Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073312 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073312
Unique NameTCONS_00073312
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4134

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073312 ID=TCONS_00073312|Name=TCONS_00073312|organism=Clytia hemisphaerica|type=transcript|length=4134bp
GTGATTTGGTTTTTGAGTATTTAATTGCAAACTTTGATACTTAAACCAAG
AGAACACGGCATCTCATTGTTTCGTTGTTTTCATATTACTATTGTCATTG
AAGGATAACCTTTTTCTATGACAATAAGATTgcaaaatgcCACAGGAACT
ACCCACGTGCCATGCATTCTTAGTATATTTGGATAACAAGTTAACAAAGA
ATGGAAGAGAACAACTTTATGAAAGAAAGCTTTCCGAATTCGAACAGACT
TACATTACATCTCACAGAATTGCAACACCAGTTGACGGAATTGATCAGAT
TAATGGAGCCGAAGGAACAACTATGTTTGAAAAACTAACGAATAAATTGG
AAAAAGTCGATGCCGTCTTTATAATGATTTCAGAGAATTTTGCTGCTTTT
ATGAATGACGAACCCAGTAATGGTGAAACATTACCTTCGATTTTGCAAAA
TGAATACAAAGCTACATACGATGCGTTTCTTAACTTCTTTAATCGGCAGG
TGGCGCTAAAAGATCCGAAATTAATGCTCGTGTACACTGTTAAGCCAGAC
AACAAAATCCCTGGGTGCCTTCAAGGATTTAAAAGTGAATACATTATCAA
AATTTCCACGAATGATCCAACAGTTGGCTTTAATGAAGTGAAAAGTCACT
TAGAAGCAAAAAGTTGTAGCAAGTAATATTCCGTTCAAGGTTTAAACTGA
GGATAAAGATGAGCAGTTCCCCCCAGGCAAGAAGACTATTAATGGACATT
TAACCCTGAACAATTTATATAATATGATTACTAAAAGTCgacaatttttt
aatcatttattcTGAAAAGAGGtgcaaaatccaaaaaaaatcacatcACA
AATTATGAACACGGTGCAATATTCAGTGTATTTCAGTCTTTTGgattttt
tagtgatttttctgGTCTTCAAATTTAAGATCCGCATGCTTCCGGAtatt
tccggagttattttcgTTGATTATTTGTAAACAACTCCGGCTTGCTTGTT
ATGGTCCAAAGCTAAAAAGGGAGGTGATCATAAGTCAATTTTTAGTATTC
CTTTACCTTTTCACTCAATGGTATTTAATTTTGAACTTAAGGCATGTATT
CTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAG
TTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcg
tcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACA
CTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAG
GTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGA
ACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAAC
GGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTA
TTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaaga
agaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaa
aaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCT
AGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCC
TGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTG
ATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAA
CATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAG
agttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTC
TTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTT
GATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGT
CGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATC
ATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAG
AAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATC
ATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTG
TCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTT
GGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTT
GATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTG
ACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTC
GAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTG
GTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTC
CTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCA
TCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGA
GAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATA
TTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGC
AGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAAT
TGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAG
CACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTC
TATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTAT
CGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAA
AAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATAT
ATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAA
GTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaa
ttttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAA
GCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGATAGAAAAA
GTTATGTTGAAATAGCGCCAAAATGATGGCTCATCAGACACTCGATGAGA
GGCGAAGGGAGACCTTTCTTTCACAAAATTGCTGAGTGTAGATTTTAGTT
TAATAAAATATTTCGCGGGACGTATCCCACGTCTCGAGTTTTGGCATTGA
TCTATTTGACTTTCATGCCTTAACCCAGTTTCCAATAAAATGTGGACAGT
ACTAGACCTAATTTAAGCGACCAACACCTTGCCTCCACTCAATGAAAAGA
CGGGGGAAAATTGACGTAAAGTTGGTAAAtcttcaaatctttgtttgtaa
CGTAATTGCGTCAAAAGAAAGCAAATCTAGAGAAGGCTCTTTAGAGCttg
aatatatattttaaagtctgtccagtATCCTTTGGACTTGTATTATCCTA
TAGAAAAATCACGGATCCCCCTTGTGCCCAGTGGTAATACTTCAAATCGA
TACGCTAGAGGCCAGAATATAGTAAAAcaggaggttcttggatcactcgt
gggccaaaaatggtcaaaacctttaaaaaattgatttttgtcaaatttta
acatttttttgactttttgccttataatctcgctggaaagactgactttt
gaatttttttttgcttgaccatgaagcacaatccgattcctacgagttag
accaaaaattacgatttctaactcaaactgggcatttcaggagggcttcg
ccctcctatgtAAGTCCATGTTCAATATactcgacattggcacttagGGT
TAACGCTTTAAATGTCGGCTACATTTATGCGGCTATAGATTAAAACATTA
GTACCAGCATTAAGTCTAAACtttaagataattttaaaattgtaattatt
tgtaacttctttttttggctatagtatttttcttcttcagatttttattt
ttgcatcaccctttttgtaactttttttagtCATACAGAATCACATTGTA
CTGTTTTATTTAAGAGTGGAATAAGAAAATTATA
Run BLAST on NCBI

protein sequence of TCONS_00073312-protein

>TCONS_00073312-protein ID=TCONS_00073312-protein|Name=TCONS_00073312-protein|organism=Clytia hemisphaerica|type=polypeptide|length=682bp
