Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073358 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073358
Unique NameTCONS_00073358
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2265

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073358 ID=TCONS_00073358|Name=TCONS_00073358|organism=Clytia hemisphaerica|type=transcript|length=2265bp
AGAACATCAATTTTTAGTTTACTACAAGTAGCTCTATACGAAGTGTGTTT
TTGAATACAACTTTTTCTGAAGAATGGAGTCAGAAGAAAGGAATTTCccc
ataataataaaaagaagacTAAGTATGCGGAAGTCTGGGGCTAGTGGAAA
TAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAG
ATTTACGAGGCTTAAATGACAagGTGACACTGAAACACATCTTGGGCTTA
ACCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTAT
CGCATATCCTGCAGGATGCGTTATAGTTCTTTACAACACCAAGACAAACA
TTCAAAAACACATTCTCAACCCAGACAAaaagacGATCACGTGCGTGTCA
TTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAATCTGGTCAACAACC
TTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGC
TCAGAGGTCACAAGTCTGGTATAAATGCTGTGGAATTTTCACCGAACAAT
AAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTG
GAATTGGAAGCTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGG
TGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGC
AACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAAGG
CAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACC
AACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCC
GCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGA
ACGTCGTATCATGGATAAATGGGTCGAACTGAAGGCTGGTAGTGCAAATT
GCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTT
ATAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAG
GCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACcGATT
TGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTA
GATTCAGAACATTTCAAGATGACCAGTATATACAATGATCATAGTTTGTA
TGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTC
TTTACCACAGTGCTTGTATTTGGGGCGTGGAGACTTATCCTTATTTCGAC
GATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATC
CGATGATACTATACGTATTTGGAACATCGAGACAGGGAACACACAAGTCA
AGATGTACCCCCGTAATTTGTACAGTAAGGAacttttgaaaatcgtctac
ATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGG
TAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTG
ATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGATTTAC
TCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGA
AATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGTTACAAATTATTGG
CATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAG
TACACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGT
TCGATTCAACTatgatgaaaatattttacaattATTAAGTTGTGGTGCGG
ATAAAGTAGTCATGTTCCATACCGCCCAAACGaaCGAAAATGGTGTTTGC
TTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGG
GATTGAGCCGACCAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATA
TGAGGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGA
TCATTAAGTGATGAAGGCAACTTGATCAAGTTTCAATTGGACGGTGGTGG
TGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACT
TTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACT
ACTAGTGTTGTTTacattttttatatataagaaccaatagaatttttctg
aggctcggttgttct
Run BLAST on NCBI

protein sequence of MAPK binding protein

>TCONS_00073358-protein ID=TCONS_00073358-protein|Name=MAPK binding protein|organism=Clytia hemisphaerica|type=polypeptide|length=718bp
MESEERNFPIIIKRRLSMRKSGASGNKITPNRKLIRKSASRQDLRGLNDK
VTLKHILGLTTTNTNGLASNPTSGIIAYPAGCVIVLYNTKTNIQKHILNP
DKKTITCVSFSPDGRYLVSGESGQQPSVRVWDLNENLSQVAELRGHKSGI
NAVEFSPNNKLLVSIGDQHDMLVNVWNWKLGHTVACNKSGCRVRSVSFSE
SGNYLVTVGNRHVKFWYLDQEAISKGNAPITPITGRAGILGDQRNNCFTD
VKCGRGKNSAFTYCVTKSSLLCMFNERRIMDKWVELKAGSANCLEVTENY
IFCGCSNGLIRVFDPTSLRFVASFPRPHNLGVNVSEGLQPTDLVHVSNKS
CPDLVAITLDSEHFKMTSIYNDHSLYVWDLKNIKKVGKVASFLYHSACIW
GVETYPYFDDSPSACLPYGSFLTCSSDDTIRIWNIETGNTQVKMYPRNLY
SKELLKIVYIDEDLSNIQDTSMAPFGKDTDGKNGVRCMQISPDGQILATG
DRSGNLRIYSLDFFDETFRIEAHESEILCVEFSPEESGYKLLASSSRDRL
IHIFDVMKKYTLLQTIDDHSSSITAVRFNYDENILQLLSCGADKVVMFHT
AQTNENGVCFVRNTIVPGKATLYDMGIEPTRKYAATVGQDRNMRVYNVQE
AKQTTCFKGSLSDEGNLIKFQLDGGGVYAAISCSDKTIGIFDFVNGECEA
SMHGHSGKTTSVVYIFYI
Run BLAST on NCBI

transcript from alignment at scaffold_90:140241..181711-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073358 ID=TCONS_00073358|Name=TCONS_00073358|organism=Clytia hemisphaerica|type=transcript|length=41471bp|location=Sequence derived from alignment at scaffold_90:140241..181711- (Clytia hemisphaerica)
AGAACATCAATTTTTAGTTTACTACAAGTAGCTCTATACGAAGTGTGTTT TTGAATACAACTTTTTCTGAAGAATGGAGTCAGAAGAAAGGAATTTCCCG TAAGTTTGAAATTTTCTTCAGTCTGTTCAAAGCATATCAGAGGTGTTTTT AGCGAGTTCATAATCTATGTTTTTCTGCGATGGAGACGGTTAGTTTTCGA TTTTTCTACATTCTGACTGACTGGATGACGGTAAATCAGCACTTTTAACC GTCCTTGATTTTGCTGGTCAGAAGTGCGGGTTATTCCAAATCGCTTCAGT CACTCCACCGTCCTCGAAAGTGAAAATATATGAATACGCTTTTATCGAGA GAACGGGTGTTGAAAAGCAGGAGGAATTCATACAGACTCATTTGATGTGA TGGTAATGAGGTTACGTCTGCCTCAAAGTATTCTTGAAAAGTAGACGTTC TTTCTTTAAACCTTTAGATTGTTCCGAAAGATGACTGTCAAACTGCTACA GTTACAGACAAATTCAGAAAAGACGTCTAAACTGATGTCCTTTATTTTAT TGTTATACAAAAAGACAGCAATAGAAATTTTATTGATAAGTAGAAACAAG CATTTATTCTGCCCTGTCCGCAACTTTATATTATATTTGAATCATTTTTT TAGTTTTCTTCAAAGCAGATTGTTTGCTACGAAATCTTTTGCCTTTAATC TTTTCTTTTTATTTTCAGCATAATAATAAAAAGAAGACTAAGTATGCGGA AGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGC AAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGGTATGAAT TTTTTTTTTTTCATAACCATAGACAACTTTCAACAATCTGTATATCCTTC CTATGACTGTTTTATATGGGTTTGAAATTGATGATAATTATCGCTAATAA CTTTGACTATTGGAATGAGTTTTCTTCTTTTTTTCATATCCTCCTGTATC CTTCCTTCTGTCTGAGAAAGATTTAACAACTGAATTTTTGTATCCGTCCC CGCCTTCTTTCCCTCTTTAGGCACTAAGCAATATCGACTTAGAACTTACT ACTTTAGATACAGTAACATAGACAAGAATGGTGTACAGGGACACTATTGT CTTTTTATATTATGAATAAAGATAACAATAGTGTCATAAAAATCTGCTCT CTTGCACATATTTTGTGCCCCTGTTTTCTGCGCTACTGAAGTTGAACAAA AAATAGTAGAAATTGTTATAAAAAGGGCCTATACGGTTTTTTAGAAGACT GAAATATTGTCTGGCTGAAACTACCGGATACCAATTTATCGAAATCTGTC TTTATTTGTAGGTGACACTGAAACACATCTTGGGCTTAACCACAACAAAC ACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGC AGGGTAAGGAAATTTAACCTACTGCACCTTAGTTATTTGTGGTTGAGCTC TTCTGCACATATTTGCTTCAGCTTCTTTATTTTGTTCCCCTGGGATCGAA GGTAAGTTCAAATAGGTACAAAATTAGCTGTCCGTGACTGTTTTCTCTAT CATCAGCCATAACCTTCACTACGAAGTTTGAAACACCCCTCCATCCTAAG GGCGACTCTTATCTTTTTGAAAAATCTTGCCGCGTGTAGGTCTGTTTCGG CTAGAGGAATAGAAAAACTTGGACACACAAGCGAAAGAGCGCTCTTTAAA GATATGGAGAAACCATCGCATTGATTCGAAAAATATGACGTCACTTTTTA AAATGCTAAAAATAGCTACACGCTTCATCGCATACACAAAACGGTGCCTA ACTGCAACAAATGGAACTTTGCGTTTTTTTAGGGGAGAATAGTTTGGCAC TGGCTACTTCATTAGATTTCACTTTCTTAGAAATATATATTCAAATCCGC TCATTAAAGACATTTCTTTTGGTTTTCAGATGCGTTATAGTTCTTTACAA CACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAGTAAGTCC AACCCTCTTTCCCATTTTATTTCAACACGGTTTCATAGAGAACATTCTAT AATCTGTATCTTTTTCTTTATTATCAAGAAATTGAATCAAAATTATTATG AAAACTATCAAAATATTTATTAATTAAAAAAAAGACGGAGAATATTTCCA TCAGGATATTGTATAGCATTACCGACAACGTTTTACGTCTCATATACCAA ATTCTTGTACAAAAGCCAATGCATATCCTCATAATTGACCATCTTTTCAT CTCATAAGTAATGAGCTATTGATATTTAATTAGTCAGTCCCAAAGCAAAA TGCTCCACCAATCGACTTTATTTTGCTTTCCAAAATTTGCGAAATTACGA TTTCAAAAAACTTCGAACACAATTTGNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGAGCTATCGAGG ATCAAAACACTGAAAATTAACCACACAATTGTGCTGTTATTCACAAATGA TCAGTCATTAGTAAAACCAAATTACTTTTATCGCTCAATCATGTTTTTCA CTAAGGACCCCTTGTTTCTCTGACAACTTTTGATTCGATTCTCCTTCAAC ATGGAGATTAGTTTCTGAGCTATTCATAGACGGGCTGATATAAATGTAGA GCTCTTCGTGTGACGCGTTGGATAAAGATGTCATGCTGTTCGCCAGCAAG GATAGAATCTCATTGCGCATGTTTACAGCGATATCTAGCGTATTACTACT CGTTGAGGTAGCGCTTTTTAGTGTTTCTTGATGTGTTGAAGAGAGAGTGG CTTTCTTTCGATGAAACGGCACACACGATGTCAACCTGATCTTCATTTTC TCATCAATAGATCTTCCTTATATATTTACTACGATAATTTTCTTTGTACT CGTAAAGTTTGTCTCTCTTCAGTTTTGGTTTTCCTAAAAAAGATAGAAAA TGTGTTCAATGAAGGGAAAAATCATTGCACAAATGTTCGCCATATCACTA ATAGATCGTTCTAAGAAATGTACTACTTAACAATTTCCCGTTTTTTATCC CTTGATATTACAGATAAAAAAAGCTCTCGTTCATCTGTAGGGAACCTATT CCTTCCACCTTCTCCTCTTCTTTTCCCTTACTCCAATCAATTAATCAAAA TTCTTTACTTTTCATATAAAACGTTGTTCTTTTTGGGCTGTCTTTTTATA AGAGTTAATCACAGCGGTATAGAGCTAGCGAGAGTGGTGGTCTAGTCTAG ATTCTGTTTCATTATTCGCTAAAAATGAGGACTCCTCTTTACAATTTCTC ATTAGTTAGAGCACACAGTCTGGTCAATTAAAGTGCGATGGCCAAGTGGT CAAAGGCGTCAGCGTCTCAAACCAGGGATTCGTCGTTCGAGTCCCCGCCC CTTACTGCAATGTTCCGTTCAATTCATAGATAGCCGAGCCGGCTGGCCGT GGAACTTGTCAAAACATTGAAAGACTGGCTAAAATTCCTAGATTACTGGG CTATCTACGTAAAATATCGACTCTATTTATCCATAAATAATAAGCACGCA ACCAAAAAATCTTGAACCATCAACATAAATCACTTTTCTCGAAATGGTAT GAAATGATAATTACGGCCCTCGCTTTCAAAAAGTTGTTATCCCATAATAC TTCAACGTCAACAGACAAAATAAGTTTTTTCTTTTGTATCAAAATTAATA ACGGTCTTTTTGGGAATACATATTAAAAATGTGTAAATGATATTTTAAAG TAATTTATTCTTTTTGAAAACGAGGCCCGCAATGATTTTGATATATCTGG AGAACTTTTCCTCGAATTGTTTCGTTCATAACTTCATATCTTCTCTATCC AACGGTTGTCTTCTATCTTTAAATATTTAACAAAATACGTGTCCTATCTC TCTCATTTCATGTCATAACTAAACATCACTAAGGCAATACCACCAGTTTT GTCAATACCATACTTCACTTTCGAGAGCAACAATATTGACTTTATTTTCA AGAAAGTTTCTCCTATAACTATACGCTTTTTCCTGCTAATACACTGATGA TCCGAATCTTTAGCTTTTCTTCTTCTATTTCTTTTGCTTTAATTTCCATC TCCTATCATTCTTGTCTATTTCTTCATATCATACTTTCTATCTTTATAAT TCTGTTTTTTTTTTCTTCCTTTTCTTTTTTCACGAGAGTACAGTACTTTA CAATATTAAGAAAATAAATGAAGAATAGTAAATGGAAGTTGGATTGCATT TCGTACTGAAAGCCCCTGAAAATGTAGCCTAGTTAACTAAGCCCGTATTC ACAAGGCTAGGACACAGGGCTAATTGCATAATAGTGTTTTCGGTGCTTTA AAGATTTTTTATATTTACGGATTTTTAAGTTTGCCTTTATTCAGTCACAA CTTACCATCAAATTTATCCTGGTGACTGGATCAAACTAGCTCAGATTTCT AGGCTACTGAAAATGTTTTCTGCTTAATAAGTAGATAAATCTATATTGTA CTATCAGGAATCAGTGTACATTTACGGCCAAGCGACGTTTCACCCGACCC CTGTATCTCAGCTCCCCAGATGTACATCTCTCCTTCTTAGAATCTCAGCT TCTCAAACTCGAATCTCTGTCTTCTCGAACCTTTAATTTTGCTTCTCTGC TTTTTATAAATGCATATCTTCTTTACAGATTTCAAATTTTAAGTTCTTGG CAGAATTTATCAAAAATGTACCATAATGAAAAAGACAATTAACCTCAATA TCTCTAAAGACAGAAAATAACATCTACAAAGGAGAGTGGCTGAGATTCAA AGAAGTATAAAAGTTGAGAAGTTGATTTGGCCGCAAAAGCACACTCATTC ACTTCTTCTTCATTGGTTTATAGGTCACCTTTTCAACAAAGAGTCAAACT TTTCATACACGCTTTTTTTTTATAAGAATACACTTTATAAGAATGTCCAT GTTGAAAATGGCCAAAAAATTAAGAATATGCTAAGAATATCACCATATGG AATTTTGCTACTCAAGCTAATAATGCCATTTTTAGAGCATTTTCAATTAT TAATTGTCAATGTCAAATAGTAAGGCTCACTCCTTTCACAAAAATGCCAT CTTATGCTTGAGACGTTGTACTAAATGTTAAATCTAGTTTGAATTAGGAC CCTAACCTAAGAATATGCTGTAAGAATATTTTAGGATGATTTTCCCAAAA AGTTAAGAATATCCATGATGAAATGGATTTACACCGCATTCTCATACAAA AAAAGCGTGTACTGTAGTGCAATGTAGATTTTGGTGACGTTGTTGATCTT TTAAAGTCTGTGGGAAAAACAAAATCTTTACCTTCGGTACAAAATTCTAG GAAACCATTTTGCCCTTCTACAAAATCAAAATATCTTCAGTGTTAAAAGC TCTCTTGTCTCAGATTAACCTTTCAAAGCTGCTAACTTTTTGGACCTACC CCGGTGGGGTGGAGGTCCTATAAATTAACCCGTGTTCGTTAGTTAGTTAG TTAGTTAGTTCGTTCGTTAGTTACCAACTTTTCTCGNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCATCATTTTTTT CTGGAAATTTATTCTTTCAAAGGCAATTTCTCGACCAGGACAAATGATTC AGGTATCAACTTTGGTATCGTTGGAAAGCTCTTTTTCTCAGCTACAAAAA ATAGTAGCTTTTTTTCTCTGAATCTCAAGTGGTCAGGAGTTATGACCAAA AGACTGTGTATCGGTAAAATGACCTTTTCAAAACGTATACATACGTCTTT CGCCTCCTAAGGGTTAAGTAGTCAATGAGTTCCGGTAGGACCAACGTGTA TTTTACAGACCGGTCTGCGAAGTACNTTCTACGTAAACATTTAGTCACGA AACATTAAGTATGTCTATCGCATGGTGGCTGCCTTTCTCAATGGCATGAC CCATAAAACCAATATTTTCCGTCTCAAAGTGAGGTTTAAAAAGATACTTT CTTCTTTCAAACTTGAATGTAATTTTTGAGCCTAATTCAAAGAATCTGGA CTAACTTGTTATGCTAATGGAGGTATAAGCTGTTACTCAATGAAACTGTG TAGAGAAACTGCCTTTCTGATCAAATCTTTGAGTTATTACAACCATTAGG AACTTTCTTTCCTTAAGAATTAATTTGAATTCATATAGTAATTAAATCCA AGTCCTAGTTCTTCAAAAACCTAATACCATTTTCTCGACCATACGCTTGA TACCTCTAATTAATATAAAGCGAAATAAAGGTGAAACCGGCTATAATATA GTGCTAATTTCCCTATAAATACTCATTGTTGTACATATAAAAAGCGAGCT TTTGGGCTGGACTTACAATAATGTTGGCATCACCTGACTGACCCTACCTC GAAACTTACCCACCCACAAAATGTTATTGCCATTTTAAAGAAAATGTTTT TTCTTTAACTTCTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCA GCGGACCCTCAATTCACGCAATCACGCAATTTTTTTTCGAAAGTCACGCA TTCACGAAAATTTTCCTCGAGTTTCACGCAATAACCCGATTTTTCAGAAA TCGGAAAATTTCTTGGGAAAATCGGGAAAACTGCACATAATCGGTGGAAA AAAGGGAAAATTCACGTATTCACGTACAAAATAGCCCAGATTCACGCATT TACGCAATCAAAAAATACATTTTCACGTTCACGCAAGTTTTTTCAATTCA CGCATTAACGCATTTTTTCTTCAATTTTCACGCATTCACGCAACCGAAAA TGCCCATTCACGCAATCACGCAAACTGCTGGGGGGGGCCCTTTAACTCTT TTGTGTTTGTCTCGTACTATCTTAAGCTTAATAATCGTCTAAAAATTATC CAAATGTGAATCAAACTTTCAAAAATGAAAAGCTTTTTTCAACCGTCCGG CCCACTTTCAAAATCTAGGGTTTAAAGCTTATAGATCTGATAGCTTTAGC TTTATAAGTCCAGCCTTATTAAGTGCACAATTAAATTCTTTCGAAGAATT TGCTAACAATTTTGAGTAAAAATATCCTTTTTACCATCCTTGAAACTTCC CTCAAATATACCATTCCTCTTTAGGACTTTTTCTTTAATTTTCTACTCCT TCACATAGAAGAAGAAGTATTTTTTCGAGCTGTTATCTCGGACATCTATA TTTATGGCTAAACTTTCTATTGAGAAGATAGCAGTTGTAGTTTATCGTCT GTACTTTACAATTTCATCTTCNATTGAGAAGATAGCAGTTGTAGTTCTAT CGTCTGTACTTTACAATTTCATCTTCTTTTCTTTTAATCCCCTAAAATAT TTCCTTTTCCTCTATAACTTTGACGTAAAGTGAAAAATCTGCTCTTTTTT TAGGTTAGCGCTTTCCAAAAAGCTTTTTGAAAGTTACATGGAACTGCACA CATGTTGGTCATAAACTATCGTGTCGNAGGTTAGCAGAGGTTAGCGCTTT CCAAAAAGCTTTTTGAAAGTTACACGGAACTGCACACATGTTGGTCATAA ACTATCGTGTCGTATATAGTGTTTTATATAAGATATATGTGATTATCTGG TTGAATTTCAGTGTTTTCCAATGATAAATTCACTATAATTTGGGAACTTC CTTGTAAATTTTTAAAACCGTTTTTTTATTAGAAAGACGATCACGTGCGT GTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAGTAAGTAAAA CCGTTCATTTCAAATCCCCGAGGGGATAAGACCCGAAACTCAAGGATGGG AAATGAAGTCATATATTTCCCATCCAGAACACGTGATCCGTGTGTTTTTC AAACAAAATTTCTAAATGCGGGGCAAACTTCAGGGGCAAGGCTTCACTTT TTCTTCCTTAAGAAAAGTTGAAGATTCCTCTCTAGCCCCTTAGGCTTCAA ACTCAATGAGCAAAAATACAAATCGTTTAACCCTATCTGCCCATCCCCCC CATTTTCCCTATAACTTTTGAATCGCTGAACGAAACTTTCTAAAACTTCT TGATTTAACTAGTTTAAAGTTTCAAATAAATCGAAGATTCCATGTCAGCC ACAGCGGCTGTTTTTTCAACGGTAACCGCCCATTCCGCCAAAATGACAAA ATCAATAAATGGCCATAAAATCTGAACCAGTTATCAAAATGATCTGAAAT TTTATACAGTGACTTGCTATCGGATATAGAACAAAACTGCATAAAAAGAT TTCCATGAACAAACTGTTCAAGACAGGCCGTTATCTGACACCCAGTCGCA GAAATCTTCATCCGATACGCTAAAGCTCTGAAGGTCGGGAAAAATTTTCA ACATCTGGAAGGTTTTACTTTACGGAATTTCGCAAGACTGCGTCAAGGAT TTTGCAGGGGGAGGCCTGGTAACCCAGCCCTCATCTAGGATTGACAGGTC CAACCGAAATATTTTTAGGTTTACGCACGAGGGTTGTTGAACCCGACTGA GGACGCGGCATCAAATGCTGACTACCAATCATCTCTGTAGAGAAATTGGC CCGATCCCTTAGGGCTTAAGCCTGGGCAGCCGCCATTCCGCCATCGGAAT ATCTGATGAGACAGGCCGATAGCCGATTTCAAATTTTTCGGTCTCAATGC CACCATTATGAAACTTTTGTGTATTTTATAACAATTCTATAACTAAAAAC TATTTCTGTACCAATCTGTAGGAAATCTCAGCTCATCCGAAATTTTTCGA TTAGCAGAATTTGAGCGCACGTTTCACTTCGCACACTTCATATCATTTTT TTCAATATAATAAAATCTCCACCTGAAAATCTTTTACCTCAATTTCAAAG TGAATGCTATTTTTCACGTTTTTTTTCTTCAAAGATTTCTTTAAAAATGG CCCTTTTTGATGACGTCATTATCAGGGTCGAATTTGAACTATTCGATCCT TATATCGAGTTTACTTGAAAAGTGGTCATGTTCATCATCAGTCTTTATCT CTCACTTTGAATCAGCCTTTAGCTCAGAAAACTATTTTTACGACTAAGAA AATCATATGAAATTGTCGCAGATGTAGTTTCTGTGATCAAACTTTTTTTA TCCACTCAATAAGAATAAGACAAACGGAAGCTTAATAATTGCCACATAAA ACTTCGTTCAGAAAGCAGTGTTGCAACTTTTCCGTCTGTAGACGGATATC CGTTCAGTTGAGATACAAATATATCATTTCCGTCTTGCCAGTAAGAGGGT TTTTGGTTCAAATGACCATCTAATCCTAATAGTCCGGGAGCTGGGGGAGG TCAACTATGACAGTCGTAGAGGCACAGTCAAACATATATCGTCATATAAC ACTATGTCTGAAGTTTCCGAATTTACTTGTTTGCCGTCCGAAATTTTCTT GTAGGTGTCTATTTTACGGACCAGAACACAAAAATTCCGAAATTTTTTTG ACGTCAACCGTCATTACTAAATCTCTTATTTCGTAAAAAAAGTACCATGC TTAATAATGTAATCAAAAAACTAACGTCAAAAATACAATTGACGCTCTCT AATTTGATTTTCAAGAGGAATTGGATTTTCATCGAATACGGGAGCGTATC GAATAGTGGGGAGTCTCCCTAATCCGATAAACACGAGGTAAATATCGAAT AATAGAGCTATTTAGTAATGACGGTTGACGTCAAAACAATTTCGGAATTT TTGCGGCATACAAGTAAATTCGGAAACTTCAGACTGGCATAGTGCTATAT GATGATATATGTTTGATTGTGCCTCTACGACTGTCATAGTTGACCTCCCC