATGGCCCTGTAACCATTTCACTTGTGTCATTTGGAGCCTAATTG CATTTTTGAGAACCCCGATGCAAGGATGATGGGTACATGTTTTTTTCATA AGCAAATGTCTGTCCCTATATCAGGCTCGCATTATGCTTAGTATTCTATT GTTCTCAAACAATAGATCCATTGTTTAGGAACTAAAAACTGAGCCTGTAT ATGATTATAAACGTTATGCTTATAAAAGAAAAAATAAGTACTCAACTAAT AATCTTCGAAACCTTTAAGCGATGAAAACTCCTCCTAAATCTCCTCCTAA ATCTGTCAGTAATTGTTTCAATTCATGTGTTTGTATGAATTTATGTTTCT TTACAGGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAA AAAGAAAACAGAAAGCGAATGGTCAGTGATGATGATGATAATTTAGAATT TTGTTCGAATCTTTCAATAACTCGAACTAAAACATCGCAAAATGCTCTCT TATAATTCGAATCCCTTTTTAATTCGATCCCTTGATCCCTTGATCTCTTG ATCTCTTGATCTCTTGATCTCTTGACCTCTTGACCCCTTGATCTCTTGAT CCATTTGATCTCTTGATCACTTGATCCCTTGATCTCTTGATCACATAGTG TGCAAGGGGGTTCCAGGTCCCACCTTATCCTAAAATTCCCACCTTCAGCC CAGACTCCCAGATTCCAGCTAAAAACAAAAAAAATATACCAATTCGAGGA ACAAAACAAAATTTCTTTACCGTAATATGAAGATGCAATATATTACATAT GAAATATTGATATGTCTATTATATACATTTAAAAAGCAGATATATTAAGG CTCTCAGCTTATGCAAAATAAAAGCAGCTCTATCTATCTAAAAGAAATTT TACTTTAACTTTTTCCAAAACACCCAAAGTCCCACCTAAAGAAATTAACT CCCACCTTAACTTGTTTCTCCCACCTAAAACCTGGAAAACCCCAAATCCC ACCTGAAAATTTTCGTCCCAAATCAGCAAAGCCCCCCCACTATTCTGGGG GGTGCACACAATGGATGATCCCTTGATCCCTCGATCCCTTGAAGATTCGA CAACGAGACAACGGTGGAGGTGGTTTCCATACTCCAAACTACATGTAATC TTGAATCTAAAGTATGTACCGGACGGGTTTCTGTGTGTGGGCATCCTGGA AACTTCATCGGTTGAATTTTGACACACAAGCTGCTTCTTGTGTGAATATG TGGGGGAATATTTCTATCTTTTTTAAATTTGATTTACAGGACATAGAATT GTTTTAATGATTTTGACTTAAGGTGAAATGCATTGTTTTCTTCTTGTTCA CAGCAAGTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGA GTAAGTACGAATCTACTACTAGACGCTACGGCTTTTTTTGCGCCGTAATG AAAAATACTGGTTATTGCTGAGGTACTCGCTAGACTCCATTCTCCTTTTA CAAAAGATATTTCTTGTTATGATCGCGTATGCAATGTTTTCTCGAAAAAG ATCTCAATTCAATTCACGTCACGAAATATTCCAAATTCATATGGAGCAAA CAAAATACTCTGAAGAGTTTTAAGTAATTTTGACTACCTATAAGCGATTC ATCAAGCATTTGTGGTGTTTTTAATTGCATAGTTTTATAATATTCTTTTG CATCCATCTAGGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGA CAGTAAGTTGCGATATTTGGGTCATTCCTTTTTATATCCATATCCAGAGG GTAACGAATAAATTTCCACGGGGGGGGGGGGGGGGGGGGAAGAATTTTCA AGGGGAAAAGTTCGTGCGTCCAAGCTCAATTTTAAGGTCTGAAAAAAAAA TTTCCAGGGGGGGGGGGGGTCGGGGAAGAATTTTCAAGGGGAAAAGTTCG TGCGTCCAAGCTCAATTTTAAGGTCTGAAAAGAATATTTCAAAGGGCTCT TGTGCAAATTTAGCATTTTTCCAGAGGGTATCCGCATATTTTTAAGAACC TTTTTTACCTTGAAAAGGTTCGTCCACCCCCAAATTTCATGGAACAGCCC GTTGCTACTACATGATAGTATTAGTTTGTATTAAAAATATTGCGTTTCAT GTTTTCTTACCATACCCCTTTTTGTCTTAATTTTAGTTGTGTGTCATGCT AGGCTAAGATTGTTCGAAATTTGATTCTTTCCCCCCTTTACAAGCTTGAA AGAAAAATTGTTGTAATAGTGTTATATTTTTCCGGCTTATGAATTTTCTT CTTTCCCTTTTTCTCTCAGTAGCAACGAAAGAATTTGAAGAATTCAAAGA GAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAAC ATGTAAGTATTAGTGTTAGTGATTCCGATTTATCGAATTCCATGAAAAAA GTGAAAACTAAAAATTCTCGGCGTTTCGGTGTCTTCTTTACACTATGATC ACAAGTACAGTAAAGAAAATTCAAAATCGAATTTCAATTTATAGACATTC AAAAAATCATTAAATTAAAAAATTACTATCATTAAATTCCTGTTAGGAAC GTCTACCTCTTAAGGGCTCTGGCCATAGTCAAAAAATAGATTTTAGTATT TGAACATGAAAAATTTTGCTTTAAGTTCTTTAACACTTTTAACAAAGAAT TGCCTTTATAAATTGCTTTTTAATGAAATCCCTTAAGAGTAATTAAGAAT TTAATTGCAAAAATGACGTTGTGAACTTTAAAAAGACGTTAATAATATGT TGCATTACCTTCTTTTATAAAAAGTACTAAGTTTTCAGTAATTAACCTTT TAGTTTCGAAGTTTTTTCAAACTGTCAGCAAAGAATTGAACTGTTTTAAA TTTTTCGGAAAACTTTCTAAATTAATGCATCAAAGGTTATGGCTGTTTTT TTATGAAACATTGGGATAAAAAATTGGTCAAAAAGCACTATTTTCAAGAT TTTAAGACAAATAAGCTTTTAGAAAAATTTTCCAAAAATACATTTTTAGT TCGGTAAAAGATACACCATCTACCGCAAAAAAAATTCAAAATGTTTTTTC TTCGCCGAAAATAAGCTCTTCAAAGTTGAAATACTCTTCTTCACAAAAAT GTTCATTTTCTACTTCATCAAATTTTTTCATTGCAATTCTTACATTTTCA GACAGAAAATGTATAACATGCGACAGTTTTGTGTGCTACATCAAGTAGAA ATTTATATTTTTTACGTGGCAAATATTAAGAACTCACTATGGTCAGAGCC CTTAAAAGAACTCGAATTCATTTGAACGAATGGAATACGGACTTCCCGTC AACATTTTAAAAATATGTCGTGCGATGTTGTCTTCTGACATTACATCATA AACCAACAGCTGATTGGTTGTAAGTGACGTAAAATCAGTCAATATGTCAC TTGCAACCAATCAACTATCGGGATGTGATGTAATGTCAGAAGACATTGCA ACAGTGCATATCATGAAAAGCCTATGTTCAGTTTCCTCTTTCAGCTTTGC GCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCT GCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAAC CGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTC ATACAATGTGGTTGGATAAGTGAATAAAGATAATCTTCGATATAAATTGT GTAGTGCTTTCTTTTCTTAAATCACTCGATTTTTTTATTCATGAAAATTC ATATATTTATATTTTTGTTTAATAATTTGTAAATTTTTTTATCCATATTA TAGCCAAATACCTTATAACACTAAATCATTTGTTCGATATTCCATTTGTG TACAGGAGACTCCCGGTTATATTCGAAGGTACCTTTCTC

Coding sequence (CDS) from alignment at scaffold_90:196096..241834-

>TCONS_00073362 ID=TCONS_00073362|Name=TCONS_00073362|organism=Clytia hemisphaerica|type=CDS|length=25365bp|location=Sequence derived from alignment at scaffold_90:196096..241834- (Clytia hemisphaerica)
CTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATC
TTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGA
CGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAG
TTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTT
GAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTC
CGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGAT
ATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAA
AAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAA
AGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGA
ATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAA
AGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAG
AATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGAC
AGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGC
TTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTT
CCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGC
TCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCA
ACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACA
AGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACATTACC
GAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAG
ACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACA
TATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTA
TTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATG
CCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGA
TGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACC
ATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCT
GAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAAC
AAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTC
CAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGA
ATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACT
ATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGT
GGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAG
AAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACA
TGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTAT
ATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAA
TATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCG
AATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCG
GAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACC
ATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATA
GAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGAT
TATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATT
AGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGA
GTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTG
ATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCA
ATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATAT
GATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTATCACA
TATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAG
TTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTG
GAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGG
ATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACAACACG
GCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAAC
GAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCC
ACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTC
GATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGG
AAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATTACGTTGTTCG
CGATACATGACTTTGAAATCTTACCTGCTCAACGAATACGCCTCTTCTCG
TATGAAAATACCTCACAAGACGAAACCGCCACACTATTTAACGCCCTCGT
TAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTGGATAAGTGAA
TAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGTCCGAT
ACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTTTCATCGGACG
ATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCACCTCCTCGTAC
AACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAA
ACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAA
TTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAA
AAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGT
TCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCACTTCAAGGA
GGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGGGTTGATTACA
AGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTGACATGTATTG
GAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATGACAATGATGC
AGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACGATGAACTAG
AAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGAT
TTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGA
TTTTGAACGGTCACATTACCGAAATCAGTATCACATATTCCTGATCATGC
TTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAA
ACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACCAAATCACCGC
AAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGA
AGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGTG
TTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACC
ACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTG
GATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAA
ATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGAC
CGATGCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTG
AAATCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCA
CAAGACGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTAC
AAGAGTTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAG
AATTTGAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTA
CTGTCCGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAG
ATGATATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGG
TAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGG
AAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATA
AAAGAATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAA
TTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATG
GGAAGAATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAG
AAGACAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTA
ATAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGA
ACGTTCCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAA
AACGCTCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTAT
CACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAG
CAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACA
TTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGC
ACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGA
CGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACA
TTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATT
AGATGCCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGC
AGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAA
GTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGT
GTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTC
ACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGA
CCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTC
AACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCC
ACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATAC
AATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCA
AAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAA
AAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAA
GTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTC
AAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGA
AAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAG
TATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATC
AGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAA
TAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTC
GTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTA
CAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAA
AAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAG
TCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGA
AGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGC
TATATGATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTA
TCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGA
AGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCA
TGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTC
AAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACA
ACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCA
CAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTA
TTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAG
ACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCT
GCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATTACGTT
GTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGAATACGCCTCT
TCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACTATTTAACGCC
CTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTGGATAA
GTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGT
CCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTTTCATC
GGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCACCTCCT
CGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATT
TGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAA
GAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGATACGGC
ATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTGCGCAA
TTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCACTTC
AAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGGGTTGA
TTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTGACATG
TATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATGACAAT
GATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACGATGA
ACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCAC
TTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGT
GATGATTTTGAACGGTCACATTACCGAAATCAGTATCACATATTCCTGAT
CATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAA
GAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACCAAATC
ACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCT
GATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAA
CTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGA
TTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTG
TTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTA
TTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGC
GCGACCGATGCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGA
CTTTGAAATCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATA
CCTCACAAGACGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGC
CCTACAAGAGTTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAAC
GAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCC
AATTACTGTCCGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAA
GAAAGATGATATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACA
TCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGG
AACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCAC
GAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACT
GGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAG
CAATGGGAAGAATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAG
CAAAGAAGACAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATC
GGTTAATAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTT
CATGAACGTTCCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTG
ATCAAAACGCTCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCA
GTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTG
CCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGG
TCACATTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAA
GAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAA
AGGGACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACG
GTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTA
TTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCG
GGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGA
GCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGT
GTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAA
CCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTG
CGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACC
TGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAA
CCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTT
CATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGA
ATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATA
AAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGA
CACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAG
TTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAA
ACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGA
CAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATA
AGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTG
GTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGAT
TGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGA
AGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGA
TGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTT
TGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCT
TTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAAC
TTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAAT
CAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCAC
TTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCC
GATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGA
TCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATT
GAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGC
AATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGC
AATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTG
TCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGA
TGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATT
ACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGAATACG
CCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACTATTTA
ACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTG
GATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAAT
GTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTT
TCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCAC
CTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGA
AGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGG
AGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGAT
ACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTG
CGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATC
ACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGG
GTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTG
ACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATG
ACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGAC
GATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGA
ATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGT
TCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTATCACATATTC
CTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTAT
TTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACC
AAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGA
CAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTT
GGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGT
CATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCA
GATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGC
TTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACT
CAAGCGCGACCGATGCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATA
CATGACTTTGAAATCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGA
AAATACCTCACAAGACGAAACCGCCACACTATTTAACGCCCTCGTTAAGG
CTCGCCCTACAAGAGTTCTTCATACAATGTGGTTGGATAAGTGAATAATA
GCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGTCCGATACTTC
TTTCCAATTACTGTCCGATAAAGAAAAACATGTTTTCATCGGACGATTCG
AGAAAGAAAGATGATATAGACACAAGTTATATCACCTCCTCGTACAACGA
AAACATCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAAACACA
ACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAA
AGCACGAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAAAAAGT
TAACTGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAAC
CTCAGCAATGGGAAGAATTGGTTAATAATAGAATCACTTCAAGGAGGAAA
CTGAGCAAAGAAGACAGGATTGCTCGTGATTATGGGTTGATTACAAGTAA
ACATCGGTTAATAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGGG
TACTTCATGAACGTTCCAGATGGAAAAAGAGTATGACAATGATGCAGAAA
ACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACGATGAACTAGAAACA
GGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACC
GGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTG
AACGGTCACATTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAG
TTGAAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAAACATT
GGAAAAGGGACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGA
TAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGAAA
TGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGTGTTTCG
CATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTC
ATTGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTG
AGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAATGAG
TGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATG
CTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATC
TTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGA
CGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAG
TTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTT
GAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTC
CGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGAT
ATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAA
AAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAA
AGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGA
ATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAA
AGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAG
AATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGAC
AGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGC
TTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTT
CCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGC
TCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCA
ACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACA
AGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACATTACC
GAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAG
ACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACA
TATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTA
TTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATG
CCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGA
TGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACC
ATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCT
GAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAAC
AAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTC
CAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGA
ATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACT
ATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGT
GGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAG
AAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACA
TGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTAT
ATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAA
TATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCG
AATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCG
GAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACC
ATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATA
GAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGAT
TATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATT
AGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGA
GTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTG
ATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCA
ATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATAT
GATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTATCACA
TATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAG
TTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTG
GAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGG
ATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACAACACG
GCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAAC
GAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCC
ACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTC
GATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGG
AAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATTACGTTGTTCG
CGATACATGACTTTGAAATCTTACCTGCTCAACGAATACGCCTCTTCTCG
TATGAAAATACCTCACAAGACGAAACCGCCACACTATTTAACGCCCTCGT
TAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTGGATAAGTGAA
TAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGTCCGAT
ACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTTTCATCGGACG
ATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCACCTCCTCGTAC
AACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAA
ACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAA
TTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAA
AAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGT
TCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCACTTCAAGGA
GGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGGGTTGATTACA
AGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTGACATGTATTG
GAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATGACAATGATGC
AGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACGATGAACTAG
AAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGAT
TTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGA
TTTTGAACGGTCACATTACCGAAATCAGTATCACATATTCCTGATCATGC
TTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAA
ACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACCAAATCACCGC
AAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGA
AGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGTG
TTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACC
ACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTG
GATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAA
ATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGAC
CGATGCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTG
AAATCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCA
CAAGACGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTAC
AAGAGTTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAG
AATTTGAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTA
CTGTCCGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAG
ATGATATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGG
TAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGG
AAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATA
AAAGAATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAA
TTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATG
GGAAGAATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAG
AAGACAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTA
ATAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGA
ACGTTCCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAA
AACGCTCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTAT
CACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAG
CAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACA
TTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGC
ACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGA
CGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACA
TTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATT
AGATGCCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGC
AGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAA
GTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGT
GTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTC
ACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGA
CCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTC
AACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCC
ACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATAC
AATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCA
AAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAA
AAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAA
GTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTC
AAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGA
AAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAG
TATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATC
AGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAA
TAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTC
GTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTA
CAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAA
AAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAG
TCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGA
AGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGC
TATATGATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTA
TCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGA
AGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCA
TGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTC
AAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACA
ACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCA
CAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTA
TTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAG
ACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCT
GCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATTACGTT
GTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGAATACGCCTCT
TCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACTATTTAACGCC
CTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTGGATAA
GTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGT
CCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTTTCATC
GGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCACCTCCT
CGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATT
TGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAA
GAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGATACGGC
ATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTGCGCAA
TTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCACTTC
AAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGGGTTGA
TTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTGACATG
TATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATGACAAT
GATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACGATGA
ACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCAC
TTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGT
GATGATTTTGAACGGTCACATTACCGAAATCAGTATCACATATTCCTGAT
CATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAA
GAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACCAAATC
ACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCT
GATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAA
CTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGA
TTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCAGATTG
TTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTA
TTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGC
GCGACCGATGCTTTGCGCGACCGTCCAATTACGTTGTTCGCGATACATGA
CTTTGAAATCTTACCTGCTCAACGAATACGCCTCTTCTCGTATGAAAATA
CCTCACAAGACGAAACCGCCACACTATTTAACGCCCTCGTTAAGGCTCGC
CCTACAAGAGTTCTTCATACAATGTGGTTGGATAAGTGAATAATAGCAAC
GAAAGAATTTGAAGAATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCC
AATTACTGTCCGATAAAGAAAAACATGTTTTCATCGGACGATTCGAGAAA
GAAAGATGATATAGACACAAGTTATATCACCTCCTCGTACAACGAAAACA
TCTGGTAAAAAAGAGTTGTCAAGAATATGAAGATTTGAAAACACAACGGG
AACGGAAAAAAGAAAACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCAC
GAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAAAAAGTTAACT
GGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAACCTCAG
CAATGGGAAGAATTGGTTAATAATAGAATCACTTCAAGGAGGAAACTGAG
CAAAGAAGACAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATC
GGTTAATAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGGGTACTT
CATGAACGTTCCAGATGGAAAAAGAGTATGACAATGATGCAGAAAACTTG
ATCAAAACGCTCGTTTGTAGTCGTGATGACGATGAACTAGAAACAGGTCA
GTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTG
CCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGG
TCACATTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTTGAA
GAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAA
AGGGACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGATAACG
GTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGAAATGTTA
TTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGTGTTTCGCATCG
GGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGA
GCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGT
GTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAATGAGTGGAA
CCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTG
CGCGACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACC
TGCTCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAA
CCGCCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTT
CATACAATGTGGTTGGATAAGTGAATAATAGCAACGAAAGAATTTGAAGA
ATTCAAAGAGAAAATGTCGTCCGATACTTCTTTCCAATTACTGTCCGATA
AAGAAAAACATGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGA
CACAAGTTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAG
TTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAA
ACAGAAAGCGAATGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGA
CAAAGTATCGGAGATACGGCATCAAAAAGTTAACTGGGAATTCAAAGATA
AGATCAGACCATTTGCGCAATTCGTTCAACCTCAGCAATGGGAAGAATTG
GTTAATAATAGAATCACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGAT
TGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGTTAATAGCTTTGA
AGTTACAATTAGCTGACATGTATTGGAGGGTACTTCATGAACGTTCCAGA
TGGAAAAAGAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTT
TGTAGTCGTGATGACGATGAACTAGAAACAGGTCAGTTATCACCAACGCT
TTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAACAAGAAC
TTGGCTATATGATGTTCCGTGATGATTTTGAACGGTCACATTACCGAAAT
CAGTATCACATATTCCTGATCATGCTTCAGTTGAAGAAGCACAAGACCAC
TTTGAAGAAGTTTATTTGAAGAAAAACATTGGAAAAGGGACGACATATCC
GATCATGTTGGAACCAAATCACCGCAAGGATAACGGTACATTTTATTTGA
TCGTCAAAGGATGGACAGCTGATGAAGAAATGTTATTATTAGATGCCATT
GAACAACACGGCCTTGGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGC
AATCACAAACGAGGTCATGATTACCACCTCATTGAGCAAAGTACCATTGC
AATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTG
TCCAGACTTCGATGCTTGTATTCAAATGAGTGGAACCCTCACAACAAAGA
TGGCTGCCGGAAACTCAAGCGCGACCGATGCTTTGCGCGACCGTCCAATT
ACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTCAACGAATACG
CCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCCACACTATTTA
ACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAATGTGGTTG
GATAAGTGAATAATAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAAT
GTCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTTT
TCATCGGACGATTCGAGAAAGAAAGATGATATAGACACAAGTTATATCAC
CTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTTGTCAAGAATATGA
AGATTTGAAAACACAACGGGAACGGAAAAAAGAAAACAGAAAGCGAATGG
AGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATCGGAGAT
ACGGCATCAAAAAGTTAACTGGGAATTCAAAGATAAGATCAGACCATTTG
CGCAATTCGTTCAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATC
ACTTCAAGGAGGAAACTGAGCAAAGAAGACAGGATTGCTCGTGATTATGG
GTTGATTACAAGTAAACATCGGTTAATAGCTTTGAAGTTACAATTAGCTG
ACATGTATTGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGAGTATG
ACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGAC
GATGAACTAGAAACAGGTCAGTTATCACCAACGCTTTTGAAGCCAATGGA
ATCACTTGATTTACCGGTTGCCGAGCAACAAGAACTTGGCTATATGATGT
TCCGTGATGATTTTGAACGGTCACATTACCGAAATCAGTATCACATATTC
CTGATCATGCTTCAGTTGAAGAAGCACAAGACCACTTTGAAGAAGTTTAT
TTGAAGAAAAACATTGGAAAAGGGACGACATATCCGATCATGTTGGAACC
AAATCACCGCAAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGA
CAGCTGATGAAGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTT
GGAAACTGTGTTTCGCATCGGGTGCAGAGATGGGCAATCACAAACGAGGT
CATGATTACCACCTCATTGAGCAAAGTACCATTGCAATTATTGCCACGCA
GATTGTTCTGGATTGAGGGTGTCGTGTGCTGAGTGTCCAGACTTCGATGC
TTGTATTCAAATGAGTGGAACCCTCACAACAAAGATGGCTGCCGGAAACT
CAAGCGCGACCGATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045517XLOC_045517Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073362-exon-scaffold_90-1575043694:241780..241834TCONS_00073362-exon-scaffold_90-1575043694:241780..241834Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:220541..220632TCONS_00073362-exon-scaffold_90-1575043694:220541..220632Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:219882..219941TCONS_00073362-exon-scaffold_90-1575043694:219882..219941Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:211680..211774TCONS_00073362-exon-scaffold_90-1575043694:211680..211774Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:211088..211128TCONS_00073362-exon-scaffold_90-1575043694:211088..211128Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:210562..210612TCONS_00073362-exon-scaffold_90-1575043694:210562..210612Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:210024..210074TCONS_00073362-exon-scaffold_90-1575043694:210024..210074Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:209124..209227TCONS_00073362-exon-scaffold_90-1575043694:209124..209227Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:203905..203977TCONS_00073362-exon-scaffold_90-1575043694:203905..203977Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:203393..203456TCONS_00073362-exon-scaffold_90-1575043694:203393..203456Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:202122..202168TCONS_00073362-exon-scaffold_90-1575043694:202122..202168Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:201354..201384TCONS_00073362-exon-scaffold_90-1575043694:201354..201384Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:201088..201167TCONS_00073362-exon-scaffold_90-1575043694:201088..201167Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:200301..200372TCONS_00073362-exon-scaffold_90-1575043694:200301..200372Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:199614..199678TCONS_00073362-exon-scaffold_90-1575043694:199614..199678Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:198635..198681TCONS_00073362-exon-scaffold_90-1575043694:198635..198681Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:198283..198323TCONS_00073362-exon-scaffold_90-1575043694:198283..198323Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:197633..197715TCONS_00073362-exon-scaffold_90-1575043694:197633..197715Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1575043694:196096..196490TCONS_00073362-exon-scaffold_90-1575043694:196096..196490Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:241780..241834TCONS_00073362-exon-scaffold_90-1510915933:241780..241834Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:220541..220632TCONS_00073362-exon-scaffold_90-1510915933:220541..220632Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:219882..219941TCONS_00073362-exon-scaffold_90-1510915933:219882..219941Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:211680..211774TCONS_00073362-exon-scaffold_90-1510915933:211680..211774Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:211088..211128TCONS_00073362-exon-scaffold_90-1510915933:211088..211128Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:210562..210612TCONS_00073362-exon-scaffold_90-1510915933:210562..210612Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:210024..210074TCONS_00073362-exon-scaffold_90-1510915933:210024..210074Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:209124..209227TCONS_00073362-exon-scaffold_90-1510915933:209124..209227Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:203905..203977TCONS_00073362-exon-scaffold_90-1510915933:203905..203977Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:203393..203456TCONS_00073362-exon-scaffold_90-1510915933:203393..203456Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:202122..202168TCONS_00073362-exon-scaffold_90-1510915933:202122..202168Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:201354..201384TCONS_00073362-exon-scaffold_90-1510915933:201354..201384Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:201088..201167TCONS_00073362-exon-scaffold_90-1510915933:201088..201167Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:200301..200372TCONS_00073362-exon-scaffold_90-1510915933:200301..200372Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:199614..199678TCONS_00073362-exon-scaffold_90-1510915933:199614..199678Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