MYSSTKDVTPLMDLNKDSKLDMPSKNEDEFLKNPFRQNFKSNEFWKKVNS
LHTKGGKSWDDALTTVQVEVFTATCGNDDPMISLLEQVYDKFIVLEKVKN
DQRSRSGFINQVTRLGAKLLELDKERATQQNEEEEEEEEEEEEEEDLGPV
YKKSFFYIENKPTLLHMLASRDLFDLCEIYLNDYYPEHLYSLDNPTILPN
DPDKDTKFRKMPFEYAYAKHFDQTAAFLAGKMDEFRVRKLFQKNQNKILQ
CSLAEVINHNMKETAIKVLDCCINPDWPFVPTEIGVDNDESWSRLKEDPR
SYHFYYDLLDSDQKGNAPKKPQEGMDKRDRFDHLQSSPLQVLINNEVTKK
AAVSHPTVVMLVDRKWNTFGKRRIFMFMALYLFFLLMLALGLFGSENWGN
EVDMVIKMIVVIFNILYTFEEVDQMFKEGRGYFCDWFNAFDFLGIATIYV
LIPLYAFGEYKAFYGVASASFILNFMRAFKFFSAFEKLGPYAKVFFDLLK
KDIWVFLQLFIVLMVAFTGSVFLALKSEKSDGGKIIDGKNDTLTFWSTML
REARALAEGKEFADDYDGVYSAPLVMFLLLNMAAIIVVLSNMLIGQISAR
YEKAAENARVESAIARAKYICKIEKSRFLCGNLRIKYYEKADYVTDDAKV
KEILTDWHELKKDTESTREAIKKLQEKMKASK
Run BLAST on NCBI

transcript from alignment at scaffold_9:326480..364015+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073312 ID=TCONS_00073312|Name=TCONS_00073312|organism=Clytia hemisphaerica|type=transcript|length=37536bp|location=Sequence derived from alignment at scaffold_9:326480..364015+ (Clytia hemisphaerica)
GTGATTTGGTTTTTGAGTATTTAATTGCAAACTTTGATACTTAAACCAAG AGAACACGGCATCTCATTGTTTCGTTGTTTTCATATTACTATTGTCATTG AAGGATAACCTTTTTCTATGACAATAAGATTGTAAGTCCGATTGTATGAT TATTCTTATTCCTTTTTGGTCCAAAAGTAATACGGTAATTACACCAAAAA AAGCCTCGGGTAGCGTTAAAACTTCTAGTGTATATCATCATCAATCTTAC CGATAAAACACGAGAACCAAGAAAAATTAATAGAGCTTCGGATTCATAAT AATCGAAAGAAGTTCTTTAACATCACTGATTTATTATTgtattgttgatt tttttattattctcGTAACAATTATCAATCAATCGCATTTTattattgtt taaatttttaggcaaaatgcCACAGGAACTACCCACGTGCCATGCATTCT TAGTATATTTGGATAACAAGTTAACAAAGAATGGAAGAGAACAACTTTAT GAAAGAAAGCTTTCCGAATTCGAACAGACTTACATTACATCTCACAGAAT TGCAACACCAGTTGACGGAATTGATCAGATTAATGGAGCCGAAGGAACAA CTATGTTTGAAAAACTAACGAATAAATTGGAAAAAGTCGATGCCGTCTTT ATAATGATTTCAGAGAATTTTGCTGCTTTTATGAATGACGAACCCAGTAA TGGTGAAACATTACCTTCGATTTTGCAAAATGAATACAAAGCTACATACG ATGCGTTTCTTAACTTCTTTAATCGGCAGGTGGCGCTAAAAGATCCGAAA TTAATGCTCGTGTACACTGTTAAGCCAGACAACAAAATCCCTGGGTGCCT TCAAGGATTTAAAAGTGAATACATTATCAAAATTTCCACGAATGATCCAA CAGTTGGCTTTAATGAAGTGAAAAGTCACTTAGAAGCAAAAAGTTGTAGC AAGTAATATTCCGTTCAAGGTTTAAACTGAGGATAAAGATGAGCAGTTCC CCCCAGGCAAGAAGACTATTAATGGACATTTAACCCTGAACAATTTATAT AATATGATTACTAAAAGTCgacaattttttaatcatttattcTGAAAAGA GGtgcaaaatccaaaaaaaatcacatcACAAATTATGAACACGGTGCAAT ATTCAGTGTATTTCAGTCTTTTGgattttttagtgatttttctgGTCTTC AAATTTAAGATCCGCATGCTTCCGGAtatttccggagttattttcgTTGA TTATTTGTAAACAACTCCGGCTTGCTTGTTATGGTCCAAAGCTAAAAAGG GAGGTGATCATAAGTCAATTTTTAGTATTCCTTTACCTTTTCACTCAATG GTATTTAATTTTGAACTTAAGGCATGTATTCTAGTACAAAAGATGTTACT CCATTGATGGATCTTAACAAAGATTCAAAGTTGGATATGccttcaaaaaa