CAGCTCCCGGACTATAAGGTTTCCGTCCATATTCACAAAACCTATTTGCA ACACTGAGAAAGTCAAAAAGTTCATCAGGGGTTGCAGATTCTTTGTCTGC TGTATCAACAAAACAATCACCTCTTCTATGATTTTTTTGTTTATTTTGAT TTTTTTAACGCTTGATAATAATCTGGATTAGAGTCATTAAAGTTTAGTCC GCCAACTTTTCACGGAGCAATGACCTTTAGAACCAATACATTCCGTGCCC AGTAATTAGGATCTGCTCGGAGATTAATAACCATCGTTTAACGGGTTTTC TATTAACTTTTATCAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATT TGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGT ATAAATGCTGTGGTGAGTTTACTTTCGTTTCCTACCCACTTTGAACATGC TTTATTTCTATCCTAAGATAGCTGAATTTTTACCCATTGGTAAATCGAAT TGGGTGATTTTTTGGGGCTTATACTCAAATCCATAACCATCTAAATAATA ACTTAGCGGCCGTAGCACGAAGGTTGAGTATCCGGCTACGGTGTGCAATG TTGTGCTCAAACCCAAGCCAGGTCATCCAAAGATTCTGAAATTGTACTCT GCTTGATGTTCTCCAGATAATGAGAAGGTTCAAGGGTGAGTGGAGAAATC CAGTGAGAAAGGACACTTCCCTTACCTTTGGGTAAGCAGCTGAGGAAAAG GGATTTTTCGGCTCGCACTCGACTGCAGTCGCAAACTTACTCACTACTGA ATACTACAGTAGAGTTTCAGTAACTTGAACACGCACGGGGAACACAAATT TGTTTGAGTTGTAATAATGTGATGCCGGCCCAGGCCTTGGTCGACACCAC ACTATTAACGGGTGGAGGACTAGTCCAGACATCAAACAGAGAAGGGGAAA CTGTACGTATTTCTGTGCTAGCTATATCTTACATTCAAATAAACTGTTAC CTTATACATACGCCATCAGAAACCCACCACTCCACTTCAGGTCCGAAACT AAACTCCCAGATCAGGCGATCTGAGCAAAGCAAAACACTCAGCCGTAACG AGGGCGTTACGGGCGTGAAGGGTGGTTTCTGGGCGTAGTACAGAGGCTAT AGAATCGCCTCTGTACAGAGTTAAGGAAATTTCGAGTTATGAAAAGTATA GTAAGGTTTATAAAGTTATTGTTAAGTAAAGGGACCATAAAACTTGTTCG GAGACATCCAAGTTATAGAAGTTCGAGTTAAAGAAAAATTTATGTGCTTA CTTGCGACTATAACTTTATATCGTTTGTCTCCAATTGCTTTCTTTCAGGA ATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATA TGCTGGTCAACGTTTGGAATTGGAAGGTGATTCTTCTACTGAACTAAACG CTTAAATGTTATTAACCGGCGATGTTTTGAAAGAGATCAAAATATCGTAA AAAAGAGTTGATTTTTTGTTCGTAATTTTGCAACCCGTTTCTTTTAGTTT AACCAATCAGCAAAGCACTTTCAGTGACATTTTACGAAAAAATAATTTTG TTATCCGAAATGGAAGTCAAATTGTGTTAGGTAGTTCATGGGGCGCGTAT AACAACCACTTTCCGGTTGTTGAAGGGCGGGCAACGTATGATTGGTCGGG AAAAGTATTATGGTGAATTGTCGAAATTTGATTGACTGCTTTCATTTTCC CTTTGCTTTACTCATGGAGGATATTGTCATGGAAACGCGGTGTTAACCAA AAAAATATCAAACCTTACATTACTGTGCCATAGTGAAAGCACACATAAAA TTGTGTTTGAAAATATAAAAAGTTTCTTGATACTTTTGGGATCGACTGCG ATAACAAGAATTTGAGGAGGTGTGGCATATTGTTACTGGAGACTTTCAAT GACTTTTTTTTGCTTCATTTTTTCTCCTTAGCTTGGTCATACTGTTGCTT GCAATAAATCTGGATGTCGGGTAAAGAATTACTTGACACTTCATACTTTT TTCGCTCATTCTATACTTCTATCCAGTGATACACCAGTATCTATTTGGTT ACTGTTTATTCAAGGATTTTTCTGGAACAGTATTATTAGTACAGTTGATT TGGTTCTTTTTATCGATGCATATATCAACCTTTAGCGGCTCGGTCGGCTT TTGTAGGCGACTGGTAATGAATTTACGAGGGACTCGGACATTTTTTCTCA GCGCACAGTATTTACGGAAAGTCATGGAAAGTCCTGGATTCTGATTAGAG TTTCTGAGTGGCCACCTTGTAGCTTAAGCCAGGCAAATTTCCTCAAAAAC TCTTACAGGGATTTTCCAGAGTCTCTGTGGTAGAGTGCAAACAATTTTTA GCATTCGAATAAATTCACTATATTGACGTTACTTTATCGCTTCAATGCAA GGGTATCTTTCACATTTTTCACAAGAGCCCTCCTACACCGTCGTCGAGAA GAATTTTCCTTGTATTTTTCTTACCAGTCTCCCCAAAAGCACTAAGGATT GATAGGTTGATATAGCAGATTAATTTTGCTATTTTAAAAAAAACTCAGTT ATAGAAAATCAAGGAATATATTTACCACAATAAACTAATTTCTTAATCCA TTTATCATCTAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACT TGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAA GCTATATCGAAAGTAAGTCTCCAAGTCTTTTAATTTACAAGGAAAAACGA AAAAAGAAGGTAGGCGTAACTAGGCTGCACGCATCACCTCTGATATGTTT TGATATATGTGGGGATGCATAACATGTATGAAAATCTCATCCCTCGTGTT AATTTCAGGGGTATATTTTATCGAGCAAGCTGAGTGAACGTTACGCTTTC TGTGTTTAGAATTATCTTTCTTGAGTGTGTCTTTATCAGTCTAAAAAAGA TTGTTAAGTGGCAATGAAGTGATTATAGGTTGAAACAGGTTACTCCAAAT TTTATACATTGCATATATCAAAATCAATTTCGGGGATACACCCGGTCTAA GACGTTACCGGTAGGGAAAGTTCTTATCATTTTTGTCCGTCACCAATCTC TCCTCCAAATAGAGTTTCAAAGCAAAAATAAGACGAAATAAAGCGAATTT GCTGATTCTGTGTGACATTACCAAAACGTTTTTGAACTAGGAGTTACGAG ACAATTTCGGGTTATAAAAGGGGATTAAACTGCTTTTATCTGTTTTTATT TCTTCTTGCATGCACTTTAATAAATTTACAAACTCCAAAATCTTGATTTT AAATCTCTTCGACTGCTTTTTGGACTATTTTGCACTATTTTACACTAATT TGATTTTCAATTCCAATATTGATCATTTTAAAGTTACAATTGAAACCGAT TCGGTTTTTTAAATATCGTTTCCTTTCGTGATGTTTTTCTCATCGCAAAC GCCCAGAATAACGATAATCCACCTCTAGAATAAAAATGCACAGATCTTAT TTCGATTTAGGAATCATAATAATAAACTTTTGGATGAATAATAACTAAAC TGTTTAAAAGCTATTTTCATAGCAAGGTCAAGTCGATCTTCCTTATTTTC CGTTAAAATGAAATTTCTCTTTTGAAGTCTTTTATTTATAGGAATCGGTT TATTTTGGCTTGGGTTTTGGTTGTTCTTAATATATTTTTTCTCAAAAATT TAACTTGTTTTCAATACCATTATATTATTTCAGTTTAAACCACAATTTTA TTTGTAATTTTTGAAATTTAAGTCCAAATTGTTCTTGAGTTTATTTATCC GTAAGTTTCTCTGCAAATCTCAGCTCCGTGTCCTTGTAAAATCGTTCTTA TAAACCGCGTATTTCTTCTCAATCTATAAGGGCAATGCACCGATCACTCC CATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCA CAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTC ACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAA ATGGGTCGAACTGAAGGTAATTGTCACTTTTTATTGTTCGATAAAGTCCT ACTCTTGTTCTTAGCGACCGTAGTGTAAAGGTACATGTTCTTGTTATAAA CGTACAAAAATCTGGCTCGGAGATGCTTAGATTGAGGGATTGACAACGCT GAAAAATGCTTATATTCTGAGGAATATTTTAGGGAAATTTCGAAAATCCG TAAAATTTAAGCCAAAGACAGCCAAAATCGGGAAATATAGGCTGAAGATA ATGCTTAGCGTGTGCTTGATTTTTGCCATATCTGAGCCTAGATGTGCTTA TAAGTGCAATACTTATAAAAAAACATTAGAGTATCCTGCTACGTTGCACA AGGTCTTGGGTTCAGTTCCTGACTGGATAATACCAAAAGCTTCCTTCTTA GTACAAAAATGGTACTTGATATCTTTCTGCTTGAGTTCAGTAATTAAGGG AAGGATAAAGGGTAAGCAAACAGTCCAAGGAGGTACCTGTAAACTTGTTC TAATTAAGGAGATATTCGAGTAACAGATGTTCGAGTTATGAAGACTCTGC CTTATATTGTTTTTCCACATTTTCTTACAGGCTGGTAGTGCAAATTGCTT AGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAA GGTATGTTTTACTCAAAAATCGATTAAAATGATTCGATTCATCGTTAAAG ATTGGCAAACTGGGGTTTTCTGAACCGTTTTCGTTTTCTAAAAAATATTG AAGATTTTATTCTTTATGAAACGATTGTATAAGTTTAAGTGCAGACTTGG AATCAGTTTTGGCCGGGAAGGAGAAAAGAAATTGGTATTCTCATTACTTT TATAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAG GCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGTAAG GCGATTTTCTAAAGTGTTTTCCCGTTATGTCAAAGACAGTTTCAACTTTC GAAATATCCATACCTTTCATTTTTGAGCAGTCACAAAGTTATATAAGCAT GTTAGCCTTTTGCCCCAAACTGTCTGGCCTATACTGTATTCTCTCAGTAC AACATTTGACGTTGTTTTCACGTCTTTTGCACCAGTTGGGATGAAACACT ACTGTCGACAGTCACTCTATTGATTAGAGCTATATTTCATACCACGTAAT CAAGGCGAAAGCTTCTTTTCTCACCCACGGAAAGCCAAGACCATATCGCG GTTCCGTTCTTCAGTTCTATTGGCTAATTGAAACACTCACCTAAATTATA ACCAATAGAGTGGCCTCATTTCGTATCATAACAGATCGGAACCGTAATGG TAACCAGTTAAAATGTCTTACGTCCACATAATGGATAAGTGGAACTTATT CGCTGTTTATATGTTTTTTTCTTCAGCGATTTGGTTCATGTTTCGAACAA GAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGG TATTTCTTATTTCTTGGACCGTTTTAAAGGTTCACTTTTTCATTAAAGTG TTCCCGTTTCATATCAGGACCGTGTCTTGTATTGTGCTGAATAAACAAAA AATTGTTTCTCTTTCCTCTTTTTGACCAATCTTGCTCCACGTCCGTGTCA ATTCAATACGAAAAAGCTTGTTAATTAAAAGTTGATGAGTAAGCAAACGA TATCACTCTTATTTAAAAACAAATCCTTCAATTTCATTATGAGAACCGTC GTAATTGAAAACTCAACATACTCAAAGTCTGTTCTTATTCTCTTGAATCT CATGATTTTCGAATTAGGCTCGAAATTTCTGAAAACTGTTCTTAGTCTTT TTATTAAATCATTCTCATGTTCTTATAAAAATACATATCCCATGGGAAAA ACATCTATCACTCTACCAATGTTATTATACTTCTTTATTATGTTTTCTAG ATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAA TATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTA TTTGGGGCGTGGAGGTTTGTATTTCAAACACGTTGTTTTTTTATTAGAGC ATCCTTAACTGGCTGAGCCTGGATGTGCTTTTTTTTCGACAATTTCGAGC CTAAAAATGTTCTTAACGTGTTCTTATTTTCGCCATTTTTCGAGTATTTT TGTGCATTTTCCTATGAAATTCGGTGTTCTAGAGACCCAAAGCCTTAGAA TGTTCTTAACTTGTTCTCAACAATTTTTGGCCATCGAAGCCTTATGTTTT TATATAGTTTGTTCGCATAAAAAAACCTGTATCCAGTGCCTCTTCTTCTT CTGTGTTAGTTTTAATGTCAAGTAAACTCCATAGTTGTCCCAATTTTAGT GTGTTTATAATAAATCGAGCTACTGTATGCCAAAATTCAACTCGCGTGAT AAATTTAAGCACGGTTTAAGAAAGGTTGAAATTAAAAATAAGTTTAAGAT AAATAAATTGAAACTGAAGTACGAAAATATATGGTAAAAACATAAGATGG GTATCTTTTTAAAAAGGCGTCGAATTAGAAAACGCCGTCCCAATTTTAGT GTTTTCATAATAGATCGGGCTATACCAAAATTCAACTCATGGTTTAAAAA AGGTTGAAATTAAAAATAAGTTTAAGATAAATAAATTGAAACTAAAATAC GAAAATATATGGGAAAAATATAAGTAGGGTATCTTTTTAAAAAGGCGTCG AATTAGAAAAAAAAATTATAGTACGTGTTAATTTCACTTGTGAAGTATGA AGCTCACTTCATCAAGAAAAAGTTTCATAACTCGAACTTGAATGGCAACA ATATTTTGCATTTCAGCTTACGTGTTAATAGATGAAATACGTTTTTCCCA TAAATAGTCCTTTGTATCGAGGTTACGTGTCAAAATCAATGAAATTTTGA AGGGCGTTCGATAATTCGTTTCGTCGAAACTGATTGAGGTCCCAGTATGT TAAAACATCGTCTTTAAAATAAGATGGAATTACAATATCTAAAGAAAGGA ATAGTTATAAATTTCGAGAACATTTTAGGCTGAAATTTTGAAGAAAAAAT AAGAACATCGCAAGAGCCTGGCCAAGCTGATAATGAAAAAATGAGCCGAA TCTGCTGATAATGATCTGAATTTACGAGAGAATTTCGTAATTGCAATAAT TCTTTTACTACCCAAATTTAAATTAGAGCAGATAAGATCAACTTTAGGGC CAATTTTTTATTACCGAAGGCCAAATGATTTTATTGCAAGAACGCAAATA TAAACATTTTAGGCTCAAAATTGTCAAAAAATAAAGCACATCCAGGCTCA GCCAAAATTAAGACACTAAGAGGTACTGGGTTAGGTGACTTAAATTTTCC CCGACGAAAATCCCCACTATAATCATGAGCTTGTTAATAACATTTTTTTA CTAGGAGGTAAAGAAAACTCACCGTACTTTTTATACCTTCTAGTAAATTG TTATCTTTCGATAAGATTTTTTCTTGGTTTCAACTTGAAGTAAGTTCATT TTTCTTCCGTCTTGACAGATCACCATCTCAGTCAGGTGCAAAAAGTTGAA ATATCAGTCTTAAAATTTAGCCGAGTTCTAAGAAACTTGGAATCAAAATT CGTTGTTTAAACTCTTCATTGACCTGTATAAACCTTTATATTTTCAGACT TATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTT CTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGACAG GTTGAACCCCCTTATTATCTCAAAAGAGCTTTACAATATCAATGAATTAT TTGAAAATCCTGATTAAAGTCTAAGGCAGTATTTTTGTTTTCTCTCCACG CTCAACGGTTGACTAAAAGTCCAAGATTAAAATGTTATAAGCTATGGATC GATTTCCCGGAAAAAGCTTTTTTACGCTTTTGTGGGAAATTTTTTTTTTA CATGCAATATTGATTTATTTGGCATTGATTTTACGAATAACTCAAATCAG AATATTCCGCGCCCAAATTAGGTTTTTTACTGTCTTTCAAATGTCACAAT GTCAAAAATCCTATCCTATTGTTTTTTATCAGGGAACACACAAGTCAAGA TGTACCCCCGTAATTTGTACAGTAAGGTAAATCAATTAAGAGCTTGAATG CTTTTCGATGGGAATACAATGAAGTTACATTGCTTTATTAATCAGATGCC CCTAGAGGAGGTTGATTCATTGAAAGATTAAGGGCTCGTTCTACTAAGAA AAACGTATCAAATGTTATATTATTTTCAAATCGTTTTTGAATCGTTTGTA TCGTATATTTTTTTACAATTTGAGCTTTTTACCTGCGATGTGAAATCTAT AAGGACATTTTTAATTATCAAGCGGAAACCACATGTTAATCCTTGCGCTA AAATGGAAATCTATAAGGGGATTGGGCTCTAGTTAACCAGTGTAATCGAT TAACGTCAAACTTTTCAAGTAACAGACACCGACATCCAGCACCATCTCAA TCTTGGTAAATTTGAACCCATTCCCTTTAGAGCTTTTTAGGGTTGAAAGA TGTAGTCTTCTAAAAACTAATATCTTTCTTTATAAAAGGAACTTTTGAAA ATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGC ACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAA TCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTG AGGTAGGTTTGGACGAGCCGTCTTTAATGGGAACATATAGTGTCATTCGA GAAAACAATTCCCCGCAAGATCTTAAAATTTGGCGGGATGAGCTTTTAAC CGCAGGCAAAAACTCTCCGAGAAATTTTACTACCCCGATGTTTGCTTTAA AAATAAGAAGGACCAGAGCCTTATTTCATTCGTCGAAACTTTTCCTGAAA ATTATGTTGTTTTCTTGAGTAGGAAAATACACATACACTGTAGGAAATAA CAAGTCCATTACGATGTGTTTCGAGTCAAAAAACTTCAATTTTCACAGGA AGTCTTTTTACTAAAGACAAGAACAGAAAATTTGTGGTAAAAGGATTTGT TCTATTTTGCCAAAATAGAAAGTAGACTTGCGAATACCGTATGGAGTCCT ATGATCAAAAAAAGTTTTTGATAATAATAATTCTGCAATTTAGAAGTGTT ATTATAATTTACGCACATTGCAGTAGCTCCTCTTTTCTTGTTGCCCCAAG TAATTTACCACCAAAATTTGGTCTCGAATGCCAGAGAGCTATCACAATAA ATACTCTGAAAAATGAAAACAGAATCGAGAATCTGTAAGGATACAGATTC TCCACAAGTCTCCACAACTCGAGCGCCGAGGGGGAGCAATAATCGTTTGA TTTATGAGAGTTCGGGCTATAGAGACGTAACGATCAAGTCAAAAGGTCCC CTAAAGGCGCCAGGAAAACGGTTCTAGAAACGAAGACCTTCAAGCTTAAA GAGACTACTCTATTTGACTAAGCTTATACTATCTGACGATAATTTACAAA TTAGTTTTGCTGTAAACTTGCCATTAGTTATAGAGAAATAGCGAATACAT ACGTGTTTGTACAATGTAATGCGAACGTAGGGTAAAAGAAGAGCTTTCGG CTACGGTGTGCAAAGTCTTTGGTTCAATTCCCGGTCGGATCATACCAAAA ACTTTGTAGGGTAGGTGGAGCAATGTAGAGAAACAGTGGTGCCCTCTTCT TCCTTCGGGTAGATAGCTACCAAAAGAGGAGCCTTCGGGTTGCCTCTGTG GTCGCAGACTTACTCACTTACATTTGATTTATCTCATAGGATTTACTCTT TGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATT CTATGTGTAGAATTTTCTCCGGAAGAATCGGGTAAGGTTTTCAACTATAT CTTGACCTCGGCGTTGTGTTCGGTAACGGATACTTTAATGAGATAAATTT TCGCAGGGATTAAATTTCGCAGATTTTGGTGTCATCCGCAAAATACTTTT GAACAAAACTCAAAAGATATCAAATAACTACTATTAAAATGTTATCAAAG AAGACATCGAAGAAGCGCTAATAATGCGTATTTCAACAACCAGTATGTAT AATTTGGCAGTACATAAAAAGAGACAAAATCATGAAAATATTGTCTCCCA ATAATACCATCCGCGAAATTAAGTCTCCGCGAAATCTTAAAATTAAAGTG TTTTTTTTTAGATAAAAGAGTGATTCTGAATTTATAATGGAGAGTGTTAG CCCTCACTCAGGAACGTGGGTTGAGTTTATAAATTAGATTAAGCGCCTGT GCTTTGCTAGACCAGTTTTAAGTTTTGTAATTTGCTTTTAATAACGATCA TTTTAGGGTTTGATTAGAAGTTATATAGAAATTCCTTTAACTGTGTAATT CTAGACCCGACCAGCCCTTAAAGGTTTTGTTTTTTAATGAGAGTGTCGTT TGCATACTCATCAATTTTAATTCATAAGCTTTTTTACATTGGATTGACAC GGATGTGGAGCAAGATTGGTCAGAAAGAGGGAAAGAAAAATATTTTCATG CTTATATCATCATAAAAAACAATCAGTAGATACTGTCCTGATATGAAATA TGTATCTGGTATGAAACGGTTAAATGTAAAAACACTTAACACTTAAATGT AAAAACAAAACCTTTAAATAAGGGAAACATATTTTCTTGTTTTTCTAAGG TTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTG ACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCC TCTATAACAGCTGTTCGATTCAACTGTAAGTATAAAAACACAGGGGATAG TAACCTCATTCAAAGAGTAAAAGTCCATACATAGGTCTTAGATGGAGATA ATATCGATGCTGTTCTGTGAGTGAAAACCCAAGGGAGGATAGTAACCTCA TTCAAAGGGAAAAAGACTGTTATTCTAAGATTGAAGTAGTATCAATACTG TTCGCTTCAACTGCAATTGCGAGTTGAAAACCATGGGAGATGGTCACTTT CACATTTCACATTCAAAGGGGAAAAATTCATAGTGTCAGGCAGTACCAAA GAGATTGTTGGTCGATGGTCTTTGGGTGTTAAAAAGGTATGTCTTGTATT GTGGTCTTGCTAGTTAAAATTCCAGGTGTATCCAAAAATTAGTGAAAAAT AGTCGTTTTAAAAAGTGGCTTCCTTTTGGCAAACATGTGTATACAATTTT CATCGAGATTATCCATTCATCATTTCTCTATCTTTTACGCAGATGATGAA AATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCA TACCGCCCAAACGGTAAGATATTTTATTTAACACCACGCGTTTGTACGTT ACTCTTTTTAATACCGGCCCTATAAAGTTAACGCTGGCCCTTGATCNTTA TTTAACACAACACGTGTGTACGTTATTTCTTTTTATACCGACCCTATAAA GTTAAGGCTGGCCCTTCGCCACTACCGAAAAAATAACGCTGAAGATGGCT AGGCTTGAAAAGGTCCAATAATAATGGGATTTTGTGTTACATCCACTGAT CTTTATATCTTTGATCGGAGTTTTTTTCGAATTGTTACCCGAGAAGAAGC CATTGCAATATTCAAAATTAACGTCTAACGGCGCTACATCAACAAAAATA TTCGTGGAAAAGTAGATCTAGCGCTCTCGATGCATTTTTTCCGCTATTTA GCAGTGCCGCCATTAGGGTACCAATTTCAAAAAAACTCCGATCAAATATT TTTGGTTGGCCGGGATTAAGTAACTTGGTCCAGGGATATATAAAGGTCAG TGGTTACATCTATCAATCCTTGTGAAGAAGTTTAGCCAGGGTAGAATGAT TTACACTCGAACCCAGCGCCCGAATAGCGTTAAGGAAGGAAGGTGTATAT AAACTGGCGGCTTTTTGTTGTTCGAAATAATTTTTTACTTGATCAAGGCT GGTTTCTCTAAATACAAGCTCTTGACATTTCGCATTAGTGGCATTGTCTA ATAAAAGCGAGTTTATGTATTTTTACTTTTGAGGACGGTGGAGTGACTGA AGCGATTAAAGGGACATAACAGTACTTGCGAAATTTGTAAACAAACTGTA TGCAGCGGATACAAAATCAAAACAAATGTCACATGTCAAAATAAAAAATC AAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNAAAAAATCAAACCAAATATGGCTAATTTTGATTGTT CAATTGTTTTACAAGTTTGTTTTGGACACGTGATTTCAATTGTTCTCTTT AATGACACGTGGTTCGAACAATGTCTACATTTTACTACTTTAATGTCCCT TTAAGATTTGGAAAAACCCGCAGTTTTGACTCGCAAAGTCATGGACGATA AAAGTGTTGATTTGCCGTCGTCCTCAGTCAGTCAGTCAGGATTTAGACAA ATTCGAACCCTACCGTCTCTGTCGTAGTAAAACACAGACTCACCCGGTAA AGTGTTCGGACCGGTTAACTGGTTCATTTTTTTCTTCATTGAGATGCATT TGCCGACTTGTCGATATCCTAAGAAGACCTAAAAGAAAGAATTGTTCTTT AAAAAATCCTTCAATTTCATTTATTTTGAAAAGTCGTTTCATTTCTGAGA TTTTCTCTGGGTTGTTAAAAAGGATTTGTGTGTGTAGGAAGTGCGAATGA AGTCGCTTTTACCTGAAAGTTAGATATCAATGAGCAATGAGTAGGATGAC TTTAGGGTGGTAAAATCTTTTCTCGCCGTGGGATTGGTTGATGTACTTCT TTATACTGTAGTTTAACCCTTAACACGAAACGATTGTTATTTGTAATGTA TTACAAAAGCTTCCTGTAATACATTAGCCTTACCAAGATTAACATAAGTT TAGATTATCTATCCATTATCTATCAATATTTTTTATATACTATTTAGCAA CCCGTAAACACGAGATAGGTTCGTGTAGTTGAGCACGTTTACTATAGACA GCCGAAGGTAAATTCGTGGACAAGATTTGCTTTCAATGTGAATTTACAGT CAGAAGGCTTTAATTATCGTTCGTTTCTTCAAACTACCCGGCAACTTACC CTCCCCTAGTGCCAAAACCGGCTGTAAACCCTGCGCTTACATTATATTTC CTGACTTTCTTACCGAATTTATGTATCGCAGGATGGATATCGAGGGCGAC AGTAAAGTGAAATCGATGCAAAACAATAGTTGATAGTTGATGTACGGCTC TATATCGCCTTTGCTCACCTTAACAGATGACGGTATTTTGATGTTTTTAC TGTCGTCGAGCAAAGTGGACGTTGATTTTGGCGACATTGTCAACTTTGCT TTATACCGTTTCCCTCGATTTATCTCGAATACATAAACTTGCTATTCCCT TCAACAACGAACAACAACAACATCATCGACTTGTTGTTGTTGTTTTTTGG GGCATTTTTGTTAATAAGGTAATCTAGTTAATAAGGCTATTTTCGTTTTT GAATCTATCTATCTATCTATNGCTTAGGAAAATGGACAAAAATGCTCAAA AAGTGGTTGAAAATAAGAACATGTTCAGAATATTTTTAGGCTTAAAATCA AAAAGTTAAGAACATCCGAAAGCTTCAAAAAAAATTTGGATATTTTTATA