Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073348 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073348
Unique NameTCONS_00073348
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3047

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073348 ID=TCONS_00073348|Name=TCONS_00073348|organism=Clytia hemisphaerica|type=transcript|length=3047bp
gtcTTATaggattcaaaaaaaaaagaaatagagaaACACAGAATATCTCC
AATGTAGTATGATCAGAGACTAAATTTTGTTTCTCAAAAATATCAAGGTT
TATGGTGTAATGAACATCGACCCATCATAAATACAAAGGAGCTTTTCAAA
AGGCCATGCCAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAAT
AAAGCCAATGAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCC
ATTCACTAGAAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaac
aACAGGGATCATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCT
TTACCACTATTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGAT
CAAGAAAATCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCA
GTGACTTAAGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTA
GAATATATTAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGA
GATCATTAGAATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAA
TTAATCCAGACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCA
TGGCCTCACTTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTC
ACATGAATTTCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTG
TACTGCAGCTTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAA
TTCCTGAAGACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACG
TGCTTATATTCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATG
AAACAGAACATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGT
ATCATTAATGGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTT
ACTGAAAGTACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATC
ATGCACAGCTTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCG
TTAACAGAACCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAG
CAGCCAAAAAGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATT
CGATTGAAGCtgcacaatttcaaaaaataatggaaccctttttcaaaaag
ataGCCAAATGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATT
ATATTATTGGAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGA
ATGTTATTCTTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGAC
CATTGGAACCAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTT
CATGGAAATGAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAG
CTGAACGACAAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGG
AAGCATCTCGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAAC
CTAATCAGTAATTTAAAATCACTACTCCTGCAACGATTAGAAATTGATAG
CAGCAATTTTTTAGTATGCGATATCACAAAGCTTTAGCAATGATGAGGGA
AGTATTACCTTACCCTTGTAATGGTGGTTTTTATTATGTTTTTAACCTGC
ATAGAACTAATTAAATGGAGCAACTATCTATCTATAACCCCGTGTAACAC
GTTTTAAGAGAAAGATCTAACATGGTAGCAGCTGGATTATAATCGCCGTT
ATATTAAAATTGAACTGATTTTCAAAATTTATGAACTACTGGCAACCAAT
CAATCAATTTGTTTGTTTTTTTTTCAAAATCCATTGTTTTCTTTTTTGGC
GACAACATGGTGTGTCGGCCAACTCCAAAAATCACAAAAAATCGAAAGAA
AATTTATAATTTAGTAGGTACTTTTAATTATATGGAAAATTGAAATTTCA
ACTCCTCGAGTAGAAATTAAAGCAGGCCTTTCAACTTTTTTTCGTTGTTG
TGTGTCTTTCTGCCTTTTTGAACGAGTTTTCTCTTTTCTTCGTATCTTTT
CATGATTTTAAAATGATTTCTCCTTCGTATCTTTTGGTGATTAATGTGTT
TCTATATTTTCTATCTGTATCCCTCTGGCTAAAAAGTATGAAAACCATGG
CCTTTAATAGTAATTTATTATCCTCATCAGTTTAGACAAAAGGGCGAATT
CTTTCCTAATTAAAAACATGAATTTATAATAGTGTGTCTGTTACAATTTA
CTTCACATTCCATAGAAAAGTCCCTTTTAGAAAGGCAATTAAAATTTTAG
AGCATTTTTTGAATGTGATCAGAGCCTAATTTCAGACATCCTAAAAGCGC
ATATTCCTTCAAACTAATTTCGATAAGTCGTCAATTCCCAAAGGGGTACT
TACTTGTCTTTACATTGGTaataattatgtttttgatgattactattatt
ttagtttatattttttgtccAATTGTTTTCATGTAAACAGAATATGCATG
TAAATATACAAGCTGCTTTTTCTTatatatttcatttcaatttataCAAG
ACAAACTTTGAGTTTTTATTCTTCTGTTTTAAATTACTTGATGCCTGAAA
ATGCAAGTTAATCTATTCATCCTATCACGACTTTTTCGAGCTCCATGACG
CTGAATAGTTTTAGTACGAAAATGTTTCATTAGTTTTCAACAAGCCATTT
TGCCCTTTAGACGTAGATTTTCTTATCTCAAGATTGAGAAAAACTTTTAC
AGAAAATTGGACCAGTGTCTATTAACCCTTTGGGCATCTTCCTACTTTTT
ACTAGGGGAAGCATCTTGGAGggcttaaaatctaaaaattggcaagtgct
atgaccttgaaattttgatcaGTGGTATATATGGATGATTAAGAAGATGG
AAAAAATTTGGCTCGGCCACTTGTCTGGTTGGTGTTTaacagaccag
Run BLAST on NCBI

protein sequence of TCONS_00073348-protein

>TCONS_00073348-protein ID=TCONS_00073348-protein|Name=TCONS_00073348-protein|organism=Clytia hemisphaerica|type=polypeptide|length=482bp
MPMHGTAAPQPGANNKANEGGGGGGGKDSLDPFTRKSSVKKIGKHPKKQQ
GSSRFRNNPHVEIQPLPLLKDSPAQERQELMIKKIQLCCNMFDFMDPVSD
LRGKEVKRSTLNELVEYINAETGVLTEPVYPEIIRMVAINCFRTLPPSIN
PDFDPEEDEPTLECSWPHLQIVFEFFLRYLESHEFQPTIAKKYIDQKFVL
QLLELFDSEDPREREFLKTVLHRIYGKFLGLRAYIRKQINHIFLRFIYET
EHFNGVGELLEILGSIINGFALPLKAEHKQFLLKVLIPLHKVRCLSLYHA
QLAYCVVQFLEKDPALTEPVVMGLIKYWPKTSSQKEVMFLGELEEVLDSI
EAAQFQKIMEPFFKKIAKCVSSPHFQVAERALYYWNNEYILTLIQENSNV
ILPIMFSCLYRISKDHWNQTIVALVYNVLKAFMEMNGKLFDELTSSYKAE
RQKEKKKEKEREELWKHLDKIELEKKTGDQPT
Run BLAST on NCBI

transcript from alignment at scaffold_90:16284..52279+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073348 ID=TCONS_00073348|Name=TCONS_00073348|organism=Clytia hemisphaerica|type=transcript|length=35996bp|location=Sequence derived from alignment at scaffold_90:16284..52279+ (Clytia hemisphaerica)
gtcTTATaggattcaaaaaaaaaagaaatagagaaACACAGAATATCTCC AATGTAGTATGATCAGAGACTAAATTTTGTTTCTCAAAAATATCAAGGTT TATGGTGTAATGAACATCGACCCATCATAAATACAAAGGAGGTGAGATTC AGTTAATCAGAGTTAATTAATAAACTTTTAAAGAAAGCATTTTTGTTGAA CTGTAgtcattgaaaatttgaagcaCTTTTATGTGGCTGTTATGAGAAAA CtgagttttgaaactcaatatttgaagaaaaaatcttttgaatcaTAAAA AGTTGTGAAAATGCAGATAATGTTACATTACTGCCTGGTTTCTTTTGTTC TCGATGCATTTCATTCTATGCATTGTAggtaaaaacatcaaattattATA TCACgtcattttggtaaaaacagcctttttgtggaaaaacactagaaaaa gtgccctttttgaccACCAACGGACTGAGTTGGCTATGGGTAAAGTGNca ttttggtaaaaacagcctttttgtggaaaaacactagaaaaagtgccctt tttgaccACCAACGGACTGAGTTGGCTATGGgtaaagtgcttggagtttt gccTACTTGTGACAGCTTGTGGTAGTTTTAAATTTGTAGATATCAGGTTT CAAAAAAGCACATGCTGTGACTCATTGTTTCACTACACATTTAACTCGAT TTACTACTATGTACTACTGATTTATTTTTAGCTTTTCAAAAGGCCATGCC AATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATG AAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGA AAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATC ATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTAT TAAAAGGTATTTCTGATTTAATCTCAATCCATAACCATAGTATGAGGAAC CTAGTCAAAATTCGAACATACACAAGAAATGTAAAGTTCTTTGATTAACC CTTCCAGcatcttcttatttttttacCAGGGGAAGGATCCTccttaaaat ctcaagattaAAAATGCTTTGACCTTGAAATTGACCTGTTATAATTGTTC ATATGGTTATTCTGAgattatatattttgatttggCTACCTGTTTGGTTG GTGTTTTTATACAGTCCAGAAACTTGACTATAATTACATATTAACTGAAT TGGTCCATGAATATTTGGTACAaactgatctgtaaaataatgaagctttt gacttgaaatgaTAACTTATGATACTTATGTACTTACGTCATACAAAATT TGTCTTGCTGAAGGTGCTTAgaaaaagtagttttttttaGTGGGTACTTT TTTTACACAAGGAAAGTCCTTAATTGAACTAACAAATTCcatcttatttc aattattatGAACTCCAGTGAGATatgatttttcaggattttaacTCAGG