Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073323 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073323
Unique NameTCONS_00073323
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length384

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073323 ID=TCONS_00073323|Name=TCONS_00073323|organism=Clytia hemisphaerica|type=transcript|length=384bp
CAGAGTGGTAAATCGACTTACCTAAGACAGATTGCACTTCTCCAAATCAT
GGCACAGTGTGGTTCGTTTGTGCCCGCGGCTTACGCTTCTTTCCGCCTGT
GTAAACAAGTCTTTGTTCGAATTGGTAGTGATGATGACATTGAAACCAAT
TGCTCCACTTTTAAACTCGAGatGAAAGAAATGCATTATATTTTACAGAA
CATCACGGATAGCTCACTGTTAATCATAGATGAATTAGGAAGAGGTACTG
GAATAGCTGAAGGCGTAGGAATTTCTTACAGTATTTGTGAAAAACTCATT
TCAACAAAGGCATTTACATTCTTCGCCACTCACTTCCTGGAATTGTGCGA
TCTCTCAAATGTTTATCACAATgttgaaaagtaa
Run BLAST on NCBI

protein sequence of TCONS_00073323-protein

>TCONS_00073323-protein ID=TCONS_00073323-protein|Name=TCONS_00073323-protein|organism=Clytia hemisphaerica|type=polypeptide|length=127bp
QSGKSTYLRQIALLQIMAQCGSFVPAAYASFRLCKQVFVRIGSDDDIETN
CSTFKLEMKEMHYILQNITDSSLLIIDELGRGTGIAEGVGISYSICEKLI
STKAFTFFATHFLELCDLSNVYHNVEK
Run BLAST on NCBI

transcript from alignment at scaffold_9:312449..314794-

Legend: exonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073323 ID=TCONS_00073323|Name=TCONS_00073323|organism=Clytia hemisphaerica|type=transcript|length=2346bp|location=Sequence derived from alignment at scaffold_9:312449..314794- (Clytia hemisphaerica)
CAGAGTGGTAAATCGACTTACCTAAGACAGATTGCACTTCTCCAAATCAT GGCACAGTGTGGTTCGTTTGTGCCCGCGGCTTACGCTTCTTTCCGCCTGT GTAAACAAGTCTTTGTTCGAATTGGTAGTGATGATGACATTGAAACCAAT TGCTCCACTTTTAAACTCGAGGTAATATTTTTATACTGATTTGATGTATA CTACACCTTTATCCAAGAGTTGAGCAGTAAAGCCCGAAAGACTCTTTCGC TTTTTGATATATGAGATGATAAGTGACCCGGCAAACACATTTTTTTTTGC TTTACTAAATCATGCAGCAAACTCATGCAACTAAAGGCAAACCTTTTCCG TGATAATCAAGGTATTAAACTGTCTACTAAAAAAGGATTTCCCATGTAAA GTCTCTTTACCAGCCGACCGCGCCCGTAGGGATCAAATTTTCAAAATTTT CAAAATTTCCAAAAATACTTTTATTGGTATGCTCTTGTTACAAACCTTTG GATGGTCAGTGGTGTTATGATGGAGAGGCTTTTGGGACGCCCCCGGTCAT TAGCTAGATTTGATGAATGCGATTTTTATCTTTTTAGATGAAAGAAATGC ATTATATTTTACAGGTATTAAATCTTGTATATCGTTTTTTTAGTATTATT TTTGTTTTCAAGAAAATTCCAAAAGATTGAATCGGGTAAGATATTTCAAC GTCTAAACTTTATTTTACATCTTCGATTTTTCAGAACATCACGGATAGCT CACTGTTAATCATAGATGAATTAGGAAGAGGTAAGAGTTATTTGCTCGTA ACTTGAGAATAGCGTATACCCGCAAAGCTAACTTACTATCTCTCTCTCTC TCTCTCTCTATACCATCTAATAGACATTAATATTGATTGTGATACCATGG AAGAATCTGTTGTAAAGAAATTTGTCTATAACAAAAAAGTTTATCAATGT TTTTGAATGATTGTACGAACCATCGAGTTCACGAACAAGAAAGAATTCTA ATTGACGTCAGTTTTGAATGATTCAATTTTGACCTCTTTTTAAGAAAACC TCATTACTTTACAAAAAATTCATTTCAGACATTGAGATTTTCAGAAGTGC TCTGAATTAAGTCAGAGTTTAGCCAGACAAAACTTGAAATTGATAGCACA ACTAGAGTCTACGTTAAAATTTGAAAATCAGGCAAAAATATAGAAATGTA GTGTTTCCGGAATGTGGGTGAAGGAAAAAAGCTCTCATGCAGCCGGCCGG AAAAATCTTTTTTTTGCTATTTTTGATAACTTAAGATCATTGAAATTAGA ACTTTAAAGATAACATTTATGTAAAACAGTATGTAGTAAGCCTTCTGCTA CTAACTACTAACAAAGTCTGCGGCCGGGTCAGAAAATTATTTTTTTTCAC CCGGCTGGTTTCTGGAAACACTACATTTTTTTATTTTCGCCTTATGGAAA AATTTTTTGGACCACCCGTTATATGATGATTTCACGCAAAAAGTCAGGAT TTCAAAAACTGATTAGAATTATGATGGGTGTATCGTTTATCTTTGCGGTT AAAAAATTGTTGCAGTAATTTATTGATCGGTCGAGGATCGTTCGAGTGTT TTTAATTACACCGTGGGTGCCTTACAAAGGTTTTCAACTTATTTCTAGGT ACTGGAATAGCTGAAGGCGTAGGAATTTCTTACAGTATTTGTGAAAAACT CATTTCAACAAAGGTTTGTTTCTTACCTATATCTATGCGTACGTTTGCGT ATTGTCCGATTGATTTTATCCACCTTGAAAATCCTCCCATTCACGCAAAA TTTTAATGATCAAACTATAACTTTTTTCTGATAGCGGACTTCTAGCTTGA AGACTGAGTGAGACTCTAAAGTCATTCGTAAAGCTTGTGTTCTGCTCTAC CGACTTAGCATTGTTTTCAATGACATGGATTCCTTGTTCGGGAATAGCCC TGGTTTTCGAACAAATCACTCAATTGAAGACTCTTCTTACTTAAGTCAAC TAAAACAAGACGAGTTCGGTTGAGTGAAGTGAGTTTAGACTAATACCATC GTGCTACAGTTGTCTTTTGTACTAGGGATCTNTTAAGTCAACTAAAACAA GACGAGTTCGGTTGAGTGAAGTGAGTTTAGACTAATACCATCGTGCTACA GTTGTCTTTTGTACTAGGGATCTCTTTCGCAAATTAACGTCACTTTCAGA ACTCGTTTATAAGTAGGAAAAGCTATTTTTACTTACAGTTCTGAAATCAA TTATAATCCACCTTCTTTCAGGCATTTACATTCTTCGCCACTCACTTCCT GGAATTGTGCGATCTCTCAAATGTTTATCACAATGTTGAAAAGTAA