AAACAAACGTGTATTCAGTCATCAACCACTCTGGTCAATGCCAAAAATGT GGAAAAATAAAAAAATAAAAAATAAAATGATTTAAAAAAATGCGTTCATC ACTGGAAAAAAAAAACATTTTAATTTTCTACATATGTTAAATAAGCAAAT TGCCTAAATTTAAGCCCGGGGCCACTCAAGGTAAATGACCCACCACACGT GTGGCCCTTAAGGGTATATTTTCCAAGCTTACCAAAGTGCACTGTAAGGG TTGAAATCAGCAAAGATGAAAAAATTGCACTCTAAGGATGTAAGATTTCG AAAATCTGACCATATTTTGCCTGAAAATGATTTTCAGTTAAATGTACCGT AACAGTCGATTTTTGGCTCAAATTTGCTTTTATCTGTACTGTAGGGGTCC GATTTGGAAGGCCTAATTTTGGACCACACGTTTGGTCGTTTTTGAATCGA GTTCTTATTCAATCTATCTTCATCCATAAATTATGTAATCTCATGTTATT GTTGTAAAATTTTATGATCCTTATTTTCATCGTTTTTCTTCGTCTTTACA TTTGCGTGTTCATTTCTATCCTTTCATCATTTCATTCCATTGTCTTTCTT GTTGCTATATTAGTAACTACCCTGGTCCTCCCTCTCTCTCTCTCTCTCTC TTTTTCTCTCTCATGCTTGCATCTATTATATGTTATATTTTTCGTTCAAC TTTTGCAGTGATAAAAGCCTCATTTAAGAAGAACAAAAAGAGAAAATCAT TTCTCTCGCATTTTGATGGTGATTGGATGCTACCGGGCCTATAAAAAGGT TTCATCGGTTTAAATGCAGTTTAAAAAGGAGTAGCTTTCGGTTGAATAAG ACTTTAAACATACTTTTGGATTTTTCGCCTCACGAAACATCTGCAAAGAA TAAGCTTTTAGAATAAAAGGACTGGAATCTCGAAATGATTCAAACGTACA CTATATTTCTAATCATCTTGATTTCGTTGGGGTCTATCTCAAACGGGTTG ATGGTTTACCATTGCGCGCGCCAGCTCAAGACACTGAAAAGTGCAATTTT ATTGAGCATGGCTGTCACAGACCTCTTACAATGTTTGATTGGATATATCT TACAAATGGTTATCAACGAAATTGTACAGAATGACAATTTATGTATCACC GCTGCCTTCTGTTTTGGTTTATGTGGTGTGGCATCTATCAATCATTTCCT GGTACTTTTCATCGAAAGAACCATACGTATAACTGGTTCAGGTCCTCTGA TCTCGAAACTGGATGACAAGAAGTATCACATACTTGCTGTTATATGGGCT TATTCCTTGTTTTGGACAGCCGCTCCTATCTTTGGGTGGGGTAGTTATCA AAGCAAAATCATCCTGGTACCGAACTGTCCCGTACGTGTCCCCTTCTTAT CGCTCTCACAAGAACTCCATTTGTACGGGATCATTATATTGGTGTTCGGG GTTGCTGTTCTTTCGATCGGTGGACTTTTCCTATACACGCAATCTGTTTT ATCCAGGAACTTGAACTCGATTACAAAGAAAAGTGAATACCCACAACCAC ATTTAGTGGCACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTTTTCTGATTTTTTGCACAAAGATGCGTATT AGCAATGCCCAAAACTTGGCTGAGTCCGATTTTTGAGAAAAAATCTTTAC CGGTCGAAAATGCCGGAAATATCCCGGAAATCGCCGTTTTTGCAGATTTT CATCGGAACTTTTCCTTATATTTCGTTGTTTTTTCACACAAAAACATTAT TGATAGCAATGCCCACCATCAAGCATGGTTTAATTGTCAATAAAAGTGAT TTTTGAAGCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACCGGAACA GCCGATTTTCGCCGGAAAAACGGTATTTCTTGAATTTCTCGAGCTGTACT TTCTATTTTTTCATGAAATTTTGCACACTGATGCAAAATGTCAATACCTA AATTGTGACGAAGCCTGATTTTCAATTAACGTACTTTTCCGGCCGAAAAT GCCGGAAATATGCCGGAAAAAACGGTTTTTTGGCATTTTCTCAAGATTTC ATCATAAGTTTTTTCTGATTTTTTGCACAAAGATGCGTATTAGCAATGCC CAAAACTTGGCTGAGTCCGATTTTTGAGAAAAAATCTTTACCGGTCGAAA ATGCCGGAAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCAAGATT CCATCATCAGTTTTTTCTGATTTTTTGCTCAAAGATGCGTATTAGCAATG CCCAAAACTTGGCTGAGTCCGATTTTTGAGAAAATGGTCGAAAATGCCTG AAATATGCCGGAAAAACCGGTTTTTTGGCATTTTCTCAAGATTCCATCAT CAGTTTTTTCTGATTTTTTGCTCAAAGATGCGTATTAACAAAGCCCAAAA CATGGCCGAGACCGATTTTTGAGAAAATGGTCGAAAATGCCTGAAATATG CCGGAAATCGCCGTTTTTCTAGATTTTCATTGGATTTTTTTCCTTATTAT TGGTTGTTTTTTCATTCAAATCCTGTTTTTTCATTGAAAAACATTATTAA TAGCAATGCCCACCATCAAGCATGTTTCAATTTTCAATAAAATTGATTTT TGAAGCCAGAACTATTTTAAAAGTCGCTGGAACAACCCATTTTCGCCGGA AGTCAGTATTTCTTGAATTTCTCGAGCTGTACTTTATATTTTTTTATGAA ATTTTGCACACTGACGCAATATGACAATACCTAAAATGTGACGGAGCCCN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAATGCTCACCATCAAG CATGATTCAATTGTCAATAAAACTGATTTTTGCGACCAGAACTTTCTATT TATTTTTTTCCCTACAACCCTTTCCTCTCCCCCTCTACCATCAATCAATG ATGAATTTCTTGCGTTATGCTTTCTGACTGATTTTTTTTCATTTTTCTCC TTGCACTGCTATCTAACTTTCATCATCAGGTAGGTCCATTCAGCATCTAG CTTGTTTTATATATGATAGGTTTTAAACGGAACAAATATACAAACACTAA AGGTTCCTAGCCTCCCGCTAAAAACCTTAGATTTTACCGCCATTGGGTAA GAACCAAAAAAAAAGAAACGAAAATCTGGAAGCAACAAAATTCCAATTTT TGACTTAGATTTCAAAATCAGCGTAAAAATTTAGCTTGAAATGTCAAATT CTTATTTATTCAATTCAAATAATTTATTCAATTCAAATAAGTTCCACCTG TTTTTTATTTTTTTGTAAAATCTGAGCGGGCTGAGAAAATATTTTTTAGT ACTGCGCATGCATAGTTTCACAGAAAAGCTAAATCTTAATTATTTCAAGA TGGCGGACGCTAGAGAAACCAAAGAAGTTGAAGAAAATGTAGGTTTGGAT GTTTTATTTATCCAAATTAAGCCATTAAAATATCCTAACTAGGATATAAA TTCTGACCTAATTAGGCGAACATCCTAGTTTGGCCATCATAGCCTAATTT GTAATAGTTCTTGACTGTTTAATCTTCGCACCATTGCCTTTTCAAGCAAG TGCAAATGCCAATTGTCTGAATCTGCGGTTCCTCTCGTACTGAGCAGAAA ACTCTCTAGATCTGCCCGACGCGAGTAAAATATTGAAATCCAATAGGCTC TTAGAATATGAATAAGAAAGATTTTACTTTTAAATTTTATCATTTGCATT TGGTACTGGGAATAAGCTAATCTTGCATAATTATTTTCATTCATCTATCA AGATTTCTAGTTCAAAGCATATGTCATTCTTGAGAGTTTGTTGGAGCCTC CGACCTCTCCCCCAAGATGCGTCCCCTTCTTTTTATAAAAATAGTGTTTT TCATTTTATCATGGATATTCTTAACTTTTTAGGGGAATTCATTCCAAAAT CAGTCCTAAATTTTACATGTAATACTCTCAGGTACTAATAGTTGCCCCCC CGCTAATAAATTTTTCGAAAATTTTCCACCCAGGACATTTTTATTCAACC CCCCCGCTTATTAAGTTTTGAGATTTTTTCCAACCCCCCTCCCCAACCCT GCTTATTCCAACTCCCCCCAGGGCCGGCGAATCAATTTTGAAAGTGGAGG GGCCAAATAGTAAGTGTCTAAGGAGGCGCCACCATGGTTGGTGCCGACGG GCCTTTCTTAGCAAAAAAGTGGGGGGGGCCGGGGCCCCCCCCCCCCCCCC CCCTCCCGCCCCCCCCCCCCCCCCCCGGGGGGGGGGGGGGCGGGGGGGGG GGGGGGGGGCCATGCCCCCCCCGGCCCCCCCAGTTTCGCCGGCCCTGCCC CCGCTGTTAGGTAGCCGAGAGTACGCACCTGAAGCATAAAATGGCATTTT TTGTGAAATGGGGGATAATTGGCAATTTACAGTTAAAAATGCTCTAAGAA ATGACATTCTTAGGTTGGTTCTGTTGTCATACTGCATGATGGTGATATTC TTAGCATATTCTTATTTTTTCGACAATCTTATCCCGGTAGAAATTGTTTT GAAAGTCTTTAGGTAACTTTAATTTCACAAACTCTTATAAGAGCAGATGT CCTGAACAACCATAGTTTTCTTTTTTACAGAACGAAAATGGTGTTTGCTT TGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGA TTGAGCCGACCAGGTATGTTGCCGTTAAAGGGGGACGCGACCACTGACCT TTATATATCACTGGACCAAGCTATATCCGCCATCTTTGATCGAAATTTTT TGAAACTTGGTACCCGTAAAGAAGCCATTGTAGTGTTTGATATTTTGCCT ACCGACAAACGGCGCTGCATGACTAGTGTACAAGCGAAATAATATCTAGC GCTCTCTCCGTGGGTACCAATTTCGAAAAACTCCAATCATGATATATAAA GGTCAGTGGACGTGACCTGAAGCTCCGTCTACTATTCTGATAGGAGGTTT TCAGTTTGACTAAGTTACGTAACTTACACCAATATATGAAAGCAAACGTT TGATCTGCATAAGGAAAGGCTTCACGAATTCGAAAGTTTTCTCTCTTATT TTCGGGTCGTCATTATCTTATATAACTCTTGTAAAGCCTATTTCCTTTCA TAGACAGGAATCCGCGTACTTTAAGTTTTTCAAGGATTTCCATCACCTAG TCTAGAAATTACTTCTGATTGAACTTTCCGTTTTTGAGGATTTTTAACAA GTGCAGCGAAGTATATAAGAGCACTTGGAGAGGTCGCGCCTTAGTCTCCC CAGCGGTAACTCTGATCACGATATTGTGCAATTTTTTGTCCTCAATCACG ATCACGTAAAACAACAAAAAAATTGGATAACCACGCATCCCTCTAAACAA TTCCAAATCACGCATCACGGCTAAAAAAAATTTAAATAACGATCACGTTT TGACCTCTGATCACGCAACCACTAAGAAAAAAATTCCAAATCACGTTATT AGGTTTGAAAAAAGTACCTATCACGACATCACGCAAACTGCTTGGAGGGC CTCTTTAAACTGAAAACAGCAAAATTTGAGATTTAGATACCAACACGAAT AACAGATTTTAAATTCCTTAATCTCAAATAAAAAAACATTGCTTCATCCG ATTTTTACCTTCAAAAAACAACTAGAATCTAAAGGAGATCTACCATATAC TACCGGGCCACTTAATCATACCACCCAGTCTATCAAAAAGTGGACCCCGG GCTACTCAATAACGAGCCTTGAAATAAAGAAGATATTCTTGTAGCATTAT AGCCTAGAGTTATCCCAGACTAACTAAAGCTGGTTGCAATTCAAATAGGA TCTCTTAAAACACAAAAATGAAACTGAGTTCCGCTCCCTTCCGTTTCCGT TCGAGAAAAGAGCGACGCTAAAACTTGACAAACCGATTGATTAAGTCAAA GCTTAATCATGATATGATAAGGTTGTGTATATTGGACCTACCCCGGTGGA GGTCCTATAAATTAACCTCTGTTCGTTCGTTCGTTCGTTACTAGCTTTTC TCGGGATTGGCTCATTAGTTTTTCCTAATTTTTGGCACAAAGATGCAAAA TGGTAATGCCCAAAATGTGACGGAGCNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTGAATTTCTTGCGTTATGCTTTCTGACTGATTTTTTTTCAT TTTTCTCCTTGCATTGCTATCTAACTTTCATCATCAGGTAGGTCCATTCA GCATCCAGCTTGTTTAACTTTTTTTGGACCTACCTCCGGGTACCCCGGTG GAGTTCCTTTAAATTAACCCATGTTCGTTCGTTCGTTCGTTCGTCTGTTA CCAGCTTTTCTCGGGATTGGCTCATTACTTTTTTCTGTTTTTTGGCACAA TGATGCAAAATGATGATTCCTAAAAAGTGACGGAGCCCGATTTTTCGAAA GCCAAAAATGCCGAAAATATGCGTATTAGCAATGCCCAAAACATGGCAGA GTCCGATTTTTGAGAACAATTTTTTTCCGGCCGGAAATATGCCGGAAATC GCCGTTTTTCTTGATTTTAATTGGACTTTTTCCTCTTAATTGGTTGTTTT TTCATTCAAAAACACTATTAATAGCAAATTGATTTTTGAAGCCGGAACTA TTTCAAAATCGCCGGAACAACCTATTTTCGCCGGAAAGACAGTATTTCTT GAATTTCTCGAGCTGTACTTGATATTTTTTTATGAAATTTTGTACACTGA TGCAAAATGACAATACCTAAAATGTGACGGAGCCGGATTTTCGAAAAACA TTTTTTTCCGGCCGAAAATGCCGGAAATATGCCGGAGAAACTGTTTTTTT TACATTTTCTCGAGATTTTACCTTTGTTTTTTTCTTTTCTTTTTCTCAAA GATGTGTATTAGCAATGCCCAAAACATGGCCGAGTCCGATTTTTGAGAAA AAATTTTTTTCGGCAGAAAATGTCGGAAATCGCCGTTTTTCTGGATTTTC ATTTGACTTTTTCCTTATAATTGGTTGTTCTTTCATTCAAAAACATTTTA ATAGCTATGCCCACCATCAAGCATGTTTCAACTTTCAATATAATTGATTT TTGAAGCCGGAACTATTTAAAAATCGCCGGAACAACCTATTTTCGCCGGA AAAACGGTATTTCTTGAATTTCTCGAGCTGTACTTTAAATTTTTTTATGA AATTTTGCACACTGATGCAAAATGACAATACCTAAAATGTGACGTAGCCC GATTTTCGAAAAACATTTTTTTCTGGCTGAAAATGCCGGAAATATGCCGG AAAAAACGGTTTTTTTACATTTTCTCGAATTTTTATTATTTTCATTCTTA AGTTTTTTCTCTTGCAGAGAGATGCGTATTCGCAATGCTCAAAACATGGC CGAGTTTGATTTTTGAGAAAAAAATTTTTCCTGTTGAAAATGCCGAAAAT CGCCGTTTTTGCAGATTTTCATAGGACTTTTTCCTTTTATTTCTATGTTT TTCACACAAAAACATTATTGCTAACAATGCTCACTCACCATCAAGCATGA TTCAATTGTCAATTAAACTGATTTTTGCGACCAGAACTTTCTATGCTTAT TCAAACAAAACAGCATTTCAGCGGTAAAAATATTTTAAAAAGTGCATCAT TTTGGAACAATTTAGATAACTTTATGAGAATTTTACGTGAAGAAAGAAAA CGAAACCTGAGTTTCGTAATAAAAAAACTTTCCTTTTTTAAATCCCGATG GAGTTTACCATAATGAGTCCTGAAAATGGTATTTTCCTCTAAAGTTTTCT TTTCACGGCAAGTGAAACTAAATTTTCCACCCAGTATTTCCACAACAAGG AAAATTTTTGCAACAACTTTAACAGCAATCCCCTCTTGTTTTGTTTATAA GGTTCCAATATTTTTGATTTCAAAAGCGAAGTTTCGAATCAAATCATAGA CGATGTTATCGTCCGTTACAGTGATAGTTAAGGCGGGAAAATACGGCGGT ATGATGGTATACGGAAAAGAAAATCGGCGGCAGAGTTTAGAAGACTGGCA AACTCTACCGATTGTAAACTCTTGTCGGCAAAAAAAACGTTTGCGAATTT TCTTTGGTTTTGGGCTTATTTCTTAGATAGTGATTTGTCTTTGGCATAGT CTAATCAAATCACTGCAAGTTGCATGTTTTTAATTTCGTGATTTTAAGTG CGGCACTTGTTTCTCTACCTTTGTCTTCCTATAAGCGCCAATCTGAAAGT GCAGAGTGTTTGGAAATAGTGCGGTGCTTTCTAAGAGGACGGCGGTTATT TCAAAAACTCCAAAATTAAGGTGTGGTCCTTTTTAGAGGGGGCGCTTACT GGAAAAATACTAACACGAAAACTCTTGAGTGACCATTAAAAATACCTTTT TTAAAAAAGTTACGAAATGAGTTAAGAAATCATAACTTTGGATTTAGACG TCATAATTTATTTGTCTTGACCTTGGTTTAAGTTCCTTGAGCCTCTAGAA TACTGGTGTGAATTTGAAGTTTTCTTTTATCCTTTCTTCTTCTTTTATTT TTCATAAAAAAAAATCACAAAATTCCATGATGGTGATATTCTTAGCATTA TTCTTAATTTTTTTTACCATTTTCATCATGGACATTCTTATAAAGTGTAT ATTCTTATTTATTCTGGTTGATTGATTGATTGATTTTTATTGTAGGAAAT ATGCAGCCACAGTTGGTCAAGATAGAAATATGAGGTAAACTTTTCATTAA ACTGTTTTCTAATAAACTAAACAATTGTTACTGCTAACGCAGTAGCGAGG AATATATCACTGACCCCGATGAGTATATTCTGACCATATATTTCAGGGAC GCTAAAACAAATGCACAAAATTAGAAGTTAGAAAACTTGCTCAACTAAAC AACTAGTTACAAGAAACTGAAAATATCCCAAGTTAGAACCAAAAGAAACG AAAGGCAAACAGAAAAGACGCAAACCCCCAAACAAAAACCTAAACGAAGC ACACTGAAAATGAAGCACTGGAAAACACACAGAAGACGCAAGCCCAACAA AGAACTTAAGCATGTACACAAACATAGAAAATACTTACTAAAATACTAAA GTTCTTTCACTTCACCCTCACAGCACTCACAACAACATACAACAGTTCAG TACAAATTCATAAGGGACAAGACAATAGACGCGCACGGAACATTGAAAAA TATAAAATACGTTATGGAGGAGAACCATATACTCCCGCGTAGAGTGGAGG CCTACTTGTACTCAATGCGGGAACAACAATTTTTTGTTTATTCAGCACAA TGCAACAATAGAAAGACACCGTCCTGATATGAGACATGTGTCTGATATGA AACAGGAATACTTTTGTAAAAATAAAACCGTTAAAGGGGGATTATACACC ACGCACGATGGACACTGTTTTCATGTAAAACTACCCCGTTTTGGTATTGA GATATACCAAATTTAGGTACATTAGTTGGACTTTCCCTGGCGTTGCAAGG GTACTCGAAAGCCTGACTAAATTGTTGCGCTTTTTATACGTAAATACCCT CTCTTTCTTCTTACAGGGTGTATAATGTTCAAGAGGCAAAACAAACCACT TGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGTAACCTC AACTTTACTTTACTTCACCTAAATCTAATCCGTGTTTACACATTATAGGG AAGGGGCGTCAAGCAGTTGGTTGGTACCAAACATATCATAACGTTTAGTT CCGTAGTGGGTCATATTTGATTTTTGTATTCTGCAGTTTAGTGTCTTATC TTTTGAGTACTAACAGCTATAGAAGTTGGTGTTCTTTAAATTTCAAGTCA GAAAAATGGCACTTTTAGGGATGCCATGACAAGGCTTTCAACTTTTCCTT TCACTACAGGCTCTTTTCTTCATTCTGCAATACTCAATAACAGGAAACTA CTTTTTTAAGGTTTCAAATGGTTAAGTATCTTTTCAAGTTTTGATATCCC ATCTATCAATTCTCACGATTTCAACCTGAAAGTAAGGTTTTTAGGGTTAT TTCGGTATTGTTAGTTATAGTTATGTAATATTGTGGTTTGCCGAAAAACG GCTAATTTTTCTCATTTTTCTCATTTTTTGCACGAAAGTAGGGTACCATC ATTTGGTAAAAGATGGCTGAAGCAGATTTTCACAAAAAAAATTTTCCCCT CAAAAATTGAATCTTTATCCATAAGAATCACTATTTATAAGCTTAGATCA ATGTTCCTAACGAAATTAATCAAATTTTTGATGAGATAGATGTATTTTTT GCTCATGAAGTCTTGATATGAAAGAGTATTTGTTGTTGTTGTTGGTTGCT AAACGTGTTTTTCTGGCCTTTCTGACATACTACTGGTCCATTGAAATTTC TATTATTAAAAGCAGTAAATTTCCCATTACCATTACATAACTTGGAAAAA ATCCGTTTGGAAAAAGAAGTTTTCCAGTTATTCTAGACGACTAAAATTTA GAGAAGTAGTGTATGATGAGGAAAACGGAAGGATGTAAAGTGATCTCGCT ATTACACATTTCCGTTATCCTAGGCTGCTTCGTGGTCTCATACTAGCTGA GGTTTTGTAAAGGTCTGTGATTCAGACTATCATTATCCTAGACTGCAGTC ATCTATAATCCGTGTCTTCTAGTAATATTGGTGTTATATGATAATACAAT AATCGTAATGACATAATATCAGTGTGNGTTGTTGTTGTTGGTTGCTAAAC GTGTTTTTCTGGCCTTTCTGACATACTACTGGTCCATTGAAATTTCTATT ATTAAAAGCAGTAAATTTCCCATTACCATTACATAACTTGGAAAAAATCC GTTTGGAAAAAGAAGTTTTCCAGTTATTCTAGACGACTAAAATTTAGAGA AGTAGTGTATGATGAGGAAAACGGAAGGATGTAAAGTGATCTCGCTATTA CACATTTCCGTTATCCTAGGCTGCTTCGTGGTCTCATACTAGCTGAGGTT TTGTAAAGGTCTGTGATTCAGACTATCATTATCCTAGACTGCAGTCATCT ATAATCCGTGTCTTCTAGTAATATTGGTGTTATATGATAATACAATAATC GTAATGACATAATATCAGTGTGTAAAGAATTTATCCCGTCCTTATTATTC GTGTCTTGTCTTATGTCTGAATCAGTCTTATAGCATGCTAAACTACCATA ATACGAAAGATTAAACGATTCCAGTCCGACTAATAGCAGAAGGCTTTCTA GAAAATTTACCTGTTCTCATCTTCTGCTTTTTCCAGTTTCAATTGGACGG TGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTT TCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGT AAAACTACTAGTGTTGTTTACATTTTTTATATATAAGAACCAATAGAATT TTTCTGAGGCTCGGTTGTTCT

Coding sequence (CDS) from alignment at scaffold_90:140241..181711-

>TCONS_00073358 ID=TCONS_00073358|Name=TCONS_00073358|organism=Clytia hemisphaerica|type=CDS|length=51768bp|location=Sequence derived from alignment at scaffold_90:140241..181711- (Clytia hemisphaerica)
TTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAA
AACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGC
ATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAA
GGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCAT
TAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCA
AGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGAT
CGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGAT
GATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCAT
GTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGA
TCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAA
CAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTT
ACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCG
GAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAA
TCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCA
CCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAAT
CAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGA
GGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTA
TCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCT
TAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGACAGAT
GACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATA
TCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATT
TGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATC
TTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTAC
ATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGA
ACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAG
TGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCA
ATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAA
CGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGC
CTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAAC
GTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTT
TCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTT
TTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTT
GCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTT
TCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTC
TGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCAC
AAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGAC
GATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTG
AAATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACAT
TCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAAC
AAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATC
CTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCT
AGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAG
TCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGA
ATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTT
CCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCT
AGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTA
TATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAA
GGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAG
TTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAA
ATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCG
ACCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAG
TAGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCA
GTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTT
TTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAA
CTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCA
TGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTT
TTGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATC
CATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTA
TGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGA
AATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTA
AGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGA
TCCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGA
GACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTG
AAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGC
TTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGT
CCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTG
ATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTC
GGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGC
TTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTAT
AAGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGG
TGACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGA
ATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTC
AATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGT
GTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATG
TCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACT
GTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCT
ATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATT
GGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAAT
CTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGT
GAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTA
TCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAA
AACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAA
CCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATC
GCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTC
TGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAA
GTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAA
GAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATC
AGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATG
TGAAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACA
TTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTG
TTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCA
GCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTT
GTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGAT
TGAGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCG
GATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCA
TCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTA
CACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTC
GATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAG
AAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCG
GGAACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAG
ATACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTA
CGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCG
CTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTG
TACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACC
ATATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGA
ACATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATG
GGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACC
ACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAA
GAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGA
GTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACA
TAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGC
AAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATG
GTCTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTA
TCCTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGT
GGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTG
TATGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGC
GTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAAC
CGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGG
TCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACA
ATAAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTT
TGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAA
TGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAA
ATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATA
TTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAAC
ATTCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTG
GGCTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGG
TATTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGC
GGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATT
CGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGA
GTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGC
AGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATG
GTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTT
GTTTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAA
CCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAA
ATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGT
TTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATA
TGGGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTG
TGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATT
ATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGA
AGAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACA
GCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTT
CGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGA
AGAATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAAC
ATCCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAA
TGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTG
GTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCG
TAATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTT
GTTTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGT
ATTTGGAACATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGT
ATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTT
CTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTT
CGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACAT
TTCAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAA
GGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTG
GTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGT
TCCAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGC
GCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATG
TGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTC
TACTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTG
AAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGT
TGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGA
AACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCA
CCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGT
CAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGG
ATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCT
GGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATG
GAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAA
GACAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACA
CATCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAA
CTTCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTA
AGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAA
ATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACA
AGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTG
TTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTT
GTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTAC
TAGTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCA
AAACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGAT
CAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAA
ATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTT
TACGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTAT
TAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTT
ACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGAC
GTTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTC
TATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGA
GACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTT
CTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCT
TTCCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATG
GGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTG
GCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGT
ACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCT
TCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATAC
TATACGTATTTGGAACATCGAGACAGATGACCAGTATATACAATGATCAT
AGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGC
GTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTT
CATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTC
AGAACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGC
TTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACC
CACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTG
TGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCAC
AGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACG
TTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAG
TCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGT
CGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGG
TAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCT
ATATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGA
ATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATA
TGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGA
GTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCA
CAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCG
CCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACA
ACACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACAC
TGAAACACATCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCC
AATCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAG
AAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAA
ATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTA
AATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGT
GGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTT
CGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTA
AAACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCA
AGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCA
ACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAG
AACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGC
CACTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTA
CAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCA
AACGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATAT
CTTTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATT
CCTCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCT
TTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTA
GAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATG
AAGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGAC
ACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCA
AATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTC
AAGATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGA
TAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCG
ATGATACTATACGTATTTGGAACATCGAGACAGATGACCAGTATATACAA
TGATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCA
AAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGA
TTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTT
TAGATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGT
GGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGAC
TTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATA
TCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTC
CCATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTC
ACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGT
CACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATA
AATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAAC
TACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCA
GGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGAT
GTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAA
CATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTC
AGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCA
GAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTC
ATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTT
CTTTACAACACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAA
GTGACACTGAAACACATCTTGGGCTTAACCACAACAAACACTAACGGATT
AGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAA
TAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATC
ACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACG
AGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATT
GGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTG
GTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACAT
TCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATA
ATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGAT
GAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAA
ATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAG
GAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAA
TATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATA
CCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAA
TTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGAT
GATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTG
GATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCT
ATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTAC
ATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGG
TAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTG
ATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACAC
ACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATT
TCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGC
TCATCCGATGATACTATACGTATTTGGAACATCGAGACAGATGACCAGTA
TATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAA
GTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGT
GGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCT
ATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGA
GATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCA
GAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAG
AATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCG
ATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAA
TTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGT
ATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATC
ATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTC
TGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATC
TAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAA
TCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGG
TGATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAAC
AACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCT
GAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGT
GCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGT
TATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATTCTCAACC
CAGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACAAACACTA
ACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGC
ATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAA
TAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAG
ATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCT
TTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAA
ACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCA
TGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAG
GTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATT
AAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAA
GATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATC
GTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATG
ATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATG
TTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGAT
CGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAAC
AATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTA
CTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGG
AAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAAT
CGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCAC
CTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATC
AGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAG
GGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTAT
CCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTT
AACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGACAGATG
ACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATAT
CAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTT
GGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCT
TGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACA
TCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAA
CGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGT
GACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAA
TGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAAC
GAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCC
TTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACG
TCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTT
CAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTT
TGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTG
CAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTT
CCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCT
GGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACA
AGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACG
ATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGA
AATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATT
CTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACA
AACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCC
TGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTA
GTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGT
CGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAA
TTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTC
CGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTA
GCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTAT
ATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAG
GATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGT
TGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAA
TACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGA
CCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGT
AGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAG
TCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTT
TACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAAC
TGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCAT
GAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTT
TGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCC
ATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTAT
GCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAA
ATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAA
GACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGAT
CCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAG
ACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGA
AGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCT
TGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTC
CTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGA
TCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCG
GAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCT
TAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATA
AGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGT
GACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAA
TTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCA
ATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTG
TCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGT
CAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTG
TTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTA
TTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTG
GAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATC
TATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTG
AAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTAT
CCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAA
ACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAAC
CACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCG
CATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCT
GGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAG
TGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAG
AAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCA
GTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGT
GAAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACAT
TTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGT
TTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAG
CCACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTG
TGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATT
GAGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGG
ATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCAT
CATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTAC
ACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCG
ATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGA
AGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGG
GAACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGA
TACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTAC
GTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGC
TCTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGT
ACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCA
TATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAA
CATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGG
GATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCA
CAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAG
AGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAG
TATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACAT
AACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCA
AATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGG
TCTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTAT
CCTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTG
GCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGT
ATGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCG
TTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACC
GTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGT
CATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAA
TAAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTT
GGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAAT
GAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAA
TGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATAT
TTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACA
TTCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGG
GCTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGT
ATTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCG
GAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTC
GCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAG
TCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCA
GCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGG
TGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTG
TTTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAAC
CACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAA
TATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTT
TGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATAT
GGGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGT
GGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTA
TTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAA
GAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAG
CTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTC
GCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAA
GAATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACA
TCCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAAT
GGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGG
TGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGT
AATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTG
TTTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTA
TTTGGAACATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTA
TGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTC
TTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTC
GAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATT
TCAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAG
GCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGG
TAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTT
CCAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCG
CTGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGT
GGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCT
ACTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGA
AGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTT
GGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAA
ACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCAC
CGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTC
AACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGA
TTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTG
GTATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGG
AAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAG
ACAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACAC
ATCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAAC
TTCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAA
GTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAA
TTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAA
GATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGT
TTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTG
TCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTACT
AGTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAA
AACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATC
AAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAA
TGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTT
ACGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTATT
AAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTA
CAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACG
TTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTCT
ATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGAG
ACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTC
TCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCTT
TCCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATGG
GAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGG
CAACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTA
CCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCTT
CTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATACT
ATACGTATTTGGAACATCGAGACAGATGACCAGTATATACAATGATCATA
GTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCG
TCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTC
ATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCA
GAACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCT
TTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCC
ACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGT
GGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCACA
GGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACGT
TAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGT
CCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGTC
GAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGT
AACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTA
TATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAA
TTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATAT
GCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAG
TTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCAC
AAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGC
CTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAA
CACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACACT
GAAACACATCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCCA
ATCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAGA
AGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAA
TCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAA
ATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTG
GTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTC
GACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAA
AACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCAA
GAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAA
CTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGA
ACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCC
ACTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTAC
AATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAA
ACGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATC
TTTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTC
CTCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTT
TGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAG
AATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATGA
AGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGACA
CTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAA
ATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCA
AGATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGAT
AGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCGA
TGATACTATACGTATTTGGAACATCGAGACAGATGACCAGTATATACAAT
GATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAA
AGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGAT
TTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTT
AGATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGTG
GCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACT
TCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATAT
CTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTCC
CATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCA
CAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTC
ACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAA
ATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACT
ACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAG
GAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGATG
TCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAAC
ATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCA
GTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAG
AGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCA
TTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTC
TTTACAACACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAG
TGACACTGAAACACATCTTGGGCTTAACCACAACAAACACTAACGGATTA
GCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAAT
AAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCA
CGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGA
GGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTG
GACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGG
TATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATT
CAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATAA
TGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGATG
AAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAA
TATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGG
AAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAAT
ATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATAC
CGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAAT
TCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATG
ATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTGG
ATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTA
TGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACA
TTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGGT
AAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGA
TGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACA
CAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTT
CGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCT
CATCCGATGATACTATACGTATTTGGAACATCGAGACAGATGACCAGTAT
ATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAG
TTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTG
GAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTA
TCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGAG
ATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAG
AAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGA
ATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGA
TCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAAT
TGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTA
TTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCA
TGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCT
GGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCT
AGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAAT
CTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGT
GATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACA
ACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTG
AGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTG
CGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTT
ATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATTCTCAACCC
AGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACAAACACTAA
CGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGCA
TAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAAT
AAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGA
TTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTT
TCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAA
CCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCAT
GGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAGG
TGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTA
AGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAG
ATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCG
TGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATGA
TGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGT
TCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGATC
GTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAACA
ATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTAC
TCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGA
AATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATC
GTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACC
TTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCA
GCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGG
GAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTATC
CTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTA
ACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGACAGATGA
CCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATATC
AAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTG
GGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTT
GTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACAT
CATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAAC
GTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTG
ACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAAT
GCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAACG
AAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCT
TCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGT
CGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTC
AGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTT
GGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGC
AATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTC
CATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTG
GTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAA
GTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGA
TCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAA
ATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATTC
TCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACAA
ACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCT
GCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAG
TGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTC
GTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAAT
TTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCC
GATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAG
CATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATA
TATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGG
ATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTT
GGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAAT
ACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGAC
CAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTA
GTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGT
CGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTT
ACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACT
GATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATG
AATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTT
GAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCA
TGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATG
CAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAA
TTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAG
ACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATC
CTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGA
CAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAA
GAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTT
GTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCC
TGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGAT
CCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGG
AGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTT
AGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAA
GGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTG
ACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAAT
TCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAA
TGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGT
CATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTC
AAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGT
TGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTAT
TGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGG
AAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCT
ATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGA
AAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATC
CGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAA
CACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACC
ACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGC
ATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTG
GGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGT
GCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGA
AAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAG
TTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTG
AAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATT
TTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTT
TCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGC
CACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGT
GAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTG
AGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGA
TAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATC
ATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACA
CGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGA
TTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAA
GCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGG
AACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGAT
ACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACG
TTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCT
CTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTA
CAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCAT
ATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAAC
ATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGG
ATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCAC
AGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGA
GTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGT
ATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATA
ACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAA
ATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGT
CTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATC
CTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGG
CAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTA
TGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGT
TCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCG
TCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTC
ATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAAT
AAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTG
GAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATG
AAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAAT
GCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATT
TGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACAT
TCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGG
CTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTA
TTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGG
AAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCG
CAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGT
CAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAG
CCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGT
GAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGT
TTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACC
ACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAAT
ATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTT
GCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATG
GGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGTG
GTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTAT
TGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAG
AAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGC
TGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCG
CATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAG
AATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACAT
CCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATG
GTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGT
GACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTA
ATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGT
TTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTAT
TTGGAACATCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTAT
GTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCT
TTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCG
AACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTT
CAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGG
CCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGT
AGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTC
CAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCGC
TGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGTG
GGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTA
CTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGAA
GGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTG
GCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAA
CTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACC
GAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCA
ACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGAT
TTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGG
TATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGA
AGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGA
CAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACACA
TCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAACT
TCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAG
TATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAAT
TGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAG
ATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTT
TACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCGACTTTGT
CAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAAACTACTA
GTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCAAGAGGCAAA
ACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAACTTGATCA
AGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAACGAAAAT
GGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCACTCTTTA
CGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTACAATTATTA
AGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAACGGTTAC
AAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCTTTGACGT
TATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTCCTCCTCTA
TAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTTGATGAGA
CGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGAATTTTCT
CCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATGAAGATCTTT
CCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGACACTGATGGG
AAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAATACTGGC
AACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAAGATGTAC
CCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGATAGCCCTTC
TGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCGATGATACTA
TACGTATTTGGAACATCGAGACAGATGACCAGTATATACAATGATCATAG
TTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGT
CTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCA
TGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTAGATTCAG
AACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGTGGCAAGCTT
TCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCA
CGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATCTTTTGTG
GTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTCCCATCACAG
GACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCACAGACGTT
AAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCACAAAGTC
CAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAAATGGGTCG
AACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTA
ACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGGAAGCTAT
ATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGTCGGGAAT
TTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACATGATATG
CTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAGTACGAGT
TTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGAGGTCACA
AGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCATTTTCGCC
TGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCTTTACAAC
ACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAGTGACACTG
AAACACATCTTGGGCTTAACCACAACAAACACTAACGGATTAGCTTCCAA
TCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAATAAAAAGAA
GACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCACGCCAAAT
CGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAA
TGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGGACGGTGG
TGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGTATTTTCG
ACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTCAGGTAAA
ACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATAATGTTCAAG
AGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGATGAAGGCAAC
TTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAATATGAGAA
CGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGAAAAGCCA
CTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAATATTTTACA
ATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACCGCCCAAA
CGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATTCATATCT
TTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATGATCATTCC
TCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGATTTCTTT
GATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTATGTGTAGA
ATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACATTGATGAA
GATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGGTAAAGACAC
TGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGATGGTCAAA
TACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACACAAGTCAA
GATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTCGACGATA
GCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTCATCCGAT
GATACTATACGTATTTGGAACATCGAGACAGATGACCAGTATATACAATG
ATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGTTGGCAAA
GTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGGAGCGATT
TGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTATCACTTTA
GATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGAGATTCGTGG
CAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGAAGGACTT
CAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAATTATATC
TTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGATCACTCCC
ATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATTGCTTCAC
AGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTATTGCGTCA
CAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCATGGATAAA
TGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTGGGAACTA
CTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTAGACCAGG
AAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAATCTGGATGT
CGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTGATCAACA
TGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAACCTTCAG
TACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGAGCTCAGA
GGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGCGTGTCAT
TTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTATAGTTCT
TTACAACACCAAGACAAACATTCAAAAACACATTCTCAACCCAGACAAGT
GACACTGAAACACATCTTGGGCTTAACCACAACAAACACTAACGGATTAG
CTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGCATAATAATA
AAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATAAAATCAC
GCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGATTTACGAG
GCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTTCAATTGG
ACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAACCATTGGT
ATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATGGACATTC
AGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAGGTGTATAAT
GTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAAGTGATGA
AGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGATAGAAAT
ATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGTGCCAGGA
AAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATGATGAAAATA
TTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTTCCATACC
GCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGATCGTTTAATT
CATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAACAATTGATGA
TCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTACTCTTTGGA
TTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAAATTCTAT
GTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCGTCTACAT
TGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACCTTTTGGTA
AAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAGCCCTGAT
GGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGGAACACAC
AAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTATCCTTATTTC
GACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAACTTGCTC
ATCCGATGATACTATACGTATTTGGAACATCGAGACAGATGACCAGTATA
TACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATATCAAAAAAGT
TGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGGGGCGTGG
AGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTGTGGCTAT
CACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACATCATTGAGA
TTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACGTTTCAGA
AGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGACAGAGAA
TTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATGCACCGAT
CACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAACGAAACAATT
GCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTTCACGTAT
TGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTCGTATCAT
GGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCAGAGTCTG
GGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTGGTATCTA
GACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCAATAAATC
TGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCCATTGGTG
ATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGGTCAACAA
CCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAGTCGCTGA
GCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGATCACGTGC
GTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAATGCGTTA
TAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATTCTCAACCCA
GACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACAAACACTAAC
GGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTGCAGGCAT
AATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGTGGAAATA
AAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCGTCAAGAT
TTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATTTCCCTTT
CAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCGATAAAAC
CATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGCATGCATG
GACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATATATAAGGT
GTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGATCATTAA
GTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTGGTCAAGA
TAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATACGATCGT
GCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACCAGATGAT
GAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAGTCATGTT
CCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTCGAGATCG
TTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTACAAACAA
TTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTGATTTACT
CTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGAATCGGAA
ATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTGAAAATCG
TCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCATGGCACCT
TTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGCAAATCAG
CCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAATTTGAGGG
AACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGACTTATCC
TTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCCTTCTTAA
CTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGACAGATGAC
CAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAGAATATCA
AAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTGTATTTGG
GGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCTGATCTTG
TGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATCCTACATC
ATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGAGTGAACG
TTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTAGAAGTGA
CAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAGGGCAATG
CACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGACCAACGA
AACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATTCCGCCTT
CACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAATGAACGTC
GTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTCATTTTCA
GAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCAAGTTTTG
GTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTTGCTTGCA
ATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATTGGTTTCC
ATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGGAAGTCTGG
TCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTATCACAAG
TCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAAAGACGAT
CACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCCGGTGAAA
TGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAACACATTCT
CAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACCACAACAAA
CACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCATATCCTG
CAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGGGGCTAGT
GGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTGCGAGTCG
TCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAAAGGAATT
TCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGTTGTTCCG
ATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGAAGCTAGC
ATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTTTTTATAT
ATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTTCAAAGGA
TCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCCACAGTTG
GTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTGAGAAATA
CGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGAGCCGACC
AGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGATAAAGTAG
TCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCATCCAGTC
GAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACACGCTTTTA
CAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGATTCAACTG
ATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAGCTCATGA
ATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGAACTTTTG
AAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATACATCCAT
GGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGTTGTATGC
AAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTCTGGAAAT
TTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTACAGTAAGA
CTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATATGGATCC
TTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACATCGAGAC
AGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGATTTGAAG
AATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACAGTGCTTG
TATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAGTTGTCCT
GATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTATTTGATC
CTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAACCTCGGA
GTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAATTGCTTA
GAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTCTTATAAG
GGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCCTAGGTGA
CCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGCAAGAATT
CCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTATGTTCAAT
GAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTTCAGTGTC
ATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGTCATGTCA
AGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCATACTGTT
GCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATAAGCTATT
GGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGGAATTGGA
AGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGAAAATCTA
TCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATGCTGTGAA
AGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTTGGTATCC
GGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACATTCAAAAAC
ACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGCTTAACCA
CAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTATTATCGCA
TATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGAAGTCTGG
GGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGCAAAAGTG
CGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTCAGAAGAA
AGGAATTTCCCTTTCAATTGGACGGTGGTGGTGTTTACGCAGCCATCAGT
TGTTCCGATAAAACCATTGGTATTTTCGACTTTGTCAATGGTGAATGTGA
AGCTAGCATGCATGGACATTCAGGTAAAACTACTAGTGTTGTTTACATTT
TTTATATATAAGGTGTATAATGTTCAAGAGGCAAAACAAACCACTTGTTT
CAAAGGATCATTAAGTGATGAAGGCAACTTGATCAAGGAAATATGCAGCC
ACAGTTGGTCAAGATAGAAATATGAGAACGAAAATGGTGTTTGCTTTGTG
AGAAATACGATCGTGCCAGGAAAAGCCACTCTTTACGATATGGGGATTGA
GCCGACCAGATGATGAAAATATTTTACAATTATTAAGTTGTGGTGCGGAT
AAAGTAGTCATGTTCCATACCGCCCAAACGGTTACAAATTATTGGCATCA
TCCAGTCGAGATCGTTTAATTCATATCTTTGACGTTATGAAGAAGTACAC
GCTTTTACAAACAATTGATGATCATTCCTCCTCTATAACAGCTGTTCGAT
TCAACTGATTTACTCTTTGGATTTCTTTGATGAGACGTTTCGCATAGAAG
CTCATGAATCGGAAATTCTATGTGTAGAATTTTCTCCGGAAGAATCGGGA
ACTTTTGAAAATCGTCTACATTGATGAAGATCTTTCCAACATCCAAGATA
CATCCATGGCACCTTTTGGTAAAGACACTGATGGGAAAAATGGTGTACGT
TGTATGCAAATCAGCCCTGATGGTCAAATACTGGCAACTGGTGACCGCTC
TGGAAATTTGAGGGAACACACAAGTCAAGATGTACCCCCGTAATTTGTAC
AGTAAGACTTATCCTTATTTCGACGATAGCCCTTCTGCTTGTTTACCATA
TGGATCCTTCTTAACTTGCTCATCCGATGATACTATACGTATTTGGAACA
TCGAGACAGATGACCAGTATATACAATGATCATAGTTTGTATGTATGGGA
TTTGAAGAATATCAAAAAAGTTGGCAAAGTGGCGTCTTTTCTTTACCACA
GTGCTTGTATTTGGGGCGTGGAGCGATTTGGTTCATGTTTCGAACAAGAG
TTGTCCTGATCTTGTGGCTATCACTTTAGATTCAGAACATTTCAAGAGTA
TTTGATCCTACATCATTGAGATTCGTGGCAAGCTTTCCAAGGCCACATAA
CCTCGGAGTGAACGTTTCAGAAGGACTTCAACCCACGCTGGTAGTGCAAA
TTGCTTAGAAGTGACAGAGAATTATATCTTTTGTGGTTGTTCCAATGGTC
TTATAAGGGCAATGCACCGATCACTCCCATCACAGGACGCGCTGGTATCC
TAGGTGACCAACGAAACAATTGCTTCACAGACGTTAAATGTGGGCGTGGC
AAGAATTCCGCCTTCACGTATTGCGTCACAAAGTCCAGTCTACTCTGTAT
GTTCAATGAACGTCGTATCATGGATAAATGGGTCGAACTGAAGGTGCGTT
CAGTGTCATTTTCAGAGTCTGGGAACTACTTGGTAACCGTTGGCAACCGT
CATGTCAAGTTTTGGTATCTAGACCAGGAAGCTATATCGAAACTTGGTCA
TACTGTTGCTTGCAATAAATCTGGATGTCGGGAATTTTCACCGAACAATA
AGCTATTGGTTTCCATTGGTGATCAACATGATATGCTGGTCAACGTTTGG
AATTGGAAGTCTGGTCAACAACCTTCAGTACGAGTTTGGGATTTGAATGA
AAATCTATCACAAGTCGCTGAGCTCAGAGGTCACAAGTCTGGTATAAATG
CTGTGAAAGACGATCACGTGCGTGTCATTTTCGCCTGATGGAAGATATTT
GGTATCCGGTGAAATGCGTTATAGTTCTTTACAACACCAAGACAAACATT
CAAAAACACATTCTCAACCCAGACAAGTGACACTGAAACACATCTTGGGC
TTAACCACAACAAACACTAACGGATTAGCTTCCAATCCAACTTCTGGTAT
TATCGCATATCCTGCAGGCATAATAATAAAAAGAAGACTAAGTATGCGGA
AGTCTGGGGCTAGTGGAAATAAAATCACGCCAAATCGAAAATTGATTCGC
AAAAGTGCGAGTCGTCAAGATTTACGAGGCTTAAATGACAAGATGGAGTC
AGAAGAAAGGAATTTCCC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045516XLOC_045516Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073358-exon-scaffold_90-1575043694:181613..181711TCONS_00073358-exon-scaffold_90-1575043694:181613..181711Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:180870..180993TCONS_00073358-exon-scaffold_90-1575043694:180870..180993Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:180259..180350TCONS_00073358-exon-scaffold_90-1575043694:180259..180350Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:179670..179732TCONS_00073358-exon-scaffold_90-1575043694:179670..179732Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:172472..172529TCONS_00073358-exon-scaffold_90-1575043694:172472..172529Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:170000..170095TCONS_00073358-exon-scaffold_90-1575043694:170000..170095Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:168986..169063TCONS_00073358-exon-scaffold_90-1575043694:168986..169063Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:168392..168430TCONS_00073358-exon-scaffold_90-1575043694:168392..168430Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:167650..167748TCONS_00073358-exon-scaffold_90-1575043694:167650..167748Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:166296..166481TCONS_00073358-exon-scaffold_90-1575043694:166296..166481Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:165661..165731TCONS_00073358-exon-scaffold_90-1575043694:165661..165731Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:165367..165456TCONS_00073358-exon-scaffold_90-1575043694:165367..165456Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:164813..164885TCONS_00073358-exon-scaffold_90-1575043694:164813..164885Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:164248..164361TCONS_00073358-exon-scaffold_90-1575043694:164248..164361Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:162512..162614TCONS_00073358-exon-scaffold_90-1575043694:162512..162614Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:162136..162179TCONS_00073358-exon-scaffold_90-1575043694:162136..162179Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:161510..161673TCONS_00073358-exon-scaffold_90-1575043694:161510..161673Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:160331..160422TCONS_00073358-exon-scaffold_90-1575043694:160331..160422Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:159387..159512TCONS_00073358-exon-scaffold_90-1575043694:159387..159512Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:158849..158919TCONS_00073358-exon-scaffold_90-1575043694:158849..158919Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:148749..148831TCONS_00073358-exon-scaffold_90-1575043694:148749..148831Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:142978..143016TCONS_00073358-exon-scaffold_90-1575043694:142978..143016Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:142070..142145TCONS_00073358-exon-scaffold_90-1575043694:142070..142145Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1575043694:140241..140425TCONS_00073358-exon-scaffold_90-1575043694:140241..140425Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:181613..181711TCONS_00073358-exon-scaffold_90-1510915933:181613..181711Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:180870..180993TCONS_00073358-exon-scaffold_90-1510915933:180870..180993Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:180259..180350TCONS_00073358-exon-scaffold_90-1510915933:180259..180350Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:179670..179732TCONS_00073358-exon-scaffold_90-1510915933:179670..179732Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:172472..172529TCONS_00073358-exon-scaffold_90-1510915933:172472..172529Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:170000..170095TCONS_00073358-exon-scaffold_90-1510915933:170000..170095Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:168986..169063TCONS_00073358-exon-scaffold_90-1510915933:168986..169063Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:168392..168430TCONS_00073358-exon-scaffold_90-1510915933:168392..168430Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:167650..167748TCONS_00073358-exon-scaffold_90-1510915933:167650..167748Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:166296..166481TCONS_00073358-exon-scaffold_90-1510915933:166296..166481Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:165661..165731TCONS_00073358-exon-scaffold_90-1510915933:165661..165731Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:165367..165456TCONS_00073358-exon-scaffold_90-1510915933:165367..165456Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:164813..164885TCONS_00073358-exon-scaffold_90-1510915933:164813..164885Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:164248..164361TCONS_00073358-exon-scaffold_90-1510915933:164248..164361Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:162512..162614TCONS_00073358-exon-scaffold_90-1510915933:162512..162614Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:162136..162179TCONS_00073358-exon-scaffold_90-1510915933:162136..162179Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:161510..161673TCONS_00073358-exon-scaffold_90-1510915933:161510..161673Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:160331..160422TCONS_00073358-exon-scaffold_90-1510915933:160331..160422Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:159387..159512TCONS_00073358-exon-scaffold_90-1510915933:159387..159512Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:158849..158919TCONS_00073358-exon-scaffold_90-1510915933:158849..158919Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:148749..148831TCONS_00073358-exon-scaffold_90-1510915933:148749..148831Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:142978..143016TCONS_00073358-exon-scaffold_90-1510915933:142978..143016Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:142070..142145TCONS_00073358-exon-scaffold_90-1510915933:142070..142145Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1510915933:140241..140425TCONS_00073358-exon-scaffold_90-1510915933:140241..140425Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:181613..181711TCONS_00073358-exon-scaffold_90-1491911889:181613..181711Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:180870..180993TCONS_00073358-exon-scaffold_90-1491911889:180870..180993Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:180259..180350TCONS_00073358-exon-scaffold_90-1491911889:180259..180350Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:179670..179732TCONS_00073358-exon-scaffold_90-1491911889:179670..179732Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:172472..172529TCONS_00073358-exon-scaffold_90-1491911889:172472..172529Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:170000..170095TCONS_00073358-exon-scaffold_90-1491911889:170000..170095Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:168986..169063TCONS_00073358-exon-scaffold_90-1491911889:168986..169063Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:168392..168430TCONS_00073358-exon-scaffold_90-1491911889:168392..168430Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:167650..167748TCONS_00073358-exon-scaffold_90-1491911889:167650..167748Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:166296..166481TCONS_00073358-exon-scaffold_90-1491911889:166296..166481Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:165661..165731TCONS_00073358-exon-scaffold_90-1491911889:165661..165731Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:165367..165456TCONS_00073358-exon-scaffold_90-1491911889:165367..165456Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:164813..164885TCONS_00073358-exon-scaffold_90-1491911889:164813..164885Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:164248..164361TCONS_00073358-exon-scaffold_90-1491911889:164248..164361Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:162512..162614TCONS_00073358-exon-scaffold_90-1491911889:162512..162614Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:162136..162179TCONS_00073358-exon-scaffold_90-1491911889:162136..162179Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:161510..161673TCONS_00073358-exon-scaffold_90-1491911889:161510..161673Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:160331..160422TCONS_00073358-exon-scaffold_90-1491911889:160331..160422Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:159387..159512TCONS_00073358-exon-scaffold_90-1491911889:159387..159512Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:158849..158919TCONS_00073358-exon-scaffold_90-1491911889:158849..158919Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:148749..148831TCONS_00073358-exon-scaffold_90-1491911889:148749..148831Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:142978..143016TCONS_00073358-exon-scaffold_90-1491911889:142978..143016Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:142070..142145TCONS_00073358-exon-scaffold_90-1491911889:142070..142145Clytia hemisphaericaexon
TCONS_00073358-exon-scaffold_90-1491911889:140241..140425TCONS_00073358-exon-scaffold_90-1491911889:140241..140425Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
MAPK binding proteinTCONS_00073358-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:140241..181711 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
5.2975 4.49282 2.65714 2.35111 17.3829 13.8833 14.7974 15.4108 6.97971 10.5907 8.65376 7.36651 10.7877 11.1435 8.70095 10.8937 9.43036 9.01524 7.77752 8.06183 12.296 11.8405 5.44089 8.61601 17.0631 16.6834 4.16434 3.56048 7.89083 7.10286
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00073358 vs. Swiss-Prot (Human)
Match: MABP1 (Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens GN=MAPKBP1 PE=1 SV=4)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 353/692 (51.01%), Postives = 486/692 (70.23%), Query Frame = 2
Query:  158 TPNRKLIRKSAS--RQDLRGLNDKVTLKHIXXXXXXXXXXXASNPTSGIIAYPAGCVIVLYNTKTNIQKHILNPDKKTITCVSFSPDGRYLVSGESGQQPSVRVWDLNENLSQVAELRGHKSGINAVEFSPNNKLLVSIGDQHDMLVNVWNWKLGHTVACNKSGCRVRSVSFSESGNYLVTVGNRHVKFWYLDQEAISKGNAPITPITGRAGILGDQRNNCFTDVKCGRGKNSAFTYCVTKSSLLCMFNERRIMDKWVELK------AGSANCLEVTENYIFCGCSNGLIRVFDPTSLRFVASFPRPHNLGVNVSEGLQPTDLVH-VSNKSCPDLVAITLDSEHFKMTSIYNDHSLYVWDLKNIKKVGKVASFLYHSACIWGVETYPYFDDSPSACLPYGSFLTCSSDDTIRIWNIETGNTQVKMYPRNLYSKELLKIVYIDEDLSNIQDTSMAPFGKDTDG-----KNGVRCMQISPDGQILATGDRSGNLRIYSLDFFDETFRIEAHESEILCVEFSPEESGYKLLASSSRDRLIHIFDVMKKYTLLQTIDDHSSSITAVRFNYDENILQLLSCGADKVVMFHTAQTNENGVCFVRNTIVPGKATLYDMGIEPTRKYAATVGQDRNMRVYNVQEAKQTTCFKGSLSDEGNLIKFQLDGGGVYAAISCSDKTIGIFDFVNGECEASMHGHS 2191
            +P+ KL R  A   R+DL   + KVTL+ +LG+T +   GLA +P SG++AYPAGCV+VL+N + + Q HILN  +KTIT ++FSPDG+YLV+GESG  P+VRVWD+ E+ SQVAEL+ HK G+  V FSP+ K +VS+G QHDM+VNVW WK    VA NK   RV +VSFSE  +Y VT GNRH+KFWYLD    SK NA + P+ GR+G+LG+ RNN FTDV CGRGK +  T+C+T S LLC F++RR++DKWVEL+         A+C+ V+++YIFCGC++G +R+F+P++L F+++ PRPH LG +++   + + L   V+N   PD +A+T D  +  ++ +YNDHS+YVWD+++ KKVGKV S LYHS+C+W VE YP   DS  ACLP  SF+TCSSD+TIR+WN E+         RN+ S +L+KI+Y+D +   + DT + P G   D      + G+R + +SP+GQ LA+GDR G LR++ L    E  ++EAH+SEILC+E+S  ++G KLLAS+SRDRLIH+ D  ++Y+L QT+D+HSSSITAV+F   +  ++++SCGADK + F TAQ + +GV F R   V  K TLYDM +EP+ KY A   QDRN+R++N+   KQ   FKGS  ++G LIK Q D  G+Y A SCSDK + IFDF +GEC A+M GHS
Sbjct:   18 SPSIKLRRSKAGNRREDL---SSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEH-SQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATV-PLLGRSGLLGELRNNLFTDVACGRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTTTVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSDNTIRLWNTESSGVHGSTLHRNILSSDLIKIIYVDGNTQALLDTEL-PGGDKADASLLDPRVGIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEYSKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQKSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHS 703          
The following BLAST results are available for this feature:
BLAST of TCONS_00073358 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MABP10.000e+051.01Mitogen-activated protein kinase-binding protein 1... [more]
back to top