TATATGCCATCCTTATTGGACCTTTAAAGTccctctaagggtgtaaaaat cACAATATCTAATTTCTGTCCCCCTTAAAGGTTACAAAAAAAACAAGAAC TCCAATATTTATCCCTAGAAAAGTCTAGATTAAAGGAAAAAAGTCCCGGG AGGGTcccaaaattcacaaaatttccctattttcccCTCCATCTTAGATC CTAGAAtatccgatttttgagaatcgGGAGGACCTCCCTGTCATTTCGCG AACCTAGTTTTTTTTGCATGCATAATTTGATTCAAAACCTGTGTATGTGT GAGGTTTTACCTATCCCTTTAAAACCTAATTTAGTACTTCACTAAGACAA ATATTGAATGTAATAACCAAAGTCATCTGCTTGTTGTTTAGTAACATCCA AATATTTTATAGACTTTAAAATTCCTTATGCTGAGAGATTGACATTTTCA AACGTTTTACTTTTCTAGATTCTCCAGCTCAAGAAAGACAAGAACTGATG ATCAAGAAAATCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGT CAGTGACTTAAGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAG TAGAATATATTAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCA GAGATCATTAGAATGGTAATTACTTTTCCACTTGCTTTTTTTACCTGGAA GTATCACGGTTATGTAACATCTTAAGATTGCTAGGATGTCTAGAAAATTG AGAACCACATATTATACATATATNTGCTTTTTTTACCTGGAAGTATCACG GTTATGTAACATCTTAAGATTGCTAGGATGTCTAGAAAATTGAGAACCAC ATATTATACATATATATATACATCTGATCATACGAAATTTGTAATATGAC ACTATGGCATCACAAAGttcaatttttgttatttaaatCTAGCATTGTTA TAGTTTtggttgcaaaaaaaaaaaggataaGCAGAAACATCTTTAGTATA TTGCCAATTTCATGAAAGTGTTTTTATCCAGTCCGAATTCGACTTGCAAA TGCTGTGCAAGTAAATGCTAGTGTGAGATGGATCTCTTTTGTCAGGAAGT TTTGTGTAACGCAAAACTACAGTTTACAAGAAATGGATGAGAATAAGGTT GAggatgatttgattttgattatgtttgcaaaattaaagaaatctGGTCC AACTGATTTCAATATAATGGTTCAGCTGACACTTTATAGGAAATGTGACT GCTGACCTACATGATTTAGTTTAGTTTATGATAAAGTTTTTAATGACATC GCTCTTCGTTTTTGAATTTGTCTTGTATTTTTCTCGGAATGAAGgtgtga aatattgaaaattaaatttggtttCATTTCGTTACAATCTTTCCCTCCAA TGTAAAACTTAATTCATTATACAATCGATATTTTGACCTTTCAGGTCGCA ATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTTTGATCC AGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTACAGGTTG GACATTATTTAACAAGATTGATATCGATCTTActttgactttttatttct aTATATATGCAGGCATACTTGACAAATAATATCTTTAAGTTTAACAATAG ATTTAGTTAGTCccaaaaaaactacttaaaacatgtatttttaatACTAA GATGTAATGAGTTGTGTTactgattcaaatttttcttttttttagattGT GTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAACCTACAA TTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGGTATGTATGGTT TTGAGGATATTGTCTATGTCATTACATATGATATCTTGATTAAGAAAAGG TCTCTCGTTTCAAGTAAGCTGTCCGTCATGTGCAAATTACCgatgttgtt ttatttttcctttacaTACATTAAAGGCTTTGCTTGCTCttaatttttat atttcatCACAACAAATTATATTTTATCACAATTGCTAAAGCAAAATTTT CTGTACAAGCACGATGTCCTATTATCCTATTTCCTATGTTCTATATGTAA NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TTCGTAGTCTATTCCTATTTTACGTGTGCACTATTTTTCGAAGAACTGAT ATGATCACTGATATGCCATGTCTCTGTTCAACCCCTTTGGTAGGGAGGCC GAAAGGTCGCGTGCGGAGCGGTAACGATTCCCGATTTTCGTAAAAAAGAA GTTTGGGGATAAATATCTCacctttgaaaaaagatattcagaaacctttt tttttaagtatAGAGAATTTCTTAATctgtcttttaaaaaaaaaaccagc CGTTTTCGTCGCTTCCTTGAGTCACAATCGTCCGATAATCGCAACCCACC TACCATTTTTGACGGACACGGAAACCGGCACCGACGTTTCAAAACATAgg cctttttcaaaaggttATAACAATTGAGCGAAAATCGTTAGCCGTATAAT TTTTTCACTATCGTCTTCCCTCGTGattcaagtttgttttgaatctacgt gtgaaaaaaagaaagatctcCAAGagccaagaaattgaaaaataagtttt ggtTTGAAGTTTTTGGTAGGAATTTCACAACATTTTTACTAGTGCGTGGT ATCAAATCAAAGCTGAATGCTTCTGCTATTCAGCCATATAATTTGTTTTT NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNcagggaaaacctggaaaagtcagggaaaatttagaaaaag tagtgaaagtcagggaaaagtcaGGGAACTCTTTTTGGAATAGTCAGGGA AAGTCAGGGAATTCCAAAATCAGTCAATCTTTTTAGAAAGAGGAAAGTTT TCATTCAAATGATAGCGCGTTCATCTTTACATACGACGGTACCCCTTTTG TATCCTGGTTTTAGTGGGGTTTTAGTAGACTcgcttttaaaaaaaatata tgtattTGAAATTGTgtgaagttttattttttttatctcaatatggtgtt tttcaaaatactgtTGGGGCGAACATTCAGGGAAAAAGGCCCAATATTCT GCTCTGGTCAGGGAAAAAGGCACCTTGGTCAATCTAAAAGTCATGGAAAA aggtcttttttttggaaaaagtcagggaaaaatatttctcttaAGTGCTG GGAACCCTGTAAATTTGTTTTTCCAAAACTTGTTCTGCTCAAACGTATGA GTCAGTTTTCTATGGTATGGTAAGACAAATTTTCTCattaacttttttca atttttttgatttgtatgTGACGTCATTTGACGTTCGAACtgccttttga ttggtcttttTTTTTAGGAAAGAAATAGGAAAGCCCTCaaattttcatag gaaaatgaaaactttcattCCAAACTTAATCAACCTGTAGAAATCTTGTA TCTGGAGTGTCcagtttcaaattttgttgGACCTCTCTGCGAggaaattt ttctaagaaaagaaaatctcaaTGAATCtgctttgcaaattttttttcaa gaaagtgGGAAAAACTTGTTGTTAACTNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATAAGTTTCA GACATGGGGTGGGACTGTTTTCaggttttcaattttgacttaAATGAATT GTGGCTTGTGTGCAAAATTTGCGCATTTAGGTACACGCTAGATTGAGCAA ATTGTGTAGaaagaccggtctgtaaaataccgcCAAATAttccgaaaatt ttgaaatttcagattttgacTAGTTTTATGAATCCCAGCATGTGTGCAAG ATTTCAAGCCAATCGGACTCCAGGaacacttttttttatcaaattttcac tttgaTCTTTGAATTAGCTGgtgggtctgtaaaatacacatgttccagag aataattttttaattttttttcaaaacttggaaGCTTACATCCATGTCCa actctcctgaaaatttcagaacaaTTGAATAagccgttgaaaagatatta aattNGCAACAACGTATAgaagtggaatttccgataaggtgtattgaata aaccgttggaaagatattaaattttgaatctgaaaaagtgtttttttcac tgtttttggtGCCGTCGGCTCTTACCCATTTAGCCTAGGCCATTTGTTAC CAAAAGAGCTGTTTTTAAGCCACAAAAAATGGCATATCTTCGGAACTGCT TTTTTCTGAGAGgtctatgacccctcattttcttgcattttttacccttt ttcagaTGGATCTatgattaccttaagggaagaaatttttgcgagaagaa atatttgcggaagaaattttcgcggaatttaatttcgcgaattggggCGT AATAAAAtacaatgtaaaatatttttgtaatcaaaaattatatttaacaa ttatattgaaaagtaataatttgtTATAAGCAAAGATAACTTGTGCGGAA AAGAAAGTCTTCATTTACTGTATTGACCCCCAAATTTTTTATCGCATaaa atttctacgggaaatcgaaagtaatttcatttggcttgtgatgtttgaga gcttggatgttgggaagctgcaaggataaaggtaaacaaattatagtctt ttttctgaaagaagaatTTTAACATTCTGCTAGACTGTCTTTAAAAGATT CTTTAGTAGGNTGAAAGAAGAATTTTAACATTCTGCTAGACTGTCTTTAA AAGATTCTTTAGTAGGGTGgtcagtcgaaatttcaaactgatttgcaaaa tgtcaaaccaagtataatgaaaagcccttatcctcagaaaaaaaatcagg gGTCACTATCTTTAAACNACCAAGTATAATGAAAAGCCCTtatcctcaga aaaaaaatcagggGTCACTCATCTTTAAACCTTTAGTAGTTTTccagata ttccattttgaagttccatattttgaagatttttatgCAAAAACCTCCCG CCATCTTGTAACCTCTTCACGGCACTGAAATCGAAgtgtttcacaaaaaa aatccctGCAAGAAGTTTGGGGCGAGTGGGTTTTCCGTAGCGCAAGCAAC AGACGGATGTCACCATACCATTTACTTTCCCTTAGCGCTTTCCACCCGAA TCTATTTGATTAAGGCGGCATTCACAAAGATCTTCGTTttgcgtcgcccg accgactcttgaaaattgagtagaattgagtcggtgagtcggtaaatttg tacttttttttgtcaatgaccttttcttcgttcaaaaattttattaccta ttgccgattttttgcgagGGGATTTCTAGCGCaggaggtcacagtgttca aaggtcataattttaaaccacccattacacgtggttgttttggctgctgg ctggctggcagtttcctccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcgaccgaccgacc gaccgactcactttttagacccaacgaggacgcgaaatgaagatatttgt gattgccgcctaaagattttttcagatttggaaagaaaaaacatttatct tgttaaaataataatgttggttgaaaaatattgtaaatttaATGGAAATA TTTGCAGTTTAAGTGCTTATTTTAACTtcctgaaaaaagtagaacactCT AGTCAGCCAATGTGGTACCTTTCGAAAGCTAAACTATTACGggggaaaat gtaaaaaaattcaggcCGATAGCTGACtcgggtggctagcgcttttgatt ttagTAGCCCCCGGTAAAAAAATTTCCTGTGCCGTGAACAAGACGTTTGA AAAAGCACACCTgcgagtactcattttcaaattttgaaagaacgaaaaga catatcttgataatttcttttgcaaaaaaaagctgaataaattctcttga agttggaaaaataatttgtgCTAGAAAACTTTTCCTTCCTGGATTTATGt aagtttgaagattttttttcaaaagtcctgCTTTTGTTACTGCCGCAGGC GAGAGCCTTGACCTCCCTATCTTTAgcctttttgcgaagcgaatttatga gcgaagcagttttgctatattgtgcacgtacctttaacttctatcccaag caaaaatttgctataaaatttgctatataNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NGACGCAACgaaaataccaaagtgtcaactaaactgggaaatttgataca