Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073320 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073320
Unique NameTCONS_00073320
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2313

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073320 ID=TCONS_00073320|Name=TCONS_00073320|organism=Clytia hemisphaerica|type=transcript|length=2313bp
TTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTT
CTCGATCACTGGAGCAGTAAGTGTGAAATATGCTGGTGTGTTATCCATAA
TTGTTATTGGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGAT
ATAACAGTTCCTGTAaaATCCGTATACAAACATATTACAGCAAGGTTTAT
ATTCCTGATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAA
tgttgtcagttctacagaagACTGGACTTCATGATGGTTTGATGTCAAGT
TCCTTTCAAAAGACGTTAGAgGGTGGATTAGAATCGATCACTAAAAACCA
AGCACAAATTATTTCTTATGGGTCACATATCACATTAAGGAACACGCATT
CAAAACAGTGTTGGTTGCATTCACACAAACATTTGTATCCAGTGAAATAC
GAAGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCACATGTTATGCATT
TAAAGATATCAATAACTGGTTTATTGTCAAACATCCGGACAGCGATTCGT
TGAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCAT
TTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGCCACGATGTAGGCGC
TCCTGTGAATCCGACATTGATGGAAATATCAGGATATGTAGATCACAATG
TGTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATCCTGAT
GAGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTGCACGT
CAATACGTCAGCTGCTATTAAGGTTTCAGGATCTACTCTTCCAGAATGGG
GATTTCGACAATACGAGGTTGGAACAGACCGAAGAATCAACACACAAGAA
TCAATATGGAACGTTGAAGAACATAatcaaaatgtcacaaaacCGGAAGA
TATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGCAGAACGAT
ATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGAAATTCTTG
GAATATCAGATTAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGCA
TGCGTTTGCGTCCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTG
CTTACTGGCTTGATACATACACCAATAAACAAATCTTTATTATTGGCAAT
CCAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTT
GTTGGCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATA
ATGCTGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGT
TTCTTGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTT
ACACAATTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGATGT
TGATGGACCATGTTCATTCGGTCTGGTTCAAGAATTTTCCAATCCTTCAA
TACGGTGTGAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGT
GTTTCAATATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAA
GGGACATCGAACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCAT
agataatccttttttttttagaaaacgcTTGTTTAGGtatcatattttta
ttttattacaaTAAAGTTCAtgatagacgatatcggcttaacgtgaaaac
tcagatttgacctccgaaaattgcccacaatgctttgcgcgaaAAAATGT
GTTCAcggtgaaatatttttcacacaAAGAGTGTCATGGAGAATTCTCGA
GGGTCAAATCTGAATTTTCAtgtaaagccgatatcgtctattgtcaTCAG
ATAAACTGTCATTCGCATGATAGTATAATGAAAACTAGCCTAACTCTCCA
TTTTGACAACCAGTAATGGGATTTATTTACTTATCCGGGAAATTAAATCC
GCGTTAGTtagttttctatttttattaagTTTATTCGCTTAATGGTGTTT
TTTAATATAGTTTACCAAATGAGTGAAGTTTGCTTCCAAAGTAGGGTTTG
TATAAATTTTTAGTGTGTTgtaatttcaagttttttgagGGCATATCGTC
TGTATTATGTAATGGATTTTATAgggtttttggaagattttttgtaaaat
atttttttgttttttgaataattatttattttaagTGAAATTTTAGTTAT
ATATCCTCAAATTGTATCAGGCTACACAAattagtaaaataaaaaaaaag
cttaactttCAAT
Run BLAST on NCBI

protein sequence of TCONS_00073320-protein

>TCONS_00073320-protein ID=TCONS_00073320-protein|Name=TCONS_00073320-protein|organism=Clytia hemisphaerica|type=polypeptide|length=551bp
FRPFGWNWWKYLFLLGFSITGAVSVKYAGVLSIIVIGALIGYELWLLVGD
ITVPVKSVYKHITARFIFLIVMPIVLYIGQFYIMLSVLQKTGLHDGLMSS
SFQKTLEGGLESITKNQAQIISYGSHITLRNTHSKQCWLHSHKHLYPVKY
EDGRGSSAQQQVTCYAFKDINNWFIVKHPDSDSLKVDFPPRPVKNGDVIH
LVHGLTGRGISSHDVGAPVNPTLMEISGYVDHNVSMDAQYGWKLQIVNPD
ESELWRAIGSQVRFVHVNTSAAIKVSGSTLPEWGFRQYEVGTDRRINTQE
SIWNVEEHNQNVTKPEDMSDEEAKRVLSEHAERYQVSGKTHAMSFFQKFL
EYQIKMFKVNNDLTNGHAFASKPMHWPLMLKGVAYWLDTYTNKQIFIIGN
PIVYWLGAISLLIYMALLALYLLRRKRQCYDLDNAEWNNFSIGCYLLIGG
FLLNWLPYFPVERTLFLHNYLPALIFKIILIPMLMDHVHSVWFKNFPILQ
YGVKAASVLIVGLVVFVFQYFSAFTYGVTALSQRDIEQKRWLSSWRFMIH
R
Run BLAST on NCBI

transcript from alignment at scaffold_9:257991..265395-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073320 ID=TCONS_00073320|Name=TCONS_00073320|organism=Clytia hemisphaerica|type=transcript|length=7405bp|location=Sequence derived from alignment at scaffold_9:257991..265395- (Clytia hemisphaerica)
TTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTT CTCGATCACTGGAGCAGTAAGGTAAATATCCCTTAAATTTCTCTTTCATT TTTCCCCACCATTCTAATCATCGAAAAGAAATCAAAGAATCTTTTTAACA CTATCTTAAAAACTTTTACTAAAATTTCAGTGTGAAATATGCTGGTGTGT TATCCATAATTGTTATTGGAGCTTTGATTGGATACGAGTTATGGTTGTTA GTTGGAGATATAACAGTTCCTGTAGTAAGTGATTCCTTGTGCCTAAAGTG GACAAAAAAAATTTCATCTCATTTATATGGACTTACCAAAAGTCCCAGTT TCAAAAAAAGAGTAGCACAAAAACAGCCTTTGAGGGATTTTACCCTGGTA TTTTCAGCCAATAATGAATATCTTCGATTCCTGCCAACTTCTATGTATTA TACTACATTTACCAGGCTGATTACCATGGAACTGAGTTTGCTGGTAACAC ATTTCATTGTAAACGTTTTGAATAACTTATACTTTCTTATTTGCTCGTCT TCTGATGCATCATTCAAGGAAAAGGATGGTAGATCTCTTGAAACTCAACA AGTTTTTTCTTTCAATTTAGAAATCCGTATACAAACATATTACAGCAAGG TTTATATTCCTGATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTA CATAATGTTGTCAGTTCTACAGAAGACTGGACTTCATGATGGTTTGATGT CAAGTTCCTTTCAAAAGACGTTAGAGGTTTGTTTATAATTTTTGTTGTAC AAAAAATCTCGATTATATGTAGAAATATTATTCAAAATTGCTATATTCGA AACTTTGTTCCTCTAGAGATCTTTGCATATCATGTCTTTTTTCACTAGCG ACTCTTGTCCAAACAGTGTGAAATATTTTGTTAATATCTGTTTTTATAGG GTGGATTAGAATCGATCACTAAAAACCAAGCACAAAGTTAGTGTACATGT TTCTGCTTGTTTTTATTAAATCGTATATGTTTCTCATGTTGTTCATCATT ATTTTAGCTTGCAAGAGTTGGTGCATTTTTTTTTTAATACCTGAACATTC TTTAAATCAGAAACAAAAGTTTTTATTGAATATTTCTAGATGGACTTTCC AATTTTCTCAGACATATCTTGATAAAAACTGACTTTGTATTTAGTTTTTG TATGATTTTGTTTTACATTTTGTTTTCAGTTATTTCTTATGGGTCACATA TCACATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTCACACAAA CATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGCA ACAAGTCACATGTTATGCATTTAAAGATATCAATAACTGGTTTATTGTCA AACATCCGGACAGGTGTGGTTATCAGGTTCTTTAAGGACTTCATGTACTC CATTTCCACTGGAAATACCAGTATAATATCCCAGTTGTTTTGAGAGCACC ACTCCTCTCCCTTCATCAATATGAGCTTTAAAATGAGCTTCATGATCAAA AGAAACTTTGTAGCTAGAATCAGAGTTGAAAGAGAACACTATTACACTAT TAACTATTAACTATGATAGAAGCAAAGGAACTTTNTATAAAGTATATGCT TATAAAAAATGAATATGCTCATATTGTACGCCATCCCTTGTTTACTTCGT AAGAACTAATTACCGAAAGGATTTTCACCGTCTATCAAGAGTTATTGATT TGATTCTTATAAAGTATATGCTTATAAAAAATAAATATACTCATATTGCA