:198635..198681TCONS_00073362-exon-scaffold_90-1510915933:198635..198681Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:198283..198323TCONS_00073362-exon-scaffold_90-1510915933:198283..198323Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:197633..197715TCONS_00073362-exon-scaffold_90-1510915933:197633..197715Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1510915933:196096..196490TCONS_00073362-exon-scaffold_90-1510915933:196096..196490Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:241780..241834TCONS_00073362-exon-scaffold_90-1491911889:241780..241834Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:220541..220632TCONS_00073362-exon-scaffold_90-1491911889:220541..220632Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:219882..219941TCONS_00073362-exon-scaffold_90-1491911889:219882..219941Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:211680..211774TCONS_00073362-exon-scaffold_90-1491911889:211680..211774Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:211088..211128TCONS_00073362-exon-scaffold_90-1491911889:211088..211128Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:210562..210612TCONS_00073362-exon-scaffold_90-1491911889:210562..210612Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:210024..210074TCONS_00073362-exon-scaffold_90-1491911889:210024..210074Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:209124..209227TCONS_00073362-exon-scaffold_90-1491911889:209124..209227Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:203905..203977TCONS_00073362-exon-scaffold_90-1491911889:203905..203977Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:203393..203456TCONS_00073362-exon-scaffold_90-1491911889:203393..203456Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:202122..202168TCONS_00073362-exon-scaffold_90-1491911889:202122..202168Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:201354..201384TCONS_00073362-exon-scaffold_90-1491911889:201354..201384Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:201088..201167TCONS_00073362-exon-scaffold_90-1491911889:201088..201167Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:200301..200372TCONS_00073362-exon-scaffold_90-1491911889:200301..200372Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:199614..199678TCONS_00073362-exon-scaffold_90-1491911889:199614..199678Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:198635..198681TCONS_00073362-exon-scaffold_90-1491911889:198635..198681Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:198283..198323TCONS_00073362-exon-scaffold_90-1491911889:198283..198323Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:197633..197715TCONS_00073362-exon-scaffold_90-1491911889:197633..197715Clytia hemisphaericaexon
TCONS_00073362-exon-scaffold_90-1491911889:196096..196490TCONS_00073362-exon-scaffold_90-1491911889:196096..196490Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073362-proteinTCONS_00073362-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:196096..241834 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
20.1709 20.2536 7.22724 2.36625 18.0295 14.1559 9.06471 14.9527 10.715 11.2921 12.5026 12.347 5.13299 11.6456 7.78319 8.955 3.79414 9.41803 9.20048 8.34714 6.0874 8.75882 34.7739 30.5707 3.28925 6.36756 6.22767 8.20155 21.22 25.0234
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000433Znf_ZZ
IPR001005SANT/Myb
IPR016827Ada2/TADA2
IPR017884SANT_dom
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003713transcription coactivator activity
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0035065regulation of histone acetylation
GO:0006357regulation of transcription from RNA polymerase II promoter
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035065 regulation of histone acetylation
biological_process GO:0006357 regulation of transcription from RNA polymerase II promoter
molecular_function GO:0003677 DNA binding
molecular_function GO:0003713 transcription coactivator activity
molecular_function GO:0008270 zinc ion binding
Blast
BLAST of TCONS_00073362 vs. Swiss-Prot (Human)
Match: TAD2B (Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 1.205e-106
Identity = 177/438 (40.41%), Postives = 265/438 (60.50%), Query Frame = 1
Query:   58 AKYHCNYCHADCSGLRVSCAECPDFDACIQCFASGAEMGNHKRGHDYHLIDNGTFYL----IVKGWTADEEMLLLDAIEQHGLGNWDDISDHVG-TKSPQEAQDHFEEVYLKKNIGKVTLPKSV-SHIPDHASVEG-QLSPTLLKPMESLDLPVAEQQELGYMMFRDDFEREYDNDAENLIKTLVCSRDDDELETALKLQLADMYWRVLHERSRWKKIARDYGLITS------KHRLIASRRKLSKEDREFKDKIRPFAQFVQPQQWEELVNNRIRERELKARIKELTKYRRYGIKKLTGCQEYEDLKTQRERKKENRKRMQVISPPRTTKTSGK-KEFXXXXXXXXXXXXXATXXXXXXXXXMSSDTSFQLLSDKEKHLCATVQLRCSRYMTLKSYLLNEYASSRMKIPHKTKPPHYLTPSLRLALQEFFIQCGWIS 1329
             K +C YC A+ S LR  C EC D + C +CF++GAE+G+H+R H Y L+D G F L       GWT+ EE LLLDAIEQ G GNW+D++ HVG +++PQE  +H+  +Y+  N+GK  +P ++ + + DH    G  LSP+L  P+  LD+ VAEQQ+LGYM  RDD+E EYD DAE LI  L  + DDD++E  LK    DMY R L ER R K IARDY L+ +      K +  A +RK++KE++E + K+RP  QF+  +++++L  N  +E+ L+A+I+EL +YRR GI K+    EYE  + +RE++KEN+     ++  +  K  GK  EF++                      + +   F+LLSD+EK LC+++ L  +RY+T+K+ ++ ++   R  IP K++ P YL   L+  +  F  + GWIS
Sbjct:    5 GKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEKEKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKN----LAGSKRGKEDGKDSEFAA----------------------IENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWIS 416          
The following BLAST results are available for this feature:
BLAST of TCONS_00073362 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAD2B1.205e-10640.41Transcriptional adapter 2-beta OS=Homo sapiens GN=... [more]
back to top