gtaaaccagttgaaccaaataattaacaataattgcttcttatacgaaAC ATACGTTACtgatactttctctttaaagtttgcctggaattccgtgccaa aatttatttcaaaaattgatgtcatccattagggggtaattttttttttc tggaatggcccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNttttttctggaatggcccaatgacaataaaaggtaattaca tTCAgacttttacaactcacactttttaattacattattgacattttgac attacagtatagccatcttgttagatttttgaatttgttttgagaattct tgcaatagtttatcgttcaacttggagaaggagtgtttgtaaacatagaa atttttttataacCTTTATTTGCAATTTTAGTctcgcggctgaggtcgaa aaacgtttcatttcgtgatacatctttaagattccaaaaaaaaacaacag aaactcgcgaattagtacgtgtagattacaaatcaaaaaagtttccacga tattatcgtgcaagtaacgagtaattggcgtttgcgtttccaggcaaaat tgcaaggcctggaaattcattagtaaaaaaagacctaaatcacacgatag agctcttcaaactgagcaaaaaagtgtattacaccaaagtcccaacttct ctagatcaaaatttattggcctatttgtggtgaAAAACTGANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNGCCTATTTGTGGtgaaaaactgatggaaaacagggaatttcc ccacaatctgcattaatttatgcaaaattaaacacctttttgaccacaaa taggcccataaggGGCGAGgtccatattcaaagtcgccATGCGTAACGGG AAAAGACCGTTAGTGGGTAGGTATATCGGAATGTTGAGAGTTAGCTGTGG Cattgatgaccaaaatgaaactccactaaaaattccaaggaaaaaatcaa aaatcgctTATCGTAGCGCTCACTTCTTCGCTTTTTCCTTTAGCATGcta tccaaaatcctttccctgaGCAATTTAGGGGTGGTTTCAGAGTATAACAT TCTTGCTTTGGGAGTTATAAAAACAAAGGCCGTTTAAAAATTGTGATGAA ATTCGGCCGTTGTAAACCTCTGAAAATGGCGACCTTTGtagcgggccgtt tgttttgattttagNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTTGGTCAAATCATGAAGACCGTTAAGGTGGTGGGT AGGTATGTTTTGAAagtaacggtcttttcccgttacgcgtggcgactttg aatatggacgtcgcccctaacttttgatctagagaagttgggactttggt gtacaGGTGTTTGCCCCTCAGAATGCCACTGCCCCTCAGAATGTCAGTGT TTGGAAAATGGCAGCTACAGGCTTTGAGAATcattttaacaaaacttttt tgtggtttCCATGTGTATGAAAGTATAAGGCCTCAATTTCAATTGAAAAA ATGTGTTTAGAAatgggtgaaaaaaaattaggaccGGTTCAGTANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNtttcactttttttttggtttttggc cTTGAATCCTGTGATCTGAATATAAGTGTGCAAAGTAGCAATTTTCAATA AGCCCCAACATAGTAGAAACATTTTAAGTAGAAATTAGCTGTTCCCAATA CCATAGACAAATCTATGATGGCAGAAACTCTTACATCACAAGACTGGCAT TTTGCGGGTCCCCCTTTATTGGAAACGGAGTTTCATTTCATTCTTTAACA TATATCGAATATTTTTAGGAACAAGGATTTCAatgcaaatttaaaataaa ctataaatAAACTACTATGAAACNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNgccatttactcgttacttgcacgataatatcgtgg aaactttttgattttggaatctacatatactaattcgagagtctccatcg aaaaaagtggaatctaagaggtatatcacgaaaatcattttctagccact tttttcaaCCTCAGCTAGTAGCCGCGCGACTATTTGgctttggggggtcg gaattaggcagggctgctCAACTAAAGTATAATCCCTGGCTGACAGGCAG GGGACTATCTCTTCATCTCTACGTACGTACAACAGGTGACAGGGCAAACA ATTCTCTTCTGGAGGCTGGAAGGACCTGGTGCCTGCTGAAAACACCTGAA AACTAACCTGACTGACGTCACATCAGTCATCACCCAGCCCAGCTAAAAAA CGACCTGTTAAATTGCAGATCAATATTTATCACGtgaccaaaaaaaattt aacctttttgcTCGAGCTTTTTGACTTAGTAgatattcaattgacattgg cTTCGCCACTTCACCAATTCAAAAACTGAACCAAAACCTGACACCTGAAA ACagccaaatattttgttcagATTCTTTCCGCTGCTTCGTctaccatttt ttttaaatatttttacggAATCGATCTTTATAAAAGCATATAAGGGCCTT TTTTGATTGGACCTTTACCAAGTAACAATAATTCGGTCACCGGCAGAAAT TTTCGAGTCGTTCCCACTGCAGCCTACGTTGGCTGTTTATTGTGGAGGTA AACTTACTCTTGGTTGGCTAGGGACGGCGTTTGTTATCTCCTCAATAATT TGCTAGTTGGCAATACTTCTGGTCGTCCAtcatgaatgaaaaatgatgtt CCAACTCCTGAATTTTTGGTAATGTAAACAGCTTTTACATCTTCTTTATG TTGCTtactcaaatctttttttggtGTCTAAAAGATTTTGCAGTTTTGTT CTTGTTTGCATTCTTTTTTAGCCAGCTTACTGTTTTTTTTACAGAGGAGC CTGCTGCTTTTAGTTGTCATCAACCAACCATCctcctgtttgtttttaat tCGGAGAAATTTTAAGTCCATTTTCCGTCCATAATAGTCAAATttgactg aaagggttaaaagGTGACTTTCTTTGCCAATAACTTTCGATAAAATTGTT CCCCAAATTTCTCTTTTTCAGTATGTAGGTCTTCCTCTATATCTTACCAA AAATATTGCACTTAAATTTTTAGCCCCACAACGAAACCCCACctaactag ccgtattgtataagggttgcgaagcaaTCCAGACTCCACATCAATTCGCA aattgctagcaaaataagagacactctaaaaatccctctaataaagccgc tNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNATTTTTCTGCTTTACAGCTTTTAGAATTATTTGACA GTGAAGATCCACGTGAACGTGAATTCCTGAAGACCGTTCTACATCGGATT TATGGAAAATTCTTAGGATTACGTGCTTATATTCGAAAACAAATTAACCA TATATTTTTGAGGTATGACTATTTTATACAGTGATCCAGAGTTTGAAgca ataaagtaaaaaaatttaattttgaaatcttcGTCTTTCggtaaatttaa aagaaaattggaaTTTGAAGTATGTAAttattctttgtcttttctttgTT GTCCTTCTAATCAAACGAATCGACCGAGTTGATATTTAATTCTTTTCTCG TTTTAGATTTATTTATGAAACAGAACATTTCAATGGCGTAGGTGAACTAT TGGAGATTTTAGGAAGGTAACTgatctggaaaattttctttttgtgacAT TATCTATTATATTTAACCAATTCTATGTTGAGCTCGAATTGAAGCATGTA AAACTTTTAAATGTCATGTATTTCTGAattttaggaagaaaaaaacatta aaataattttattttttgtcataGTATCATTAATGGGTTCGCACTTCCAT TGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTAATACCTCTACAC AAAGTTCGATGTCTATCACTTTATCATGCACAGGTAAGTGTGATTGACAG TCTCTTTTCTTTATGTAAGATATGggcttttccaatacaaaagaACTTCA AATATTGAATGGATTACGGAAAGGATTCGAGTTTGGATTCAAATGTTTCT GTATTGGAAACCCTGATGAAGCCGAGCTCAATCCCCTTTCAGAGGGTCTG GGTCTGGTCTTTTGGAAACAATTGTTAGTCACCTTGAGATTGATGACTCA TTATGTGTGTCTTACCCTCGCAAGGTAGGTTTATGTTTTGGGCTTCTAGG ACTGAGTTCAAGGCTAGGTTGATTTTCGATACAGCAGTCTCGAAGAAGAC CCAGGTAAATATATGACCATTCATTTAAACCCATAcattatttcgatttt ttcacTGATGTCTTTTCAGCTTGCTTATTGTGTTGTACAATTTCTCGAGA AAGACCCCGCGTTAACAGAACCAGTAAGTCAAaccgttttttgttttgtt tttctactAAATTTATATACATACTATCTTAATCACTACGAATTTCGACT ACAGGCCTAATCGTTGTATTCATTCTGAAATTATTCTTGAAAATGTCCAA CTATCAACGTCAGATAAACCCTGAAGACGAGGACTCTAAATTTACTTAAA TTATTACAGACATACGGCGTAATCCTGATTATCTTTTTGACtccaaataa tttaataaaagttTGCTGTTAATTTTAAGGTTGTTATGGGTCTCATAAAA TACTGGCCTAAGACAAGCAGCCAAAAAGAGGTAATATCTACATCAATTTT GAAAAGACTTTAAGAGATCTTTTAGAGATTGCTAGTTATGGATTCCCTcg ttattttttatataatatgcTACACAaacttttgaattgcttttgcgTGT TTATAAATCTTCAAATTAGACTCTAATGAAACAGGGAGCTCTAAAACGTT ATATAACTTCATTTCAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTT GATTCGATTGAAGCtgcacaatttcaaaaaataatggaaccctttttcaa aaagataGCCAAATGCGTCTCCAGCCCGCACTTCCAGGTAAGTGACAGCT TAGCTTCATttcattctaaatttttttgttttatacaCAGTCGAACTCTG CATTATCAATTCgtttaacaaaattgtttttgctCGAACAAGACCGAATA TCTCCAGCTCTTTTGAACATGCACAATGCTGAAAATGTGGAATTTCGCTT TAATTGACTCCGTCTCTTtatcacttttgtttttttcaggttGCGGAACG TGCATTATATTATTGGAATAATGAATATATTCTTACTCTGATTCAAGAGA ATTCGAATGTTATTCTTCCCATCATGTTTTCATGTCTTTATCGCATCTCC AAGGACCATTGGAACCAGTAAGTTGATCTTATTTTAATCAGGTATCTTGG TCAGCCTCAGCCCTGCATTCCAAGGAATTCATNAGTAAGCATGTGTCTTT TTTTCGCTTGCCAAAATTTAGCTGAAGTATAAAGTGTACTGCTTacaaga ttttaatttttatgaaaggCTACAATACAAGGTTTATTCTTCCATTTTTG TGTTAATTCACAAATACTTTACCAAGTGTTTTGGTAAAGAATATCCCTTG ACTGTAAATGTATTCCACTGAGCACtccaggccatttttcatgcccctTA AGAGTCCGGTTATCAGACGCTACCCctcttgaaattactaaaatattggt aaaaacagcctctTAAGTGAAAAACActagaaaaagtgccctttttggcc acaaACGGACGCTGCCTTGCCCTTTTTAAAATATGGCCTATGATCTAAGC ATTGATTATCTGGGACTGATAGAAGAATTCGGGTCTCCTAGGTCTAGTGC AATTTGAAAATGGAATGGACTTTCTTAACCTCTGCCCTACTAACAGTTAC TTAATAAACGTACTTTATTTATGATGTAATGGTTTTTTCTAAAGGAAGTA GCAATCATCTGTATAATAATTTCTATATTTTGAAGATACNACTTAATAAA CGTACTTTATTTATGATGTAATGGTTTTTTCTAAAGGAAGTAGCAATCAT CTGTATAATAATTTCTATATTTTGAAGATACTTGTCTATCATTCCAGTAG ATATTTATTCTAGAAGGTTTCTAATcaattttttctcttctttAGGACGA TTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAATGGG AAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAAGTA AGTTCTTGAAAATGTTATCCCCTAAAATTACACCTATTGAACCATTAATA TTTTACAGAACCAAGTCTCTAGTAAAAATGATATTCATGGATATAAAACG TGTTGATGTCCTTCAAAAACTTaaactgtttttttgttttgtcccTTAGC CgagtgaaaaattaaatttcggTCCTTTTTGTTAAATCAGCCAAATTTGG TAATCAGAATTCATTACCCTCTGCGATACAATACGGAATTTGTAACATTT GAACTTGGTTATAAGGCAATTATGCGAACAAACCGTTTCAATATTCCGAG ATCCAGAAGTTTGGATCTGTGAGAACTAGACGAAAAGAAATTGTATTTTG GTAAACAATAATGAATTGGTTAGTGTTTTACTTCCAATGTAATTCATGTT TTTTTTTCGTAGGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGA AGCATCTCGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACC TAATCAGTAATTTAAAATCACTACTCCTGCAACGATTAGAAATTGATAGC AGCAATTTTTTAGTATGCGATATCACAAAGCTTTAGCAATGATGAGGGAA GTATTACCTTACCCTTGTAATGGTGGTTTTTATTATGTTTTTAACCTGCA TAGAACTAATTAAATGGAGCAACTATCTATCTATAACCCCGTGTAACACG TTTTAAGAGAAAGATCTAACATGGTAGCAGCTGGATTATAATCGCCGTTA TATTAAAATTGAACTGATTTTCAAAATTTATGAACTACTGGCAACCAATC AATCAATTTGTTTGTTTTTTTTTCAAAATCCATTGTTTTCTTTTTTGGCG ACAACATGGTGTGTCGGCCAACTCCAAAAATCACAAAAAATCGAAAGAAA ATTTATAATTTAGTAGGTACTTTTAATTATATGGAAAATTGAAATTTCAA CTCCTCGAGTAGAAATTAAAGCAGGCCTTTCAACTTTTTTTCGTTGTTGT GTGTCTTTCTGCCTTTTTGAACGAGTTTTCTCTTTTCTTCGTATCTTTTC ATGATTTTAAAATGATTTCTCCTTCGTATCTTTTGGTGATTAATGTGTTT CTATATTTTCTATCTGTATCCCTCTGGCTAAAAAGTATGAAAACCATGGC CTTTAATAGTAATTTATTATCCTCATCAGTTTAGACAAAAGGGCGAATTC TTTCCTAATTAAAAACATGAATTTATAATAGTGTGTCTGTTACAATTTAC TTCACATTCCATAGAAAAGTCCCTTTTAGAAAGGCAATTAAAATTTTAGA GCATTTTTTGAATGTGATCAGAGCCTAATTTCAGACATCCTAAAAGCGCA TATTCCTTCAAACTAATTTCGATAAGTCGTCAATTCCCAAAGGGGTACTT ACTTGTCTTTACATTGGTaataattatgtttttgatgattactattattt tagtttatattttttgtccAATTGTTTTCATGTAAACAGAATATGCATGT AAATATACAAGCTGCTTTTTCTTatatatttcatttcaatttataCAAGA CAAACTTTGAGTTTTTATTCTTCTGTTTTAAATTACTTGATGCCTGAAAA TGCAAGTTAATCTATTCATCCTATCACGACTTTTTCGAGCTCCATGACGC TGAATAGTTTTAGTACGAAAATGTTTCATTAGTTTTCAACAAGCCATTTT GCCCTTTAGACGTAGATTTTCTTATCTCAAGATTGAGAAAAACTTTTACA GAAAATTGGACCAGTGTCTATTAACCCTTTGGGCATCTTCCTACTTTTTA CTAGGGGAAGCATCTTGGAGggcttaaaatctaaaaattggcaagtgcta tgaccttgaaattttgatcaGTGGTATATATGGATGATTAAGAAGATGGA AAAAATTTGGCTCGGCCACTTGTCTGGTTGGTGTTTaacagaccag

Coding sequence (CDS) from alignment at scaffold_90:16284..52279+

>TCONS_00073348 ID=TCONS_00073348|Name=TCONS_00073348|organism=Clytia hemisphaerica|type=CDS|length=18837bp|location=Sequence derived from alignment at scaffold_90:16284..52279+ (Clytia hemisphaerica)
ATGCCAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGC
CAATGAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCA
CTAGAAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAG
GGATCATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACC
ACTATTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGA
AAATCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGAC
TTAAGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATA
TATTAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCA
TTAGAATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAAT
CCAGACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCC
TCACTTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATG
AATTTCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTG
CAGCTTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCT
GAAGACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTT
ATATTCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACA
GAACATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCAT
TAATGGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGA
AAGTACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCA
CAGCTTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAAC
AGAACCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCC
AAAAAGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATT
GAAGCtgcacaatttcaaaaaataatggaaccctttttcaaaaagataGC
CAAATGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATT
ATTGGAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTT
ATTCTTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTG
GAACCAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGG
AAATGAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAA
CGACAAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCA
TCTCGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAA
TGCCAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCC
AATGAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCAC
TAGAAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGG
GATCATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCA
CTATTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAA
AATCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACT
TAAGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATAT
ATTAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCAT
TAGAATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATC
CAGACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCT
CACTTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGA
ATTTCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGC
AGCTTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTG
AAGACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTA
TATTCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAG
AACATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATT
AATGGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAA
AGTACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCAC
AGCTTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACA
GAACCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCA
AAAAGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTG
AAGCtgcacaatttcaaaaaataatggaaccctttttcaaaaagataGCC
AAATGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTA
TTGGAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTA
TTCTTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGG
AACCAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGA
AATGAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAAC
GACAAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCAT
CTCGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAAT
GCCAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCA
ATGAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACT
AGAAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGG
ATCATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCAC
TATTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAA
ATCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTT
AAGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATA
TTAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATT
AGAATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCC
AGACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTC
ACTTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAA
TTTCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCA
GCTTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGA
AGACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTAT
ATTCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGA
ACATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTA
ATGGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAA
GTACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACA
GCTTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAG
AACCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAA
AAAGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGA
AGCtgcacaatttcaaaaaataatggaaccctttttcaaaaagataGCCA
AATGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTAT
TGGAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTAT
TCTTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGA
ACCAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAA
ATGAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACG
ACAAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATC
TCGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATG
CCAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAA
TGAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTA
GAAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGA
TCATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACT
ATTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAA
TCCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTA
AGGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATAT
TAATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTA
GAATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCA
GACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCA
CTTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAAT
TTCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAG
CTTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAA
GACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATA
TTCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAA
CATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAA
TGGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAG
TACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAG
CTTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGA
ACCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAA
AAGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAA
GCtgcacaatttcaaaaaataatggaaccctttttcaaaaagataGCCAA
ATGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATT
GGAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATT
CTTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAA
CCAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAA
TGAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGA
CAAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCT
CGACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGC
CAATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAAT
GAAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAG
AAAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGAT
CATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTA
TTAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAAT
CCAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAA
GGGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATT
AATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAG
AATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAG
ACTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCAC
TTACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATT
TCAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGC
TTTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAG
ACCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATAT
TCGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAAC
ATTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAAT
GGGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGT
ACTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGC
TTGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAA
CCAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAA
AGAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAG
CtgcacaatttcaaaaaataatggaaccctttttcaaaaagataGCCAAA
TGCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTG
GAATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTC
TTCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAAC
CAGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAAT
GAATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGAC
AAAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTC
GACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCC
AATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATG
AAGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGA
AAATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATC
ATCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTAT
TAAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATC
CAATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAG
GGGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTA
ATGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGA
ATGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGA
CTTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACT
TACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTT
CAACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCT
TTTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGA
CCGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATT
CGAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACA
TTTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATG
GGTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTA
CTAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCT
TGCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAAC
CAGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAA
GAGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGC
tgcacaatttcaaaaaataatggaaccctttttcaaaaagataGCCAAAT
GCGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGG
AATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCT
TCCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACC
AGACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATG
AATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACA
AAAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCG
ACAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCA
ATGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGA
AGGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAA
AATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCA
TCAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATT
AAAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCC
AATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGG
GGCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAA
TGCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAA
TGGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGAC
TTTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTT
ACAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTC
AACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTT
TTAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGAC
CGTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTC
GAAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACAT
TTCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGG
GTTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTAC
TAATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTT
GCTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACC
AGTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAG
AGGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCt
gcacaatttcaaaaaataatggaaccctttttcaaaaagataGCCAAATG
CGTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGA
ATAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTT
CCCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCA
GACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGA
ATGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAA
AAGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGA
CAAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAA
TGCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAA
GGAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAA
ATCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCAT
CAAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTA
AAAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCA
ATTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGG
GCAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAAT
GCTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAAT
GGTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACT
TTGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTA
CAGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCA
ACCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTT
TAGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACC
GTTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCG
AAAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATT
TCAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGG
TTCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACT
AATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTG
CTTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCA
GTTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGA
GGTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtg
cacaatttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGC
GTCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAA
TAATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTC
CCATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAG
ACGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAA
TGGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAA
AGGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGAC
AAAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAAT
GCATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAAG
GAGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAAA
TCCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCATC
AAGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTAA
AAGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCAA
TTATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGGG
CAAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAATG
CTGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAATG
GTCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTT
TGATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTAC
AGattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAA
CCTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTTT
AGAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACCG
TTCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCGA
AAACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATTT
CAATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGGT
TCGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTA
ATACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTGC
TTATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCAG
TTGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGAG
GTTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtgc
acaatttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGCG
TCTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAAT
AATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTCC
CATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAGA
CGATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAAT
GGGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAA
GGAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGACA
AAATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAATG
CATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAAGG
AGGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAAAT
CCTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCATCA
AGATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTAAA
AGATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCAAT
TATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGGGC
AAAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAATGC
TGAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAATGG
TCGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTTT
GATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTACA
GattGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAAC
CTACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTTTA
GAATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACCGT
TCTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCGAA
AACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATTTC
AATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGGTT
CGCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTAA
TACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTGCT
TATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCAGT
TGTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGAGG
TTATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtgca
caatttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGCGT
CTCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAATA
ATGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTCCC
ATCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAGAC
GATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAATG
GGAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAAG
GAGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGACAA
AATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAATGC
ATGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAAGGA
GGCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAAATC
CTCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCATCAA
GATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTAAAA
GATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCAATT
ATGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGGGCA
AAGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAATGCT
GAAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAATGGT
CGCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTTTG
ATCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTACAG
attGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAACC
TACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTTTAG
AATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACCGTT
CTACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCGAAA
ACAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATTTCA
ATGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGGTTC
GCACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTAAT
ACCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTGCTT
ATTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCAGTT
GTTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGAGGT
TATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtgcac
aatttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGCGTC
TCCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAATAA
TGAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTCCCA
TCATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAGACG
ATTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAATGG
GAAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAAGG
AGAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGACAAA
ATTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAATGCA
TGGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAAGGAG
GCGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAAATCC
TCTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCATCAAG
ATTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTAAAAG
ATTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCAATTA
TGTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGGGCAA
AGAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAATGCTG
AAACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAATGGTC
GCAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTTTGA
TCCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTACAGa
ttGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAACCT
ACAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTTTAGA
ATTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACCGTTC
TACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCGAAAA
CAAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATTTCAA
TGGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGGTTCG
CACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTAATA
CCTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTGCTTA
TTGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCAGTTG
TTATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGAGGTT
ATGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtgcaca
atttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGCGTCT
CCAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAATAAT
GAATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTCCCAT
CATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAGACGA
TTGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAATGGG
AAATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAAGGA
GAAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGACAAAA
TTGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAAATGCCAATGCAT
GGAACAGCAGCTCCACAACCAGGAGCTAACAATAAAGCCAATGAAGGAGG
CGGCGGTGGCGGTGGAAAAGACTCACTTGACCCATTCACTAGAAAATCCT
CTGTCAAGAAAATaggaaaacatccaaaaaaacaACAGGGATCATCAAGA
TTCCGAAATAATCCTCATGTTGAAATTCAGCCTTTACCACTATTAAAAGA
TTCTCCAGCTCAAGAAAGACAAGAACTGATGATCAAGAAAATCCAATTAT
GTTGTAATATGTTTGATTTCATGGACCCTGTCAGTGACTTAAGGGGCAAA
GAAGTCAAGAGGTCCACACTCAATGAATTAGTAGAATATATTAATGCTGA
AACGGGTGTCCTGACTGAACCAGTCTATCCAGAGATCATTAGAATGGTCG
CAATCAACTGCTTTCGAACACTTCCACCCTCAATTAATCCAGACTTTGAT
CCAGAAGAGGATGAGCCGACACTGGAATGTTCATGGCCTCACTTACAGat
tGTGTTTGAGTTCTTCTTGAGATATTTAGAGTCACATGAATTTCAACCTA
CAATTGCCAAAAAATACATAGACCAGAAATTTGTACTGCAGCTTTTAGAA
TTATTTGACAGTGAAGATCCACGTGAACGTGAATTCCTGAAGACCGTTCT
ACATCGGATTTATGGAAAATTCTTAGGATTACGTGCTTATATTCGAAAAC
AAATTAACCATATATTTTTGAGATTTATTTATGAAACAGAACATTTCAAT
GGCGTAGGTGAACTATTGGAGATTTTAGGAAGTATCATTAATGGGTTCGC
ACTTCCATTGAAAGCTGAGCATAAACAATTTTTACTGAAAGTACTAATAC
CTCTACACAAAGTTCGATGTCTATCACTTTATCATGCACAGCTTGCTTAT
TGTGTTGTACAATTTCTCGAGAAAGACCCCGCGTTAACAGAACCAGTTGT
TATGGGTCTCATAAAATACTGGCCTAAGACAAGCAGCCAAAAAGAGGTTA
TGTTCCTTGGAGAATTGGAAGAAGTTCTTGATTCGATTGAAGCtgcacaa
tttcaaaaaataatggaaccctttttcaaaaagataGCCAAATGCGTCTC
CAGCCCGCACTTCCAGgttGCGGAACGTGCATTATATTATTGGAATAATG
AATATATTCTTACTCTGATTCAAGAGAATTCGAATGTTATTCTTCCCATC
ATGTTTTCATGTCTTTATCGCATCTCCAAGGACCATTGGAACCAGACGAT
TGTTGCATTGGTATATAATGTTTTGAAAGCCTTCATGGAAATGAATGGGA
AATTATTTGATGAATTAACATCTTCTTATAAAGCTGAACGACAAAAGGAG
AAGAAAAAGGAAAAAGAGCGGGAAGAACTTTGGAAGCATCTCGACAAAAT
TGAATTGGAAAAGAAAACGGGAGATCAGCCAACCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045512XLOC_045512Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073348-exon-scaffold_90-1491911889:16284..16424TCONS_00073348-exon-scaffold_90-1491911889:16284..16424Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:16284..16424TCONS_00073348-exon-scaffold_90-1510915933:16284..16424Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:16284..16424TCONS_00073348-exon-scaffold_90-1575043694:16284..16424Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:17015..17239TCONS_00073348-exon-scaffold_90-1491911889:17015..17239Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:17015..17239TCONS_00073348-exon-scaffold_90-1510915933:17015..17239Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:17015..17239TCONS_00073348-exon-scaffold_90-1575043694:17015..17239Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:18252..18448TCONS_00073348-exon-scaffold_90-1491911889:18252..18448Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:18252..18448TCONS_00073348-exon-scaffold_90-1510915933:18252..18448Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:18252..18448TCONS_00073348-exon-scaffold_90-1575043694:18252..18448Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:19228..19329TCONS_00073348-exon-scaffold_90-1491911889:19228..19329Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:19228..19329TCONS_00073348-exon-scaffold_90-1510915933:19228..19329Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:19228..19329TCONS_00073348-exon-scaffold_90-1575043694:19228..19329Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:19529..19621TCONS_00073348-exon-scaffold_90-1491911889:19529..19621Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:19529..19621TCONS_00073348-exon-scaffold_90-1510915933:19529..19621Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:19529..19621TCONS_00073348-exon-scaffold_90-1575043694:19529..19621Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:47415..47545TCONS_00073348-exon-scaffold_90-1491911889:47415..47545Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:47415..47545TCONS_00073348-exon-scaffold_90-1510915933:47415..47545Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:47415..47545TCONS_00073348-exon-scaffold_90-1575043694:47415..47545Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:47740..47799TCONS_00073348-exon-scaffold_90-1491911889:47740..47799Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:47740..47799TCONS_00073348-exon-scaffold_90-1510915933:47740..47799Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:47740..47799TCONS_00073348-exon-scaffold_90-1575043694:47740..47799Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:47958..48066TCONS_00073348-exon-scaffold_90-1491911889:47958..48066Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:47958..48066TCONS_00073348-exon-scaffold_90-1510915933:47958..48066Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:47958..48066TCONS_00073348-exon-scaffold_90-1575043694:47958..48066Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:48453..48506TCONS_00073348-exon-scaffold_90-1491911889:48453..48506Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:48453..48506TCONS_00073348-exon-scaffold_90-1510915933:48453..48506Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:48453..48506TCONS_00073348-exon-scaffold_90-1575043694:48453..48506Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:48763..48813TCONS_00073348-exon-scaffold_90-1491911889:48763..48813Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:48763..48813TCONS_00073348-exon-scaffold_90-1510915933:48763..48813Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:48763..48813TCONS_00073348-exon-scaffold_90-1575043694:48763..48813Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:49001..49120TCONS_00073348-exon-scaffold_90-1491911889:49001..49120Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:49001..49120TCONS_00073348-exon-scaffold_90-1510915933:49001..49120Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:49001..49120TCONS_00073348-exon-scaffold_90-1575043694:49001..49120Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:49323..49450TCONS_00073348-exon-scaffold_90-1491911889:49323..49450Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:49323..49450TCONS_00073348-exon-scaffold_90-1510915933:49323..49450Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:49323..49450TCONS_00073348-exon-scaffold_90-1575043694:49323..49450Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:50229..50330TCONS_00073348-exon-scaffold_90-1491911889:50229..50330Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:50229..50330TCONS_00073348-exon-scaffold_90-1510915933:50229..50330Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:50229..50330TCONS_00073348-exon-scaffold_90-1575043694:50229..50330Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1491911889:50746..52279TCONS_00073348-exon-scaffold_90-1491911889:50746..52279Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1510915933:50746..52279TCONS_00073348-exon-scaffold_90-1510915933:50746..52279Clytia hemisphaericaexon
TCONS_00073348-exon-scaffold_90-1575043694:50746..52279TCONS_00073348-exon-scaffold_90-1575043694:50746..52279Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073348-proteinTCONS_00073348-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:16284..52279 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
131.298 135.801 118.315 114.244 306.483 229.838 188.588 205.368 146.111 149.849 111.757 105.835 92.3519 86.454 98.7751 111.79 133.371 125.775 73.7396 87.0223 123.912 128.774 108.891 111.312 84.5972 98.392 135.708 103.249 173.397 145.366
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR002554PP2A_B56
IPR016024ARM-type_fold
Vocabulary: Cellular Component
TermDefinition
GO:0000159protein phosphatase type 2A complex
Vocabulary: Molecular Function
TermDefinition
GO:0019888protein phosphatase regulator activity
GO:0005488binding
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007165 signal transduction
cellular_component GO:0000159 protein phosphatase type 2A complex
molecular_function GO:0005488 binding
molecular_function GO:0019888 protein phosphatase regulator activity
Blast
BLAST of TCONS_00073348 vs. Swiss-Prot (Human)
Match: 2A5E (Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens GN=PPP2R5E PE=1 SV=1)

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 317/420 (75.48%), Postives = 365/420 (86.90%), Query Frame = 3
Query:  237 DSLDPFTRKSSVKKIGKHPKKQQGSSRFRNNPHVEIQPLPLLKDSPAQERQELMIKKIQLCCNMFDFMDPVSDLRGKEVKRSTLNELVEYINAETGVLTEPVYPEIIRMVAINCFRTLPPSINPDFDPEEDEPTLECSWPHLQIVFEFFLRYLESHEFQPTIAKKYIDQKFVLQLLELFDSEDPREREFLKTVLHRIYGKFLGLRAYIRKQINHIFLRFIYETEHFNGVGELLEILGSIINGFALPLKAEHKQFLLKVLIPLHKVRCLSLYHAQLAYCVVQFLEKDPALTEPVVMGLIKYWPKTSSQKEVMFLGELEEVLDSIEAAQFQKIMEPFFKKIAKCVSSPHFQVAERALYYWNNEYILTLIQENSNVILPIMFSCLYRISKDHWNQTIVALVYNVLKAFMEMNGKLFDELTSSY 1496
            D +D F+RKS V+K  +   +     R +  P +E+ PLPLLKD P+ E+ EL +KK+Q CC +FDFMD +SDL+ KE KRSTLNELV+YI    G LTE  YPE++RMV+ N FRTLPPS + +FDPEEDEPTLE SWPHLQ+V+EFF+R+LES EFQP+IAKKYIDQKFVLQLLELFDSEDPRER++LKTVLHRIYGKFLGLRA+IRKQIN+IFLRF+YETEHFNGV ELLEILGSIINGFALPLKAEHKQFL+KVLIPLH VR LSL+HAQLAYC+VQFLEKDP+LTEPV+ GL+K+WPKT SQKEVMFLGELEE+LD IE +QF KI EP FK+IAKCVSSPHFQVAERALYYWNNEYI++LI+ENSNVILPIMFS LYRISK+HWN  IVALVYNVLKAFMEMN  +FDELT++Y
Sbjct:   12 DKVDGFSRKS-VRKARQKRSQSSSQFRSQGKP-IELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSTMFDELTATY 429          
The following BLAST results are available for this feature:
BLAST of TCONS_00073348 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
2A5E0.000e+075.48Serine/threonine-protein phosphatase 2A 56 kDa reg... [more]
back to top