Coding sequence (CDS) from alignment at scaffold_9:312449..314794-

>TCONS_00073323 ID=TCONS_00073323|Name=TCONS_00073323|organism=Clytia hemisphaerica|type=CDS|length=1920bp|location=Sequence derived from alignment at scaffold_9:312449..314794- (Clytia hemisphaerica)
GCATTTACATTCTTCGCCACTCACTTCCTGGAATTGTGCGATCTCTCAAA
TGTTTATCACAATGTTGAAAAGTAAGTACTGGAATAGCTGAAGGCGTAGG
AATTTCTTACAGTATTTGTGAAAAACTCATTTCAACAAAGAACATCACGG
ATAGCTCACTGTTAATCATAGATGAATTAGGAAGAGATGAAAGAAATGCA
TTATATTTTACAGCAGAGTGGTAAATCGACTTACCTAAGACAGATTGCAC
TTCTCCAAATCATGGCACAGTGTGGTTCGTTTGTGCCCGCGGCTTACGCT
TCTTTCCGCCTGTGTAAACAAGTCTTTGTTCGAATTGGTAGTGATGATGA
CATTGAAACCAATTGCTCCACTTTTAAACTCGAGGCATTTACATTCTTCG
CCACTCACTTCCTGGAATTGTGCGATCTCTCAAATGTTTATCACAATGTT
GAAAAGTAAGTACTGGAATAGCTGAAGGCGTAGGAATTTCTTACAGTATT
TGTGAAAAACTCATTTCAACAAAGAACATCACGGATAGCTCACTGTTAAT
CATAGATGAATTAGGAAGAGATGAAAGAAATGCATTATATTTTACAGCAG
AGTGGTAAATCGACTTACCTAAGACAGATTGCACTTCTCCAAATCATGGC
ACAGTGTGGTTCGTTTGTGCCCGCGGCTTACGCTTCTTTCCGCCTGTGTA
AACAAGTCTTTGTTCGAATTGGTAGTGATGATGACATTGAAACCAATTGC
TCCACTTTTAAACTCGAGGCATTTACATTCTTCGCCACTCACTTCCTGGA
ATTGTGCGATCTCTCAAATGTTTATCACAATGTTGAAAAGTAAGTACTGG
AATAGCTGAAGGCGTAGGAATTTCTTACAGTATTTGTGAAAAACTCATTT
CAACAAAGAACATCACGGATAGCTCACTGTTAATCATAGATGAATTAGGA
AGAGATGAAAGAAATGCATTATATTTTACAGCAGAGTGGTAAATCGACTT
ACCTAAGACAGATTGCACTTCTCCAAATCATGGCACAGTGTGGTTCGTTT
GTGCCCGCGGCTTACGCTTCTTTCCGCCTGTGTAAACAAGTCTTTGTTCG
AATTGGTAGTGATGATGACATTGAAACCAATTGCTCCACTTTTAAACTCG
AGGCATTTACATTCTTCGCCACTCACTTCCTGGAATTGTGCGATCTCTCA
AATGTTTATCACAATGTTGAAAAGTAAGTACTGGAATAGCTGAAGGCGTA
GGAATTTCTTACAGTATTTGTGAAAAACTCATTTCAACAAAGAACATCAC
GGATAGCTCACTGTTAATCATAGATGAATTAGGAAGAGATGAAAGAAATG
CATTATATTTTACAGCAGAGTGGTAAATCGACTTACCTAAGACAGATTGC
ACTTCTCCAAATCATGGCACAGTGTGGTTCGTTTGTGCCCGCGGCTTACG
CTTCTTTCCGCCTGTGTAAACAAGTCTTTGTTCGAATTGGTAGTGATGAT
GACATTGAAACCAATTGCTCCACTTTTAAACTCGAGGCATTTACATTCTT
CGCCACTCACTTCCTGGAATTGTGCGATCTCTCAAATGTTTATCACAATG
TTGAAAAGTAAGTACTGGAATAGCTGAAGGCGTAGGAATTTCTTACAGTA
TTTGTGAAAAACTCATTTCAACAAAGAACATCACGGATAGCTCACTGTTA
ATCATAGATGAATTAGGAAGAGATGAAAGAAATGCATTATATTTTACAGC
AGAGTGGTAAATCGACTTACCTAAGACAGATTGCACTTCTCCAAATCATG
GCACAGTGTGGTTCGTTTGTGCCCGCGGCTTACGCTTCTTTCCGCCTGTG
TAAACAAGTCTTTGTTCGAATTGGTAGTGATGATGACATTGAAACCAATT
GCTCCACTTTTAAACTCGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045489XLOC_045489Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073323-proteinTCONS_00073323-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073323-exon-scaffold_9-1575043694:314624..314794TCONS_00073323-exon-scaffold_9-1575043694:314624..314794Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1575043694:314181..314207TCONS_00073323-exon-scaffold_9-1575043694:314181..314207Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1575043694:314015..314060TCONS_00073323-exon-scaffold_9-1575043694:314015..314060Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1575043694:313082..313146TCONS_00073323-exon-scaffold_9-1575043694:313082..313146Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1575043694:312449..312