tgaagatgaatttctcaaaaatccgtttcgtcaaaatttcaaaagcaatg aattttggAAAAAGGTAAAAAACATTCTTTATTTAAAACCATTTAATTTT ATGACTAGGTTTTTTTAATTCATGTGAAATCTTTAAATACTTACTGTGGT TTCCTTCGCCTGTGTGGGGGTCACCCCAGGCAGGCCAAATGATTGATGTG GGGCATGGGGGCTGATGGATGGTGGCCCCTGACCGCCCCTCCTCCTTGTC ACCTAGCCTAGCTAGGTACTGCCTTCTCACACCTCCCACTTTTAGCCCCT AGATAAATAATAGGATGATAGGATGCAAATACCCTAATATTTTACTTCAT CAGTTcattcagtcaggcacatcctggcaaatgaacggggtgagcatttg catggggtattcgtcacccagtgtaaatgagataggacgtctcaNCATTA Ggtcgctttcgttttcgaccccgttcatttgccaatggtcgcaagtgaaa aataccccgttcatttgccaggatgtgcctgactgtcatTAGTTCAAAAG TTAGCTATGccccaaaaaactaaaaaaacaaattttaagaaatgtcaaaa aaggcgTAAAACGAGGGTATTGGAATTTAATTGTCATAACATGAAAAAAC TTTAGGAAATATATTTCTACTGTGTAAAAAAACCCTTATTTTACTTAGAC ATACCTGTAAATTTATTTCTTATTATCATCTATCTGTGGGTCGAGATGAG CTGCAACATTTGGAATAAGACATTtcttaaaactttaaaagaacCTTCTC TATCTTTCTCATCGATGTTACACTCTAccaaaaaggttttgttttggaAA CTCTTGGAAAGCTGGTGATGATTTTGTGTAGACTGGAGCATTCTTCCCTT TGGTGTGATGCCCAGGGGAAATTattatttgaaacaaaaaagtccaaaaa caatATAATAGCAATCAAATAAAGAAAGCGTAAAGAGTGTGAGGATCAAG ACTTTTTACTTACTGTATATAAATGTTTTGGTCCTTTTTTCATAAATTGA TAGCCATGTTTTAAATTTTAGCctctttttgacattttttaaatttgatg ttttagttttttggaCATAATTTTCAAACCAATGGAGTAAAATTAGAAAG TAATATGtacaccaaaatttaagttaggcccggggggggggcgtcGGCAC TAAAATTTTAGACACCACAACCTTTAGtgaccatgtgtactaaaatccca aattaggtggggtcttcaagaactttaagaaaaattttagtaaTGAGTAC Taaaatcaccaaattttaggaaatttaactattgaccaagcattttaggc aaaatgaaaaaaataaaaactttctatataagatttaaacacccctgtgt cacaaattaagcaaaaatttcatcgccggtgggaaaatacccttgaattt cagtcccactgggaaattgactttgatttcatccccactcaaaattccat gttagaaaaattgcactccaaaaccttGGAACAATTTAATTTCTATCcca ttagcatttcaataggaatttttatccccactgaggaaaaggttccaccg gggttgtgaaacaggggtgtatttaatgttctgcttttatatactatgga taaaaaatgtttttgaagttgaatGCTTTGTTTCTGTAAAGAACCCATAG ATAActggatagaaaagaaatagcaagctgtaaactaggtgaaaaataac caatcaatcttTACAATAACTAAAGTAGAGCAGAGCAAAAGTGTCTTGAC TGTTTCTGAGTCTTTATCTAGAATAGAGATAGATCatgcatagtgtcctc ccctctttataaagggggggaccaattttccaattttgaatgggtgaggg gggggggggaaagNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaacatcgata gttggcaaatttggtggggggaagtatgaaatcacttcaactttatctca gcaaccaaggtcagtccacatgatatcTAAATGATTTGTTTTAGATTCTA TGATctctcttttcactttcttccttcctTTTTTGTTATTCGGCagattt taagttttctttttgcttcttggtaatctccgcgtatgttttctttgata tttccgtcattatttctgctgtgtgctttatttccttctttatcatgctt cttgttttttcctccatcttttgaagttttcctgccagaaaggttttgag gtcatttttgatggaatcacgggttttTGTGTTGGTGTTGACCTTGTTGT Ttagtttttgtatgacgtcatctttcttttaaagttaattttgcatcata tgttgagtgtttttccccactttatttcttaggtttttTGTTATTTGTAC ACAGTTTGGACATCAGTAATGATCGTTGTAGGATGTCACgaatatttgta