CGCCATCCCTTATTTACTTTGTAAGAACTAATTACCGAAAGATATATCAC CGTCTATCAAGAGTTATTGATTTGATTCTTATAAAGTAAATGCTTATAAG AAAAATGAATATGCTCATATTGTGCGCCATCCCTTGTTTACTTTGTAAGA ACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNAATAACCGAAAGGTATGTCACCGTCTATCAAGAGTT ATTGATTTGATTCTTATAAAGTATATGCTTATAAGAAAATAAAGAAAAAA TCAAAACTGTGAATCTAAAAACATAAAGATATATGACGTAATCCAAAGAA AATCTGCGAAAGTCGTCCGTAGTTATACGAGCGTGTAATTTGTAAATTGA TTTTAGTGAGTTCGTCCACCGTATCAAGTACTTTAGTTTTCTAATTATTT TTCCTCACCGCCGCAGAATGCTGATTGTAATACTTTCGCTAAGGCGAAAT TAATAAATCAAGTCCATGAATTCACAAAAATTCACTTTTGACAAATACGT CTGAGTATTTATTCATGTATCTTCTCGTTCTAAAAACTACAAATTTCAAC GTAAGGTTCTGAACCAACTCTTTTATTTGTATTTTTCATAGCGATTCGTT GAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCATT TGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGGTAAATCCTTCTTTAT TGGATTCGATTGATATATTTCTTCATAGCATCTTTGGGAAACAGATACAG ATTTAAGCTAAGTATTGGAGGAGTGCACTATTCTTTTGATTGGGTTGTGA TTGACGGCGAATGTTGATGACCTTGTTGGTTGGTTGGTTCATCGTTGACG GGAGGGATATTTAAGGTTCCTGTTGTTTGTGATTCAGGTGATGCGCTTAA ATTTATTAGATTCTCGTTTCGAGATTTGACATGACTAGATTCTAGATACA AAGTAATAAGTGGCCAAATATAATAGGTTGCAGATCAGGGTTAAACACCA AGAAGCTGGTGATTTTGAAGAAATCTTGGTTCGACGAAGATATATACTTT CTCTTGTTTTCAGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGATG GAAATATCAGGATATGTAGATCACAATGTGTCCATGGATGCTCAGTATGG TTGGAAACTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTA TCGGATCACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAG GTTAGTGTTATGCAGTAGATTGGTGGGTCGTTGGAATTTTGGTATCCTCT TTTAAAAGTCAAATATATTTGTAAAAATGACGCGAGAGAGTGAGCATGAA TATTTTTGGGTATTCTCACTCTTTTTGGCTGAAAACTGTTGGTTTTAAGT GTGTAAAAGATCGAAGGGACTCCAAAATTAGTAAACAGAGGCGCCTAGTT TTCCGAACCTTGTCTTTCGAGGTCCCCAAAAATTCGGCCGCTGGGGAGGG CATCCCCCTGCCACCAAGCTACTCTGATGGTCTTATGTATGATTCTTCGA GCATTACCGTTTTTAGTAGATATAATCTATATGAAAGACATCGTATGTCG TATGTGTTCAGTTTTAAACACATGCGACTAGTGCTTTACGCGTTGAAAGA CTACTGTTCTCGACAAGTGCTAAGAAACTAAAAATTGTTTCGATTTCAAT ACAAATTATTTCAATCTAAACATACACGTCTTATTATTATAATATTTAAT GGTTATTCTTTGAAAATTTGTAGGTTTCAGGATCTACTCTTCCAGAATGG GGATTTCGACAATACGAGGTACGTGCTCATGTCATTAAATTTACCAGATG CAAAATACAGCTGTAAGGGCGATGTCATTCTCCTTCTCGGTCACTATAAA AATGTAACTTCATCAATGCTTAGCTCTATTTTAGACAGCCCACTTTTCGC CCTACCTTTTCTAATTGTGAATTAAAGCTGGCAAATAGTTGGCTGTCTAA AGTTAATGTATAGCCCTCTTTTGAAGTCAATGCAATGTCTTCTTTCAATC TTTTCCAAACAAAGATTTTAACTGCCAACTTTCTGCCTACTTGCCTATTT TAACAACTAGAATAGGCAGGGCATAAAGTCGGCTGTCTAAACTAGAGCTA AAATTTACAGCGTCATTCGTTCGAACCTTCATTTTCTTTCTACTGTTTAG GTTGGAACAGACCGAAGAATCAACACACAAGAATCAATATGGAACGTTGA AGAACATAATCAAAATGTCACAAAACGTAAGTCGCCTTTTAAAGTATGAG ACTAAAATTTGTCTTGGCAGAGTATTAGATAGAAAACGAGTTATCCAACC ATAAGGCCGTTTACATTGACTTATTCGGGATTTTTTTCTTCAATTAAATT CTTTGTCCTGTAAATGACAAATTGTTTATTTCATACCATGTTCTACTAGC GGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGCAG AACGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGAAA TTCTTGGAATATCAGGTAACAGTGGTCAAAAAGCTTGTTTTTCATAAGGA TACAAGTGCTGACGAAATAGTTTATTATGTCATCTTAAAATCGGGTATAT GTTTAATTATTTTGGGGTATTGACTATTGAGTTTTTTTTCGCAACTAATA TTTTTTCGCCGAATGGAAGGATATTTCTCAGAGAACCCTTATATAATTTC AATTACAGTGAAGTCCTCATGACTCCAACCTTTATAACTCGAATTTCTCC TTAACTCGAACAAGTTTTCTGGTCCTTTCAGCTAACAATTCCTAATATAT TCTCCATAACTCGAAATTCCCAAAATTGGAGTAAATTTATGTTCCCCGTG CGTATTCGATTTATGAAGACTCCACTGAATATTTACTTAATCTACTGTAG ATTATACGATGATTATTTTCAGATTAAAATGTTCAAAGTCAACAATGATC TAACGAACGGGCATGCGTTTGCGTCCAAACCTATGCATTGGCCACTCATG TTGAAAGGAGTTGCTTACTGGCTTGATACATACACCAATGTAAGTAAAAT CTACTCTGTTGTGTTCTAAATTTCTTAAAACATGACTAGCTTAAAGGACA TCAATTATACCATTTGCTTTCATAGCATTTTTAATCAAAAGGACGAAAGA CTTTTTTCTACACCCGCGCCGCGAGAACACAAAATTTTAGAAATTATTTT TCTTAGTTCTGCTCTGTTGAGATGTCCTCGTCCTTTCTATANAAAACCCT TTTTCTACTCCCGCGCCGCGCGAACACAAAATTTTAGAAATAATTTTTCT TAGTTCTGCTTTGTTAAGATGCGCTCCTCCTTTCTATATCACATAAAATG TATCAAAGAAGAATTTCTTAAAACATGACTAGCTTAAAAGACATCAATTA GACCATTTGCTCATACATAGAATTTTTAAACAAAAAAGCTTTCACTGGGA AATTCTTTTGTTTATTTTGCTTTGTCAACATAAGAGGCACACCTTCTTTT TATATCATAATAATGAACTCAAACTCCTTACGAAACTTAATAGTTGTTAA TTCTTTAGGGAATGAAATCTTATAAAATTTCTTAACAACCGAATGAATAA AACATTTTGAAGAACTTGACTGAAGGATTTTGCGAAATTTTCAACGCAGT GAGCAGTCACCTACTTTGCTAACATGTTGTGATATTGCTGCTTTTGAGAA ATCTGATTATTTGTCTCTTTAGAAACAAATCTTTATTATTGGCAATCCAA TTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTG GCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAATGG TGAGTGAATTTTTCGTACTGATTTTACTTGAAATAAAAATCAGATTTTTG ATATTCAATGATGTCATCAGTAGCACATAAGTTGTGTGACTAACGCTGAA GAGGCAAATTTCAATTTGGTCAAACTGTACAGTGTCTTCTGCATCGAAAT TACTGTAGGAGTCCTTGGTACACTTTTCTTCTTGACGCCTTGCTGAAGAA GGTACTCTGGGAGAAAATCCATGAAATGGGGTGGGGGTCAATATTAAGTG ATTTTCCCAAAAACCCTTTTGAAAATGAAAGTATTTGCATTATATAATGC TATTGGGTTGTTTCTTTCCGAAAAATTGCAAAGTGACCCCCCCCTACAAT TAAAGGCTACACAGGCTACAAAGTTGCTTCCAGAAAGGCACTGGTGAAGT GTTGGCCTGTGTTTTCAGACACTAGATTACTAAACAGTAATCTTTATTCT GAAGTAATGGTTTTCCTACTTTAAATAAATGTCTTCAAATTTTCTTTTCC AGCTGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTT TCTTGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTTA CACAATTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGATGTT GATGGACCATGTTCATTCGGTCTGGTTCAAGTAAGTACGAAATGATCAAC AAACAAAACTTCTCTACATTATTTTACATTTTACATTATCGTACCGTAAG TTGGTCTAATATCGACATCCCTCATCTAAAAGTTTCGTGGATGTAAACGC CCTCTTTACTTTCTTCGTTACAGGAATTTTCCAATCCTTCAATACGGTGT GAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAAT ATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACATC GAACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCATAGATAATC CTTTTTTTTTTAGAAAACGCTTGTTTAGGTATCATATTTTTATTTTATTA CAATAAAGTTCATGATAGACGATATCGGCTTAACGTGAAAACTCAGATTT GACCTCCGAAAATTGCCCACAATGCTTTGCGCGAAAAAATGTGTTCACGG TGAAATATTTTTCACACAAAGAGTGTCATGGAGAATTCTCGAGGGTCAAA TCTGAATTTTCATGTAAAGCCGATATCGTCTATTGTCATCAGATAAACTG TCATTCGCATGATAGTATAATGAAAACTAGCCTAACTCTCCATTTTGACA ACCAGTAATGGGATTTATTTACTTATCCGGGAAATTAAATCCGCGTTAGT TAGTTTTCTATTTTTATTAAGTTTATTCGCTTAATGGTGTTTTTTAATAT AGTTTACCAAATGAGTGAAGTTTGCTTCCAAAGTAGGGTTTGTATAAATT TTTAGTGTGTTGTAATTTCAAGTTTTTTGAGGGCATATCGTCTGTATTAT GTAATGGATTTTATAGGGTTTTTGGAAGATTTTTTGTAAAATATTTTTTT GTTTTTTGAATAATTATTTATTTTAAGTGAAATTTTAGTTATATATCCTC AAATTGTATCAGGCTACACAAATTAGTAAAATAAAAAAAAAGCTTAACTT TCAAT

Coding sequence (CDS) from alignment at scaffold_9:257991..265395-