523TCONS_00073323-exon-scaffold_9-1575043694:312449..312523Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1510915933:314624..314794TCONS_00073323-exon-scaffold_9-1510915933:314624..314794Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1510915933:314181..314207TCONS_00073323-exon-scaffold_9-1510915933:314181..314207Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1510915933:314015..314060TCONS_00073323-exon-scaffold_9-1510915933:314015..314060Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1510915933:313082..313146TCONS_00073323-exon-scaffold_9-1510915933:313082..313146Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1510915933:312449..312523TCONS_00073323-exon-scaffold_9-1510915933:312449..312523Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1491911889:314624..314794TCONS_00073323-exon-scaffold_9-1491911889:314624..314794Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1491911889:314181..314207TCONS_00073323-exon-scaffold_9-1491911889:314181..314207Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1491911889:314015..314060TCONS_00073323-exon-scaffold_9-1491911889:314015..314060Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1491911889:313082..313146TCONS_00073323-exon-scaffold_9-1491911889:313082..313146Clytia hemisphaericaexon
TCONS_00073323-exon-scaffold_9-1491911889:312449..312523TCONS_00073323-exon-scaffold_9-1491911889:312449..312523Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:312449..314794 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.93377 8.10544 9.18165 10.1057 2.46053 1.51227 4.95219 6.10023 3.92924 8.46435 5.5456 4.86061 2.69659 5.60086 3.33839 3.82968 4.71785 6.08355 0.646519 3.38268 4.31224 4.30232 6.50849 6.76247 25.2488 22.7282 5.00369 3.26338 4.50029 2.06329
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000432DNA_mismatch_repair_MutS_C
IPR027417P-loop_NTPase
Vocabulary: Biological Process
TermDefinition
GO:0006298mismatch repair
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0030983mismatched DNA binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006298 mismatch repair
molecular_function GO:0005524 ATP binding
molecular_function GO:0030983 mismatched DNA binding
Blast
BLAST of TCONS_00073323 vs. Swiss-Prot (Human)
Match: MSH4 (MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 3.079e-54
Identity = 85/125 (68.00%), Postives = 100/125 (80.00%), Query Frame = 1
Query:    4 SGKSTYLRQIALLQIMAQCGSFVPAAYASFRLCKQVFVRIGSDDDIETNCSTFKLEMKEMHYILQNITDSSLLIIDELGRGTGIAEGVGISYSICEKLISTKAFTFFATHFLELCDLSNVYHNVE 378
            SGKSTYL+QIAL QIMAQ GS+VPA Y+SFR+ KQ+F RI +DDDIETN STF  EMKE+ YIL N  D SL++IDELGRGT   EG+GI Y++CE L+S KAFT FATHFLELC +  +Y NVE
Sbjct:  684 SGKSTYLKQIALCQIMAQIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVE 808          
The following BLAST results are available for this feature:
BLAST of TCONS_00073323 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MSH43.079e-5468.00MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=... [more]
back to top