gttgatacaggggtaactgtgtgcactcataatgaactgatcttttacat tttttgcaagtTAAGCAATCCATGTCTTTGTCTTCAGTACATCTTGACGG CATACAAGCTGGAGGTGGTGAGGCTGCTTGgaaaggctgatctttatcca ttttgatgttattttcatgaattttaatgtttttatttgttttcagccat tttttccaaGAGCTTTGCAAAAGCGTCTTATCTAGTTGACGTcaacgtca aataaaaacttctAAAGTATAAGTATAAAGCAtaccttgaaaatcttcct atcaaaagttatggaggttgaaagttttgtgattgaaagttttgtgatga cgtcatcacaagccTTACcaggaaaaacttaaaaaccttgtaattttgga acaaaaatgaaccaaattttatgttttatacatgaattcatatcaaaatt cattgctttttctgattttgatgttcaaattgaattaaaagcttttaaga gccattttttttttaaatcttcagaataaactggaataaagaaagtctga tacctcaccctcttagattttgatgaaattttgaccaaatgatctatcac acaaggaAATAAGACTccgaaaatttcaccttgatatctcaagtagtttt gcagatatagtgtctcaaagataggctactaagcgaaaattgacccctaa aaaccATGAGCTCttgtggggagcagattttgaaacccaatgaattttta ttcaagtacattagaaagctgatttacagtggatttcaagaactttttgt agggaatcagaaaaaatcaaattgagtctccataattttcgccgaaaatc tctagcacctcctgttgagggcttcaaactttgcgtaatctgggtttgga agcaattttagctggctgctgatggtcattgggacttttttgaagtaaac tttTGTCCtagagtggtttactggtgggttttggccacaaaaataatatt ttcaggatttccatctttgcgtaaccgtcaaaaatggccgaaaaaattgc tattttggcagaccTGGAGCGAAATTcaagatggtgtatctttttaaggc aatgccaaatttttttgaaactttcagcaaggcttcttagtaggtctagt ttatagcctcaaaaaatctcagtgggcttttgaagtctcttaaagatatg atcgattgaaaatttgcttaacttcgttgttttctCCNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNGAACaactgaaaaagatttcaggtcatttccattaACA GATGACATTCAATgacagtttctttatttttaagtacagaatatGTAGAA AAATGATACTggcatctggcctttcctaccattctAGAGCCCATATTTCC AGGAAACGCCTCAgcctttcacagtttggtgaatgATAATCTTAAATATA Cgcaggttacttcaactaaatgggtttaacagtacttaattcctattaaa aaactttttagactcattcagaaatcctactttgacaataatttgcgctt taccgcaaaattcCTAAGTCCAAGTGTTGTCATtagctttagactgtcca atatttcttgtccagaagatttaaaCAGCATTATATGTAGTATCTCATAA ATTATCACCCTAGTAATGTTGCTTAGTTATTTAAGAACCACAAGTAAGAC TGTTaatttttgcccagccacctgatgacgtcatctggcagactgccagg tggcaaaatttggtgttactgtttagaATTAAGTTTTAGAACTTCTAAGG ATCATTCTATAGATCAGctatataaaatattgtcaaaaacaGTAATTCTT TTAACattaaaatgctgaatcagcaaaatttcatgatctTTCCTGTGGTA CCATCAGActttgaatattcttataaaaaataaattttagctCGGCCACC TTATGACGTCATCCGGCAGGTGGCAAGGTCaccaaatttggtgttactca agtttaaaatgaagttttagaccctctaagggtcatctgtgccaaatttg atGCTAGCACTGTCTGAAgaatttttgtgctaacagacctcacaaGCCTC AGAGCAATCTCAGGCTCAGCCAAAATCAACTggttctttcaaaaaatttt agctCTTTGATTTCTCtcacaaaggggatttccctgatttcttttagtat ttattttgaaaatttttttagaaaaggtAAACAAGTAGCACTTAATATTG ATTTGTACTAGATGTTTCAtagatctttttgaaattttcagaaatttaac TTATGTTTAAAGGGaaccaaagaaaaaataattttgaatttaagggGGAG TAATTAATTCATGTGAATCCAAATCTTTTTTCATACTCTTgcaagtttgt ttttttagttAAATATACGCAATATACTGTTTTTAAAGGTGGTAATCTCT GTAATTTCTCTGTCGTtcggtcggaaatatcataagATGGTCGGAATAAT