>TCONS_00073320 ID=TCONS_00073320|Name=TCONS_00073320|organism=Clytia hemisphaerica|type=CDS|length=23184bp|location=Sequence derived from alignment at scaffold_9:257991..265395- (Clytia hemisphaerica)
GAATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTAGTGTGTTGATCG
TCGGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCCTTCACTTATGGC
GTGACCGCCCTCTCACAAAGGGACATCGAACAAAAACGATGGCTTTCTTC
ATGGAGATTCATGATTCATAGATAACTGAATGGAATAATTTTTCGATCGG
TTGTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGTTACCATACTTCC
CTGTAGAACGAACCCTTTTCTTACACAATTATCTACCAGCGTTGATATTC
AAAATCATACTTATACCGATGTTGATGGACCATGTTCATTCGGTCTGGTT
CAAAAACAAATCTTTATTATTGGCAATCCAATTGTATATTGGTTAGGAGC
AATCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCTATCTACTCAGGA
GAAAACGACAGTGTTATGATTTGGATAATGATTAAAATGTTCAAAGTCAA
CAATGATCTAACGAACGGGCATGCGTTTGCGTCCAAACCTATGCATTGGC
CACTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACATACACCAATCGG
AAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGCAGAA
CGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGAAATT
CTTGGAATATCAGGTTGGAACAGACCGAAGAATCAACACACAAGAATCAA
TATGGAACGTTGAAGAACATAATCAAAATGTCACAAAACGTTTCAGGATC
TACTCTTCCAGAATGGGGATTTCGACAATACGAGCCACGATGTAGGCGCT
CCTGTGAATCCGACATTGATGGAAATATCAGGATATGTAGATCACAATGT
GTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATCCTGATG
AGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTGCACGTC
AATACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAGATTTTCCACCAA
GACCAGTAAAGAATGGTGATGTCATCCATTTGGTCCATGGTTTGACTGGG
CGTGGTATCAGTAGTTATTTCTTATGGGTCACATATCACATTAAGGAACA
CGCATTCAAAACAGTGTTGGTTGCATTCACACAAACATTTGTATCCAGTG
AAATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCACATGTTA
TGCATTTAAAGATATCAATAACTGGTTTATTGTCAAACATCCGGACAGGG
TGGATTAGAATCGATCACTAAAAACCAAGCACAAAAAATCCGTATACAAA
CATATTACAGCAAGGTTTATATTCCTGATTGTAATGCCTATTGTGTTGTA
TATTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGAAGACTGGACTTC
ATGATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTAGAGTGTGAAATA
TGCTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGATTGGATACGAGT
TATGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTCAGGCCTTTTGGA
TGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTCGATCACTGGAGC
AGTAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTAGTGTGT
TGATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCCTTCACT
TATGGCGTGACCGCCCTCTCACAAAGGGACATCGAACAAAAACGATGGCT
TTCTTCATGGAGATTCATGATTCATAGATAACTGAATGGAATAATTTTTC
GATCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGTTACCAT
ACTTCCCTGTAGAACGAACCCTTTTCTTACACAATTATCTACCAGCGTTG
ATATTCAAAATCATACTTATACCGATGTTGATGGACCATGTTCATTCGGT
CTGGTTCAAAAACAAATCTTTATTATTGGCAATCCAATTGTATATTGGTT
AGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCTATCTAC
TCAGGAGAAAACGACAGTGTTATGATTTGGATAATGATTAAAATGTTCAA
AGTCAACAATGATCTAACGAACGGGCATGCGTTTGCGTCCAAACCTATGC
ATTGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACATACACC
AATCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACAT
GCAGAACGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCA
GAAATTCTTGGAATATCAGGTTGGAACAGACCGAAGAATCAACACACAAG
AATCAATATGGAACGTTGAAGAACATAATCAAAATGTCACAAAACGTTTC
AGGATCTACTCTTCCAGAATGGGGATTTCGACAATACGAGCCACGATGTA
GGCGCTCCTGTGAATCCGACATTGATGGAAATATCAGGATATGTAGATCA
CAATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATC
CTGATGAGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTG
CACGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAGATTTTC
CACCAAGACCAGTAAAGAATGGTGATGTCATCCATTTGGTCCATGGTTTG
ACTGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCACATATCACATTAA
GGAACACGCATTCAAAACAGTGTTGGTTGCATTCACACAAACATTTGTAT
CCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCAC
ATGTTATGCATTTAAAGATATCAATAACTGGTTTATTGTCAAACATCCGG
ACAGGGTGGATTAGAATCGATCACTAAAAACCAAGCACAAAAAATCCGTA
TACAAACATATTACAGCAAGGTTTATATTCCTGATTGTAATGCCTATTGT
GTTGTATATTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGAAGACTG
GACTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTAGAGTGT
GAAATATGCTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGATTGGAT
ACGAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTCAGGCCT
TTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTCGATCAC
TGGAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTA
GTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCC
TTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACATCGAACAAAAACG
ATGGCTTTCTTCATGGAGATTCATGATTCATAGATAACTGAATGGAATAA
TTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGT
TACCATACTTCCCTGTAGAACGAACCCTTTTCTTACACAATTATCTACCA
GCGTTGATATTCAAAATCATACTTATACCGATGTTGATGGACCATGTTCA
TTCGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAATCCAATTGTATA
TTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCT
ATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAATGATTAAAAT
GTTCAAAGTCAACAATGATCTAACGAACGGGCATGCGTTTGCGTCCAAAC
CTATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACA
TACACCAATCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCG
GAACATGCAGAACGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTT
CTTCCAGAAATTCTTGGAATATCAGGTTGGAACAGACCGAAGAATCAACA
CACAAGAATCAATATGGAACGTTGAAGAACATAATCAAAATGTCACAAAA
CGTTTCAGGATCTACTCTTCCAGAATGGGGATTTCGACAATACGAGCCAC
GATGTAGGCGCTCCTGTGAATCCGACATTGATGGAAATATCAGGATATGT
AGATCACAATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTG
TGAATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGA
TTTGTGCACGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAG
ATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCATTTGGTCCAT
GGTTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCACATATCA
CATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTCACACAAACAT
TTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACA
AGTCACATGTTATGCATTTAAAGATATCAATAACTGGTTTATTGTCAAAC
ATCCGGACAGGGTGGATTAGAATCGATCACTAAAAACCAAGCACAAAAAA
TCCGTATACAAACATATTACAGCAAGGTTTATATTCCTGATTGTAATGCC
TATTGTGTTGTATATTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGA
AGACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTA
GAGTGTGAAATATGCTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGA
TTGGATACGAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTC
AGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTC
GATCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAG
CAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTC
TCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACATCGAACA
AAAACGATGGCTTTCTTCATGGAGATTCATGATTCATAGATAACTGAATG
GAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGA
ACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTTACACAATTAT
CTACCAGCGTTGATATTCAAAATCATACTTATACCGATGTTGATGGACCA
TGTTCATTCGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAATCCAAT
TGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGG
CACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAATGAT
TAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGCATGCGTTTGCGT
CCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTT
GATACATACACCAATCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTT
TTATCGGAACATGCAGAACGATATCAAGTGTCCGGTAAAACACATGCCAT
GTCTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAACAGACCGAAGAA
TCAACACACAAGAATCAATATGGAACGTTGAAGAACATAATCAAAATGTC
ACAAAACGTTTCAGGATCTACTCTTCCAGAATGGGGATTTCGACAATACG
AGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGATGGAAATATCAGG
ATATGTAGATCACAATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTC
AGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGATCACAA
GTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGA
AAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCATTTG
GTCCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCAC
ATATCACATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTCACAC
AAACATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACA
GCAACAAGTCACATGTTATGCATTTAAAGATATCAATAACTGGTTTATTG
TCAAACATCCGGACAGGGTGGATTAGAATCGATCACTAAAAACCAAGCAC
AAAAAATCCGTATACAAACATATTACAGCAAGGTTTATATTCCTGATTGT
AATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAATGTTGTCAGTTC
TACAGAAGACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAG
ACGTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAATTGTTATTGGAG
CTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCT
GTATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGG
CTTCTCGATCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTG
TGAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAA
TATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACAT
CGAACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCATAGATAAC
TGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCT
TGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTTACAC
AATTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGATGTTGAT
GGACCATGTTCATTCGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAA
TCCAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTT
TGTTGGCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGAT
AATGATTAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGCATGCGT
TTGCGTCCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTAC
TGGCTTGATACATACACCAATCGGAAGATATGTCAGACGAAGAAGCGAAA
AGAGTTTTATCGGAACATGCAGAACGATATCAAGTGTCCGGTAAAACACA
TGCCATGTCTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAACAGACC
GAAGAATCAACACACAAGAATCAATATGGAACGTTGAAGAACATAATCAA
AATGTCACAAAACGTTTCAGGATCTACTCTTCCAGAATGGGGATTTCGAC
AATACGAGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGATGGAAAT
ATCAGGATATGTAGATCACAATGTGTCCATGGATGCTCAGTATGGTTGGA
AACTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGA
TCACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAGCGATT
CGTTGAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATC
CATTTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATG
GGTCACATATCACATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCAT
TCACACAAACATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAG
TGCACAGCAACAAGTCACATGTTATGCATTTAAAGATATCAATAACTGGT
TTATTGTCAAACATCCGGACAGGGTGGATTAGAATCGATCACTAAAAACC
AAGCACAAAAAATCCGTATACAAACATATTACAGCAAGGTTTATATTCCT
GATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAATGTTGT
CAGTTCTACAGAAGACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTT
CAAAAGACGTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAATTGTTA
TTGGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGATATAACA
GTTCCTGTATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCT
TCTTGGCTTCTCGATCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAAT
ACGGTGTGAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTG
TTTCAATATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAG
GGACATCGAACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCATA
GATAACTGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTG
GTTTCTTGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTC
TTACACAATTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGAT
GTTGATGGACCATGTTCATTCGGTCTGGTTCAAAAACAAATCTTTATTAT
TGGCAATCCAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATA
TGGCTTTGTTGGCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGAT
TTGGATAATGATTAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGC
ATGCGTTTGCGTCCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTT
GCTTACTGGCTTGATACATACACCAATCGGAAGATATGTCAGACGAAGAA
GCGAAAAGAGTTTTATCGGAACATGCAGAACGATATCAAGTGTCCGGTAA
AACACATGCCATGTCTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAA
CAGACCGAAGAATCAACACACAAGAATCAATATGGAACGTTGAAGAACAT
AATCAAAATGTCACAAAACGTTTCAGGATCTACTCTTCCAGAATGGGGAT
TTCGACAATACGAGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGAT
GGAAATATCAGGATATGTAGATCACAATGTGTCCATGGATGCTCAGTATG
GTTGGAAACTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCT
ATCGGATCACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAA
GCGATTCGTTGAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGAT
GTCATCCATTTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTT
CTTATGGGTCACATATCACATTAAGGAACACGCATTCAAAACAGTGTTGG
TTGCATTCACACAAACATTTGTATCCAGTGAAATACGAAGATGGTAGAGG
GAGTAGTGCACAGCAACAAGTCACATGTTATGCATTTAAAGATATCAATA
ACTGGTTTATTGTCAAACATCCGGACAGGGTGGATTAGAATCGATCACTA
AAAACCAAGCACAAAAAATCCGTATACAAACATATTACAGCAAGGTTTAT
ATTCCTGATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAA
TGTTGTCAGTTCTACAGAAGACTGGACTTCATGATGGTTTGATGTCAAGT
TCCTTTCAAAAGACGTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAA
TTGTTATTGGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGAT
ATAACAGTTCCTGTATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTT
ATTTCTTCTTGGCTTCTCGATCACTGGAGCAGTAAGGAATTTTCCAATCC
TTCAATACGGTGTGAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTG
TTTGTGTTTCAATATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTC
ACAAAGGGACATCGAACAAAAACGATGGCTTTCTTCATGGAGATTCATGA
TTCATAGATAACTGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGA
TCGGTGGTTTCTTGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACC
CTTTTCTTACACAATTATCTACCAGCGTTGATATTCAAAATCATACTTAT
ACCGATGTTGATGGACCATGTTCATTCGGTCTGGTTCAAAAACAAATCTT
TATTATTGGCAATCCAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAA
TCTATATGGCTTTGTTGGCACTCTATCTACTCAGGAGAAAACGACAGTGT
TATGATTTGGATAATGATTAAAATGTTCAAAGTCAACAATGATCTAACGA
ACGGGCATGCGTTTGCGTCCAAACCTATGCATTGGCCACTCATGTTGAAA
GGAGTTGCTTACTGGCTTGATACATACACCAATCGGAAGATATGTCAGAC
GAAGAAGCGAAAAGAGTTTTATCGGAACATGCAGAACGATATCAAGTGTC
CGGTAAAACACATGCCATGTCTTTCTTCCAGAAATTCTTGGAATATCAGG
TTGGAACAGACCGAAGAATCAACACACAAGAATCAATATGGAACGTTGAA
GAACATAATCAAAATGTCACAAAACGTTTCAGGATCTACTCTTCCAGAAT
GGGGATTTCGACAATACGAGCCACGATGTAGGCGCTCCTGTGAATCCGAC
ATTGATGGAAATATCAGGATATGTAGATCACAATGTGTCCATGGATGCTC
AGTATGGTTGGAAACTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGG
AGAGCTATCGGATCACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGC
TATTAAGCGATTCGTTGAAAGTAGATTTTCCACCAAGACCAGTAAAGAAT
GGTGATGTCATCCATTTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAG
TTATTTCTTATGGGTCACATATCACATTAAGGAACACGCATTCAAAACAG
TGTTGGTTGCATTCACACAAACATTTGTATCCAGTGAAATACGAAGATGG
TAGAGGGAGTAGTGCACAGCAACAAGTCACATGTTATGCATTTAAAGATA
TCAATAACTGGTTTATTGTCAAACATCCGGACAGGGTGGATTAGAATCGA
TCACTAAAAACCAAGCACAAAAAATCCGTATACAAACATATTACAGCAAG
GTTTATATTCCTGATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTT
ACATAATGTTGTCAGTTCTACAGAAGACTGGACTTCATGATGGTTTGATG
TCAAGTTCCTTTCAAAAGACGTTAGAGTGTGAAATATGCTGGTGTGTTAT
CCATAATTGTTATTGGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTT
GGAGATATAACAGTTCCTGTATTCAGGCCTTTTGGATGGAACTGGTGGAA
GTATTTATTTCTTCTTGGCTTCTCGATCACTGGAGCAGTAAGGAATTTTC
CAATCCTTCAATACGGTGTGAAAGCAGCTAGTGTGTTGATCGTCGGATTG
GTTGTGTTTGTGTTTCAATATTTCTCCGCCTTCACTTATGGCGTGACCGC
CCTCTCACAAAGGGACATCGAACAAAAACGATGGCTTTCTTCATGGAGAT
TCATGATTCATAGATAACTGAATGGAATAATTTTTCGATCGGTTGTTATC
TGTTGATCGGTGGTTTCTTGTTGAACTGGTTACCATACTTCCCTGTAGAA
CGAACCCTTTTCTTACACAATTATCTACCAGCGTTGATATTCAAAATCAT
ACTTATACCGATGTTGATGGACCATGTTCATTCGGTCTGGTTCAAAAACA
AATCTTTATTATTGGCAATCCAATTGTATATTGGTTAGGAGCAATCTCTC
TGCTAATCTATATGGCTTTGTTGGCACTCTATCTACTCAGGAGAAAACGA
CAGTGTTATGATTTGGATAATGATTAAAATGTTCAAAGTCAACAATGATC
TAACGAACGGGCATGCGTTTGCGTCCAAACCTATGCATTGGCCACTCATG
TTGAAAGGAGTTGCTTACTGGCTTGATACATACACCAATCGGAAGATATG
TCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGCAGAACGATATCA
AGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGAAATTCTTGGAAT
ATCAGGTTGGAACAGACCGAAGAATCAACACACAAGAATCAATATGGAAC
GTTGAAGAACATAATCAAAATGTCACAAAACGTTTCAGGATCTACTCTTC
CAGAATGGGGATTTCGACAATACGAGCCACGATGTAGGCGCTCCTGTGAA
TCCGACATTGATGGAAATATCAGGATATGTAGATCACAATGTGTCCATGG
ATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATCCTGATGAGAGTGAA
CTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTGCACGTCAATACGTC
AGCTGCTATTAAGCGATTCGTTGAAAGTAGATTTTCCACCAAGACCAGTA
AAGAATGGTGATGTCATCCATTTGGTCCATGGTTTGACTGGGCGTGGTAT
CAGTAGTTATTTCTTATGGGTCACATATCACATTAAGGAACACGCATTCA
AAACAGTGTTGGTTGCATTCACACAAACATTTGTATCCAGTGAAATACGA
AGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCACATGTTATGCATTTA
AAGATATCAATAACTGGTTTATTGTCAAACATCCGGACAGGGTGGATTAG
AATCGATCACTAAAAACCAAGCACAAAAAATCCGTATACAAACATATTAC
AGCAAGGTTTATATTCCTGATTGTAATGCCTATTGTGTTGTATATTGGCC
AGTTTTACATAATGTTGTCAGTTCTACAGAAGACTGGACTTCATGATGGT
TTGATGTCAAGTTCCTTTCAAAAGACGTTAGAGTGTGAAATATGCTGGTG
TGTTATCCATAATTGTTATTGGAGCTTTGATTGGATACGAGTTATGGTTG
TTAGTTGGAGATATAACAGTTCCTGTATTCAGGCCTTTTGGATGGAACTG
GTGGAAGTATTTATTTCTTCTTGGCTTCTCGATCACTGGAGCAGTAAGGA
ATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTAGTGTGTTGATCGTC
GGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCCTTCACTTATGGCGT
GACCGCCCTCTCACAAAGGGACATCGAACAAAAACGATGGCTTTCTTCAT
GGAGATTCATGATTCATAGATAACTGAATGGAATAATTTTTCGATCGGTT
GTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGTTACCATACTTCCCT
GTAGAACGAACCCTTTTCTTACACAATTATCTACCAGCGTTGATATTCAA
AATCATACTTATACCGATGTTGATGGACCATGTTCATTCGGTCTGGTTCA
AAAACAAATCTTTATTATTGGCAATCCAATTGTATATTGGTTAGGAGCAA
TCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCTATCTACTCAGGAGA
AAACGACAGTGTTATGATTTGGATAATGATTAAAATGTTCAAAGTCAACA
ATGATCTAACGAACGGGCATGCGTTTGCGTCCAAACCTATGCATTGGCCA
CTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACATACACCAATCGGAA
GATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGCAGAACG
ATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGAAATTCT
TGGAATATCAGGTTGGAACAGACCGAAGAATCAACACACAAGAATCAATA
TGGAACGTTGAAGAACATAATCAAAATGTCACAAAACGTTTCAGGATCTA
CTCTTCCAGAATGGGGATTTCGACAATACGAGCCACGATGTAGGCGCTCC
TGTGAATCCGACATTGATGGAAATATCAGGATATGTAGATCACAATGTGT
CCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATCCTGATGAG
AGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTGCACGTCAA
TACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAGATTTTCCACCAAGA
CCAGTAAAGAATGGTGATGTCATCCATTTGGTCCATGGTTTGACTGGGCG
TGGTATCAGTAGTTATTTCTTATGGGTCACATATCACATTAAGGAACACG
CATTCAAAACAGTGTTGGTTGCATTCACACAAACATTTGTATCCAGTGAA
ATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCACATGTTATG
CATTTAAAGATATCAATAACTGGTTTATTGTCAAACATCCGGACAGGGTG
GATTAGAATCGATCACTAAAAACCAAGCACAAAAAATCCGTATACAAACA
TATTACAGCAAGGTTTATATTCCTGATTGTAATGCCTATTGTGTTGTATA
TTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGAAGACTGGACTTCAT
GATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTAGAGTGTGAAATATG
CTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGATTGGATACGAGTTA
TGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTCAGGCCTTTTGGATG
GAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTCGATCACTGGAGCAG
TAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTAGTGTGTTG
ATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCCTTCACTTA
TGGCGTGACCGCCCTCTCACAAAGGGACATCGAACAAAAACGATGGCTTT
CTTCATGGAGATTCATGATTCATAGATAACTGAATGGAATAATTTTTCGA
TCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGTTACCATAC
TTCCCTGTAGAACGAACCCTTTTCTTACACAATTATCTACCAGCGTTGAT
ATTCAAAATCATACTTATACCGATGTTGATGGACCATGTTCATTCGGTCT
GGTTCAAAAACAAATCTTTATTATTGGCAATCCAATTGTATATTGGTTAG
GAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCTATCTACTC
AGGAGAAAACGACAGTGTTATGATTTGGATAATGATTAAAATGTTCAAAG
TCAACAATGATCTAACGAACGGGCATGCGTTTGCGTCCAAACCTATGCAT
TGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACATACACCAA
TCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGAACATGC
AGAACGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCTTCCAGA
AATTCTTGGAATATCAGGTTGGAACAGACCGAAGAATCAACACACAAGAA
TCAATATGGAACGTTGAAGAACATAATCAAAATGTCACAAAACGTTTCAG
GATCTACTCTTCCAGAATGGGGATTTCGACAATACGAGCCACGATGTAGG
CGCTCCTGTGAATCCGACATTGATGGAAATATCAGGATATGTAGATCACA
ATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTGAATCCT
GATGAGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATTTGTGCA
CGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAGATTTTCCA
CCAAGACCAGTAAAGAATGGTGATGTCATCCATTTGGTCCATGGTTTGAC
TGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCACATATCACATTAAGG
AACACGCATTCAAAACAGTGTTGGTTGCATTCACACAAACATTTGTATCC
AGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACAAGTCACAT
GTTATGCATTTAAAGATATCAATAACTGGTTTATTGTCAAACATCCGGAC
AGGGTGGATTAGAATCGATCACTAAAAACCAAGCACAAAAAATCCGTATA
CAAACATATTACAGCAAGGTTTATATTCCTGATTGTAATGCCTATTGTGT
TGTATATTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGAAGACTGGA
CTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTAGAGTGTGA
AATATGCTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGATTGGATAC
GAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTCAGGCCTTT
TGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTCGATCACTG
GAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAGCAGCTAGT
GTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTCTCCGCCTT
CACTTATGGCGTGACCGCCCTCTCACAAAGGGACATCGAACAAAAACGAT
GGCTTTCTTCATGGAGATTCATGATTCATAGATAACTGAATGGAATAATT
TTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGAACTGGTTA
CCATACTTCCCTGTAGAACGAACCCTTTTCTTACACAATTATCTACCAGC
GTTGATATTCAAAATCATACTTATACCGATGTTGATGGACCATGTTCATT
CGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAATCCAATTGTATATT
GGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGGCACTCTAT
CTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAATGATTAAAATGT
TCAAAGTCAACAATGATCTAACGAACGGGCATGCGTTTGCGTCCAAACCT
ATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTTGATACATA
CACCAATCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTTATCGGA
ACATGCAGAACGATATCAAGTGTCCGGTAAAACACATGCCATGTCTTTCT
TCCAGAAATTCTTGGAATATCAGGTTGGAACAGACCGAAGAATCAACACA
CAAGAATCAATATGGAACGTTGAAGAACATAATCAAAATGTCACAAAACG
TTTCAGGATCTACTCTTCCAGAATGGGGATTTCGACAATACGAGCCACGA
TGTAGGCGCTCCTGTGAATCCGACATTGATGGAAATATCAGGATATGTAG
ATCACAATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTCAGATTGTG
AATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGATCACAAGTCAGATT
TGTGCACGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGAAAGTAGAT
TTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCATTTGGTCCATGG
TTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCACATATCACA
TTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTCACACAAACATTT
GTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGCAACAAG
TCACATGTTATGCATTTAAAGATATCAATAACTGGTTTATTGTCAAACAT
CCGGACAGGGTGGATTAGAATCGATCACTAAAAACCAAGCACAAAAAATC
CGTATACAAACATATTACAGCAAGGTTTATATTCCTGATTGTAATGCCTA
TTGTGTTGTATATTGGCCAGTTTTACATAATGTTGTCAGTTCTACAGAAG
ACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAGACGTTAGA
GTGTGAAATATGCTGGTGTGTTATCCATAATTGTTATTGGAGCTTTGATT
GGATACGAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCTGTATTCAG
GCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCTTCTCGA
TCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTGTGAAAGCA
GCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAATATTTCTC
CGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACATCGAACAAA
AACGATGGCTTTCTTCATGGAGATTCATGATTCATAGATAACTGAATGGA
ATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCTTGTTGAAC
TGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTTACACAATTATCT
ACCAGCGTTGATATTCAAAATCATACTTATACCGATGTTGATGGACCATG
TTCATTCGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAATCCAATTG
TATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTGTTGGCA
CTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAATGATTA
AAATGTTCAAAGTCAACAATGATCTAACGAACGGGCATGCGTTTGCGTCC
AAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTACTGGCTTGA
TACATACACCAATCGGAAGATATGTCAGACGAAGAAGCGAAAAGAGTTTT
ATCGGAACATGCAGAACGATATCAAGTGTCCGGTAAAACACATGCCATGT
CTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAACAGACCGAAGAATC
AACACACAAGAATCAATATGGAACGTTGAAGAACATAATCAAAATGTCAC
AAAACGTTTCAGGATCTACTCTTCCAGAATGGGGATTTCGACAATACGAG
CCACGATGTAGGCGCTCCTGTGAATCCGACATTGATGGAAATATCAGGAT
ATGTAGATCACAATGTGTCCATGGATGCTCAGTATGGTTGGAAACTTCAG
ATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGATCACAAGT
CAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAGCGATTCGTTGAAA
GTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCATTTGGT
CCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATGGGTCACAT
ATCACATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTCACACAA
ACATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTGCACAGC
AACAAGTCACATGTTATGCATTTAAAGATATCAATAACTGGTTTATTGTC
AAACATCCGGACAGGGTGGATTAGAATCGATCACTAAAAACCAAGCACAA
AAAATCCGTATACAAACATATTACAGCAAGGTTTATATTCCTGATTGTAA
TGCCTATTGTGTTGTATATTGGCCAGTTTTACATAATGTTGTCAGTTCTA
CAGAAGACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTTCAAAAGAC
GTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAATTGTTATTGGAGCT
TTGATTGGATACGAGTTATGGTTGTTAGTTGGAGATATAACAGTTCCTGT
ATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTCTTGGCT
TCTCGATCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAATACGGTGTG
AAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTTTCAATA
TTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGGACATCG
AACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCATAGATAACTG
AATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGTTTCTTG
TTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTTACACAA
TTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGATGTTGATGG
ACCATGTTCATTCGGTCTGGTTCAAAAACAAATCTTTATTATTGGCAATC
CAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATGGCTTTG
TTGGCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTTGGATAA
TGATTAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGCATGCGTTT
GCGTCCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTGCTTACTG
GCTTGATACATACACCAATCGGAAGATATGTCAGACGAAGAAGCGAAAAG
AGTTTTATCGGAACATGCAGAACGATATCAAGTGTCCGGTAAAACACATG
CCATGTCTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAACAGACCGA
AGAATCAACACACAAGAATCAATATGGAACGTTGAAGAACATAATCAAAA
TGTCACAAAACGTTTCAGGATCTACTCTTCCAGAATGGGGATTTCGACAA
TACGAGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGATGGAAATAT
CAGGATATGTAGATCACAATGTGTCCATGGATGCTCAGTATGGTTGGAAA
CTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTATCGGATC
ACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAGCGATTCG
TTGAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGTCATCCA
TTTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTTCTTATGGG
TCACATATCACATTAAGGAACACGCATTCAAAACAGTGTTGGTTGCATTC
ACACAAACATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGAGTAGTG
CACAGCAACAAGTCACATGTTATGCATTTAAAGATATCAATAACTGGTTT
ATTGTCAAACATCCGGACAGGGTGGATTAGAATCGATCACTAAAAACCAA
GCACAAAAAATCCGTATACAAACATATTACAGCAAGGTTTATATTCCTGA
TTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAATGTTGTCA
GTTCTACAGAAGACTGGACTTCATGATGGTTTGATGTCAAGTTCCTTTCA
AAAGACGTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAATTGTTATT
GGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGATATAACAGT
TCCTGTATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTATTTCTTC
TTGGCTTCTCGATCACTGGAGCAGTAAGGAATTTTCCAATCCTTCAATAC
GGTGTGAAAGCAGCTAGTGTGTTGATCGTCGGATTGGTTGTGTTTGTGTT
TCAATATTTCTCCGCCTTCACTTATGGCGTGACCGCCCTCTCACAAAGGG
ACATCGAACAAAAACGATGGCTTTCTTCATGGAGATTCATGATTCATAGA
TAACTGAATGGAATAATTTTTCGATCGGTTGTTATCTGTTGATCGGTGGT
TTCTTGTTGAACTGGTTACCATACTTCCCTGTAGAACGAACCCTTTTCTT
ACACAATTATCTACCAGCGTTGATATTCAAAATCATACTTATACCGATGT
TGATGGACCATGTTCATTCGGTCTGGTTCAAAAACAAATCTTTATTATTG
GCAATCCAATTGTATATTGGTTAGGAGCAATCTCTCTGCTAATCTATATG
GCTTTGTTGGCACTCTATCTACTCAGGAGAAAACGACAGTGTTATGATTT
GGATAATGATTAAAATGTTCAAAGTCAACAATGATCTAACGAACGGGCAT
GCGTTTGCGTCCAAACCTATGCATTGGCCACTCATGTTGAAAGGAGTTGC
TTACTGGCTTGATACATACACCAATCGGAAGATATGTCAGACGAAGAAGC
GAAAAGAGTTTTATCGGAACATGCAGAACGATATCAAGTGTCCGGTAAAA
CACATGCCATGTCTTTCTTCCAGAAATTCTTGGAATATCAGGTTGGAACA
GACCGAAGAATCAACACACAAGAATCAATATGGAACGTTGAAGAACATAA
TCAAAATGTCACAAAACGTTTCAGGATCTACTCTTCCAGAATGGGGATTT
CGACAATACGAGCCACGATGTAGGCGCTCCTGTGAATCCGACATTGATGG
AAATATCAGGATATGTAGATCACAATGTGTCCATGGATGCTCAGTATGGT
TGGAAACTTCAGATTGTGAATCCTGATGAGAGTGAACTGTGGAGAGCTAT
CGGATCACAAGTCAGATTTGTGCACGTCAATACGTCAGCTGCTATTAAGC
GATTCGTTGAAAGTAGATTTTCCACCAAGACCAGTAAAGAATGGTGATGT
CATCCATTTGGTCCATGGTTTGACTGGGCGTGGTATCAGTAGTTATTTCT
TATGGGTCACATATCACATTAAGGAACACGCATTCAAAACAGTGTTGGTT
GCATTCACACAAACATTTGTATCCAGTGAAATACGAAGATGGTAGAGGGA
GTAGTGCACAGCAACAAGTCACATGTTATGCATTTAAAGATATCAATAAC
TGGTTTATTGTCAAACATCCGGACAGGGTGGATTAGAATCGATCACTAAA
AACCAAGCACAAAAAATCCGTATACAAACATATTACAGCAAGGTTTATAT
TCCTGATTGTAATGCCTATTGTGTTGTATATTGGCCAGTTTTACATAATG
TTGTCAGTTCTACAGAAGACTGGACTTCATGATGGTTTGATGTCAAGTTC
CTTTCAAAAGACGTTAGAGTGTGAAATATGCTGGTGTGTTATCCATAATT
GTTATTGGAGCTTTGATTGGATACGAGTTATGGTTGTTAGTTGGAGATAT
AACAGTTCCTGTATTCAGGCCTTTTGGATGGAACTGGTGGAAGTATTTAT
TTCTTCTTGGCTTCTCGATCACTGGAGCAGTAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045486XLOC_045486Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073320-proteinTCONS_00073320-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073320-exon-scaffold_9-1575043694:265325..265395TCONS_00073320-exon-scaffold_9-1575043694:265325..265395Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:265122..265215TCONS_00073320-exon-scaffold_9-1575043694:265122..265215Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:264620..264775TCONS_00073320-exon-scaffold_9-1575043694:264620..264775Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:264410..264446TCONS_00073320-exon-scaffold_9-1575043694:264410..264446Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:263983..264166TCONS_00073320-exon-scaffold_9-1575043694:263983..264166Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:262862..262954TCONS_00073320-exon-scaffold_9-1575043694:262862..262954Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:262296..262482TCONS_00073320-exon-scaffold_9-1575043694:262296..262482Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:261728..261772TCONS_00073320-exon-scaffold_9-1575043694:261728..261772Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:261270..261345TCONS_00073320-exon-scaffold_9-1575043694:261270..261345Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:260981..261096TCONS_00073320-exon-scaffold_9-1575043694:260981..261096Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:260457..260573TCONS_00073320-exon-scaffold_9-1575043694:260457..260573Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:259647..259773TCONS_00073320-exon-scaffold_9-1575043694:259647..259773Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:258966..259143TCONS_00073320-exon-scaffold_9-1575043694:258966..259143Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1575043694:257991..258822TCONS_00073320-exon-scaffold_9-1575043694:257991..258822Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:265325..265395TCONS_00073320-exon-scaffold_9-1510915933:265325..265395Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:265122..265215TCONS_00073320-exon-scaffold_9-1510915933:265122..265215Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:264620..264775TCONS_00073320-exon-scaffold_9-1510915933:264620..264775Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