Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073335 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073335
Unique NameTCONS_00073335
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1348

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073335 ID=TCONS_00073335|Name=TCONS_00073335|organism=Clytia hemisphaerica|type=transcript|length=1348bp
tgaAGAAAAtaggtcgatttccgcaattccgaaataccgtacgccctcCA
CAATGTAGAAGATTTATGGCGCTTTTTAGCCTGTTTAAGCCTTGATTTGC
GAAAAACATTTCTTCGTCAAATTCgagaaagtaaatgtcgtaaatttcga
GATTTTTTGACCTCACGAAAATTTGTACACCTAAAGTATTCTGGCCACGA
TAGTTTATTCTTTTTTATCTGAAATAGTCAATcggagaaaagaaaaacat
ttNCgagaaagtaaatgtcgtaaatttcgaGATTTTTTGACCTCACGAaa
atttgtacgcctaaagtattctgGCCACGATAGTATATTCTTTTTTATCT
GAAATAGTCAAtcagagaaaagaaaaacattcaatttttgtgtttctttt
ttaaatataatcgATATTGAATTGGGCGCATGGCGTTCTAAAATACAGGC
CTAGTAAACATGTATCCGCGGCGATTTTACGAAGGCCACggaattttcat
aattttcaaaaaaagtgcgTTATCAAAAGGCTGTCGAACCATGAACAGTC
TTAGTAATGAAGAGAAGAAATTTGGAACCATCAGAGGAACATTATGAAAA
CCTACAGCTTTCCGAACAAAGCGAAGTATGCAAGTGGATCAAATCAATTC
CGTTTTGGGAGGAAGATGAAATTGAAGCGATGGTAGTTCATGTTGTCTGC
GAAAAACACTGGCCCGTTGGCTTCTTCGAAAAGAAAGGGGACCGTGAAAA
AATGCGACCCGTCCACCCTCCGTCAGTAAAGAAATGCTCGATCCCAACTC
CTCCTACAAAAGAAAGACCGACAAAGAAATCATCGTTTGAGACTAAGACG
CACAAAGAAGATCAACTTGACAAGTTCAAATTGATGGACGCAGTCAATTG
TAAATCCTTTCTTTAAAAGTCCAATCTATGTAATAAAATGGAGTTCCAAA
AAGCCATTTGATGGAATGCGGTCTTCAAACGTTCCTTCTGTATGATCAAT
GCCTTCACGGGACATTTGTAGTAAACTGACAGTTAAGCCAGTGAGTACCA
GGGCTATATATCATAAAATAACATCCAGATAAAAACATCGATGAATTGAA
TGTGGTTGTGAAagtatttggattaaaaaatccGACGAAATAAGCAACAT
TCATATCTAGAGCATTTTTTATTGCTTTCAATTTTAAATCTCGCGGCATT
AAAGTTCAGGGTATTGTTACATTAAAAAGCAACGGCTTTCTGccatattt
ttcattatttttttctaaatactgTAATAGCAAATAGACATTAGTACCGT
CCGTTGTCCGATAAATAGCGAGCCTATGGtcgaaatttggatttcttg
Run BLAST on NCBI

protein sequence of TCONS_00073335-protein

>TCONS_00073335-protein ID=TCONS_00073335-protein|Name=TCONS_00073335-protein|organism=Clytia hemisphaerica|type=polypeptide|length=119bp
MKRRNLEPSEEHYENLQLSEQSEVCKWIKSIPFWEEDEIEAMVVHVVCEK
HWPVGFFEKKGDREKMRPVHPPSVKKCSIPTPPTKERPTKKSSFETKTHK
EDQLDKFKLMDAVNCKSFL
Run BLAST on NCBI

transcript from alignment at scaffold_9:165259..166606

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073335 ID=TCONS_00073335|Name=TCONS_00073335|organism=Clytia hemisphaerica|type=transcript|length=1348bp|location=Sequence derived from alignment at scaffold_9:165259..166606 (Clytia hemisphaerica)
caagaaatccaaatttcgaCCATAGGCTCGCTATTTATCGGACAACGGAC GGTACTAATGTCTATTTGCTATTAcagtatttagaaaaaaataatgaaaa atatggCAGAAAGCCGTTGCTTTTTAATGTAACAATACCCTGAACTTTAA TGCCGCGAGATTTAAAATTGAAAGCAATAAAAAATGCTCTAGATATGAAT GTTGCTTATTTCGTCggattttttaatccaaatactTTCACAACCACATT CAATTCATCGATGTTTTTATCTGGATGTTATTTTATGATATATAGCCCTG GTACTCACTGGCTTAACTGTCAGTTTACTACAAATGTCCCGTGAAGGCAT TGATCATACAGAAGGAACGTTTGAAGACCGCATTCCATCAAATGGCTTTT TGGAACTCCATTTTATTACATAGATTGGACTTTTAAAGAAAGGATTTACA ATTGACTGCGTCCATCAATTTGAACTTGTCAAGTTGATCTTCTTTGTGCG TCTTAGTCTCAAACGATGATTTCTTTGTCGGTCTTTCTTTTGTAGGAGGA GTTGGGATCGAGCATTTCTTTACTGACGGAGGGTGGACGGGTCGCATTTT TTCACGGTCCCCTTTCTTTTCGAAGAAGCCAACGGGCCAGTGTTTTTCGC AGACAACATGAACTACCATCGCTTCAATTTCATCTTCCTCCCAAAACGGA ATTGATTTGATCCACTTGCATACTTCGCTTTGTTCGGAAAGCTGTAGGTT TTCATAATGTTCCTCTGATGGTTCCAAATTTCTTCTCTTCATTACTAAGA CTGTTCATGGTTCGACAGCCTTTTGATAAcgcactttttttgaaaattat gaaaattccGTGGCCTTCGTAAAATCGCCGCGGATACATGTTTACTAGGC CTGTATTTTAGAACGCCATGCGCCCAATTCAATATcgattatatttaaaa aagaaacacaaaaattgaatgtttttcttttctctgaTTGACTATTTCAG ATAAAAAAGAATATACTATCGTGGCcagaatactttaggcgtacaaattt TCGTGAGGTCAAAAAATCtcgaaatttacgacatttactttctcGNaaat gtttttcttttctccgATTGACTATTTCAGATAAAAAAGAATAAACTATC GTGGCCAGAATACTTTAGGTGTACAAATTTTCGTGAGGTCAAAAAATCtc gaaatttacgacatttactttctcGAATTTGACGAAGAAATGTTTTTCGC AAATCAAGGCTTAAACAGGCTAAAAAGCGCCATAAATCTTCTACATTGTG gagggcgtacggtatttcggaattgcggaaatcgacctaTTTTCTtca

Coding sequence (CDS) from alignment at scaffold_9:165259..166606

>TCONS_00073335 ID=TCONS_00073335|Name=TCONS_00073335|organism=Clytia hemisphaerica|type=CDS|length=360bp|location=Sequence derived from alignment at scaffold_9:165259..166606 (Clytia hemisphaerica)
TTAAAGAAAGGATTTACAATTGACTGCGTCCATCAATTTGAACTTGTCAA
GTTGATCTTCTTTGTGCGTCTTAGTCTCAAACGATGATTTCTTTGTCGGT
CTTTCTTTTGTAGGAGGAGTTGGGATCGAGCATTTCTTTACTGACGGAGG
GTGGACGGGTCGCATTTTTTCACGGTCCCCTTTCTTTTCGAAGAAGCCAA
CGGGCCAGTGTTTTTCGCAGACAACATGAACTACCATCGCTTCAATTTCA
TCTTCCTCCCAAAACGGAATTGATTTGATCCACTTGCATACTTCGCTTTG
TTCGGAAAGCTGTAGGTTTTCATAATGTTCCTCTGATGGTTCCAAATTTC
TTCTCTTCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045499XLOC_045499Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073335-proteinTCONS_00073335-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073335-exon-scaffold_9-1491911889:165259..166606TCONS_00073335-exon-scaffold_9-1491911889:165259..166606Clytia hemisphaericaexon
TCONS_00073335-exon-scaffold_9-1510915933:165259..166606TCONS_00073335-exon-scaffold_9-1510915933:165259..166606Clytia hemisphaericaexon
TCONS_00073335-exon-scaffold_9-1575043694:165259..166606TCONS_00073335-exon-scaffold_9-1575043694:165259..166606Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:165259..166606 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.591815 0.570959 0.619363 0.449296 0.224578 0.200911 0.532399 0.425112 0.132789 0.308625 0.112916 0 0.0783365 0.0826651 0.101105 0.14464 0.187062 0.216724 0.298001 0.0436298 0.120463 0.206091 0.0714277 0.0324691 0.291542 0.316279 0 0.0455816 0.138288 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073335 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top