:264410..264446TCONS_00073320-exon-scaffold_9-1510915933:264410..264446Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:263983..264166TCONS_00073320-exon-scaffold_9-1510915933:263983..264166Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:262862..262954TCONS_00073320-exon-scaffold_9-1510915933:262862..262954Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:262296..262482TCONS_00073320-exon-scaffold_9-1510915933:262296..262482Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:261728..261772TCONS_00073320-exon-scaffold_9-1510915933:261728..261772Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:261270..261345TCONS_00073320-exon-scaffold_9-1510915933:261270..261345Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:260981..261096TCONS_00073320-exon-scaffold_9-1510915933:260981..261096Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:260457..260573TCONS_00073320-exon-scaffold_9-1510915933:260457..260573Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:259647..259773TCONS_00073320-exon-scaffold_9-1510915933:259647..259773Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:258966..259143TCONS_00073320-exon-scaffold_9-1510915933:258966..259143Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1510915933:257991..258822TCONS_00073320-exon-scaffold_9-1510915933:257991..258822Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:265325..265395TCONS_00073320-exon-scaffold_9-1491911889:265325..265395Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:265122..265215TCONS_00073320-exon-scaffold_9-1491911889:265122..265215Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:264620..264775TCONS_00073320-exon-scaffold_9-1491911889:264620..264775Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:264410..264446TCONS_00073320-exon-scaffold_9-1491911889:264410..264446Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:263983..264166TCONS_00073320-exon-scaffold_9-1491911889:263983..264166Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:262862..262954TCONS_00073320-exon-scaffold_9-1491911889:262862..262954Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:262296..262482TCONS_00073320-exon-scaffold_9-1491911889:262296..262482Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:261728..261772TCONS_00073320-exon-scaffold_9-1491911889:261728..261772Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:261270..261345TCONS_00073320-exon-scaffold_9-1491911889:261270..261345Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:260981..261096TCONS_00073320-exon-scaffold_9-1491911889:260981..261096Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:260457..260573TCONS_00073320-exon-scaffold_9-1491911889:260457..260573Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:259647..259773TCONS_00073320-exon-scaffold_9-1491911889:259647..259773Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:258966..259143TCONS_00073320-exon-scaffold_9-1491911889:258966..259143Clytia hemisphaericaexon
TCONS_00073320-exon-scaffold_9-1491911889:257991..258822TCONS_00073320-exon-scaffold_9-1491911889:257991..258822Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:257991..265395 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
11.866 11.1326 4.76989 4.7272 38.3255 29.7243 42.4869 45.3428 19.7706 24.9692 16.6655 13.8581 8.92705 7.3158 9.88893 9.63297 12.4717 13.0492 6.52749 8.78483 10.86 10.8487 12.8415 13.6543 7.26453 8.93045 7.25366 4.96431 13.3842 12.8361
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR016093MIR_motif
IPR003342Glyco_trans_39/83
IPR032421PMT_4TMC
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0000030mannosyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006493protein O-linked glycosylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006493 protein O-linked glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0000030 mannosyltransferase activity
Blast
BLAST of TCONS_00073320 vs. Swiss-Prot (Human)
Match: POMT1 (Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3)

HSP 1 Score: 413.69 bits (1062), Expect = 4.296e-132
Identity = 227/577 (39.34%), Postives = 352/577 (61.01%), Query Frame = 1
Query:    7 PFGWNWWKYLFLLGFSITGAVSVKYAGVLSIIVIGALIGYELWLLVGDITV------------PVK----------SVYKHITARFIFLIVMPIVLYIGQFYIMLSVLQKTGLHDGLMSSSFQKTLEGGLESITKNQAQIISYGSHITLRNTHSKQ--CWLHSHKHLYPVKYEDGRGSSAQQQVTCYAFKDINNWFIVKHPDSDSLKVDFPPRPVKNGDVIHLVHGLTGRGISSHDVGAPVNPTLMEISGYVDHNVSMDAQYGWKLQIVNP-DESELWRAIGSQVRFVHVNTSAAIKVSGSTLPEWGFRQYEVGTDR--RINTQESIWNVEEHNQNVTKPEDMSDEEAKRVLSEHAERYQVSGKTHAMSFFQKFLEYQIKMFKVNNDLTNGHAFASKPMHWPLMLKGVAYWLDTYTNKQIFIIGNPIVYWLGAISXXXXXXXXXXXXXRRKRQCYDLDNAEWNNFSIGCYLLIGGFLLNWLPYFPVERTLFLHNYLPALIFKIILIPMLMDHVHSVWFKNFPILQYGVKAASVLI-VGLVVFVFQYFSAFTYGVTALSQRDIEQKRWLSSWRFMIHR 1653
            PF  +WW +L L G + + AV +KY GV + +++  +     W L+GD T+            P             V+ H+ AR + L+V+P+VLY+  FY+ L ++ ++G HD +MSS+FQ +LEGGL  IT+ Q   +++GS +TLRN   K   CWLHSH+  YP+ YE+GRGSS QQQVTCY FKD+NNW+IVK P    L V  PPRPV++GD++ LVHG+T R +++HDV AP++P   E+S Y+D+N+SM AQ  W+L+IVN   ++++W+ I S+VRFVHVNTSA +K+SG+ LP+WG+RQ E+  ++  R     ++WNVEEH    ++ +     E +R L   A+       +  +SF  +F E Q +M  + +D  + H ++S P+ W  +   +AYWL   T+ QI ++GN +++  G+++L IY  L   YLLRR+R  +DL    W  + +   L  GG+ +N+LP+F +E+TLFL++YLPAL F+I+L+P+++ H+     ++   LQ  + +A V+        V       TYG  +LS  +++  RW  SW  +I +
Sbjct:  181 PFSLSWWFWLTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLLGDQTLSNVGADVQCCMRPACMGQMQMSQGVCVFCHLLARAVALLVIPVVLYLLFFYVHLILVFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQ----RERERELHSPAQ----VDVSRNLSFMARFSELQWRMLALRSD-DSEHKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSLWYLLRRRRNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPVVLQHISDHLCRS--QLQRSIFSALVVAWYSSACHVSNTLRPLTYGDKSLSPHELKALRWKDSWDILIRK 746          
The following BLAST results are available for this feature:
BLAST of TCONS_00073320 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
POMT14.296e-13239.34Protein O-mannosyl-transferase 1 OS=Homo sapiens G... [more]
back to top