CTTTCGATGGTCAGACATATctaaaactttgatttttttcaaaatcaggg aAAATTGATGGTCAGAAATATCCTGAGCTTCTTTAAATATGCCTTGTcag catatttttaaacacaCATGGCAGAGAAGCTAATGTGAGAGAAACATAAT TTTGTAAAACCTAGACTAGATTCTACTCCTGGCTGAACTTTACTTTCTGA TAATTTTAATGACGCTGAGTTCTGGAGTATGCTGCATAGTTACTTATCAG TGTTATCCAGTACAGTATATCAAAAACCACTAAGTTGCCTCCAGGCTACG TAAAGCCCTGAGTGTTAAGGGATAGATAAGACGAGATAAGAGATACAGCG AGAAGCTCTACTTAGTCCAAACAAAACCCTATGAAGCTAGTTGAATTTCA AGTCAAGCAAATTTGGAAGGCTTTACCAAAATCTGTGACGAAGGAAATGA AGTACACAAGCATGGTAAAGAACTTTTGCAAAGAAAtgactttttatctt tgtttaaAATCGAGTGTGATTATTtgcgtgccctcgtgggtctcGTGGGT TACGTGgctcgtgccctcgtgggtctcgtgccttcgtgggtccagaaaaa aattacgtgggtatctcgtgggtctaaaaaaaattgcgtgggtatctcgt gggtccaaaaaaaatttccgtgggtatttcgtgggtccagaaaaatATTA CGTGGATCCAAAAGAAATttacgtgggtatctcgtgggtgcaaaaaaaaa ttacgtgggtatctcgtgggtccgaaaaaaaattatgtggGTCCAAAACA attacgtgggtatctcgtgggtccaaaaaaattaTGCGAGTCCTTAAAAT TTGACATTAAATTTCTGGAATTTCTGAGCTGTACCTGTTTGCCAGCTGGA AATTTTGAGCTGTTCCCGAAATCAGCCAGAAATTTGGAGCTGTTCCTGTT TGTTGCCAGCTGGAAAATAAAAGCTGTTACTAGTTGATTTTTGGTAAACA TCAGAGCTGTTCCCAAACACTATTGCacatttccagctggaaatattGAA CTGTTCCCATAATATTACGCAATCTCAGCGGGAAAAATCGAGCTGTTCCG TAATATTGTGCCTTTCCAGCTGGAAAATGGGAAcagctattttgaaaaaa aacacatacaCTCCATGTTTATGTTAGCTTTtcctagaaaataaaaaact tttatcatAAACCTTGAGCTGTTCCGGACAAAATACACTATTTTCCAACT GGAAATTCCGAGCTGTTCCTGGGAGACTTGATGacttccattttttgaaa aattctcctGGCTGGAAAATGTAAACAGCTATTTGACGATTTTgcgtcgg tggctgcttctgtatTGGGAGCTCGTCGAGTGAGAACATTGATTttctgc aatttttttttcttcaaaaaatcaggttttaatatgtactagttatcgca tgatttcgagtgcaatacgagaaatattttacgagttccgagattttccg taatatttttccgagcctttaggcgaggaaaaatatcggtaaaatctcgg aacgagtaaaatatcgagtattgcacgagaagtcNATAAAATTAGAATCT TGATTTCGAAATAAAAATGGCACACTATAATCTATCAACTTCATAGCACC ATATGGTGGCATACTCTGCTCACACTCCAAGTcacgaatgtttttattcg aaaatctaattcgaacgttagattcgaacaaaataacattcgataacttc ccgctaaaaatattcacacaaaaacaaaatggagaaacatttttcgatca ttttcgatccagaagttttgttttgaagagttgcagattttttagagatg tatttgaaagtttctagattgataattcaaaatGCAGATGATGTACAGTA TGGTTTCGATAGAGAAGAAACCCTCCATCAATGGATTAATCAGATTGATa aaattcagtctttttctatgtttttgtttcggtgacatggccatgggaaa gaatagcagaggaaaggagtcccatgatggaaatgtatgcttgcaaaaat ggttaaagaacaacatttttcaacagcaaaacaatttggatactttcttg attatcgtcaagctctaaatgtttccaattttagaaggaagatgtataat gattgttgagttgaaaagtcaaggacGTAGACTACGTTGTTctcgagaac gagaattaggagagaacttttataaaaatcactcgtcatttgattaaata caagacattacatttcccttgttatgttatgagaaattttattggcaaac attcaagagtctcaagttttttgtatgcattgataaaaaactgtttggtt atcacacggacAAGTTTGCCAAAAGTTGTTTGATAATaaattcttagttc atcagatttgattttagtgtcttttatggaagaactccaaagtaaaaatt aatctgaacatatttttgttgcgtttcccCCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttgca aaatataggatagaaatatctttaaagcataatattttcagtttcagtta agctttttttctaaaattttcacagcttattccatacaggggggtttcat ggttggcggaggagcggaatcggcccttttttcggacggagtggcggaat ttggcgaaaatttagacggaattacggaattacggaaattgggttctctg acggagacggaaaattagacaattttaatgcggaaaaacggaatttagca aaaaaatttgcggaatttcgaaattggtaaaagatattccaaatttgcgg aattttcgacaaaaatattgaatttcaaaggaattttcggtgacggaatt ttggttcaatttaagacggcttgacggaaattggagaaaaaattgactGA ATTGCGGagtcgggtaccccctgaaccccccccctaaaGTCGTGTTAAGT GTGCACtataaaatttgttttgctCGCCATTTTCCAAATAATTCTcaaaa tataacaaattatataccgttgaaaagatcaTTCAGAGCACTTTGATTTC TTCACAGTACAGAATATGTTAGAATTGAAGCAGTCGTTGAAAATGGCAAG CAAATCTATAATCAGAGCGCTCTTAAGCGAATGaactttataatttttca taTAATTATCCTATCATAAGCTGAAATTCAacgaaaattaaaatcaaata actCACCATTCACATTAggctgaaaaataaaagaagcaaaaactaatatc aaaaaattgaataatctCATGAAAAGTTATGCAACTTGGAATGAACACGA ATGTCCATGTGCTAAActgaaattctgaaaaattggattatctTCCAATC acggaaatatttttcaaaatttttcaaaataaagagaATAAGAAGTGTCA CTGTATCCATGTAagtcacagatatcttatatgcAAAATTAGAAATGCCA TCTCTAAGAAGCAGACTATCGATTGAGTGATCGATTGAGTCCATTCTATT GACTCCTTGCTTCTCGTCATGCAGGTTTTTTGTTTGGGATTGAACAAATA CTACTATGGTCTACTAAGATTATTTTGCTTCGATCGCACTGGCTTGGGAA gaacagagtagctctatcaaGTATGTTTTATATATGATATCTCGTGATAT AAGTACAGCTCAGGTGAAAATAAACCAACagaaataaatattgaaattaa aaaatttataagaacacccaaaGTTTTTGATcgtttgagttttaagccta aaaatgttcgtagcatgttcttattttcaccatttttgagcaattttgtc cattttccttaaaaaatgttcttaacttgttcttaacatttggGCCATCG AATTCttacgttcttatatagtttgttcgtataaaaaaacgtgtacctta aCTGAGAACAATTTTTGTGTTCTCATATTCAATGTTCCTTTATGGTAATG CGTCTCATCGTGAATCACTGTTCCTATTTCTTCGAGAATATTCTCATATC GTGGATCTGAAAGTgacttaaaaaaattgaaaaaatcaaaatatattgat tccAAACAGAAGAGCAGAAACAAGGGGTTTCGTAAACTGAAAAGGGACAT TGCCGAACTAGTTGAAAGGGGACAACAAaccactatctaagaaaaaggCC CAAATCTGaagaaaattcgcgaaagttttttttttgccgaaaatagtTTA CAACTGGTAGAGTTTGACGGTCtttccaaactctaccgccgCTAATTTTT CCGTATATTGCTATACATATGGCTGTTAAACTCCGCGCatattttcccat ttttaccATCCCTTCATTTGACGAACGATAGGGATATCAATCTACTGATC AAAAAGTCAATAATTTAATTTGACTGATTTGAAGTTTGTTATTTGGAAAT GATATTAACCCAAAGTCGAACCTGATAATATGCCTTAAACAATCCATTTT CTGAATCTTTCAAGGCTTCTTGGAGTGTTGGTATTAGTTCAATGACGTGT TTCAAGGAGATGGAATCAGCAATTTTCTTTTCGAACACTCTCAGATCTTT TTTCTTAGGTATTTGGACGAGACATGAGATTAATTGATCGACATCCAAAA ACCGTGACAAAActgtaaagaaaatttttaaaagttccgTATTAAAGAAA TTTAAGAGATAACAAAAGAACTGGTTGACTCAGCTCAAATTCGACGGACT ACTCCTAAATTACCAGATTGGTAACGGCACTGAGTATGACAAGCCTTAAG TTCTATAAAAGTTCGGGTGAACTCAACCACGAAATTTAATCGCCGCGAAA GTTATTATCCCATTTTGATGTAAAATCTATGAAAATTATTGTATTTGCAA CATTTCGCGACGAAATACAGAAATACATACAAGAAAGAATCTAAAATTTA CCTGTCTGTAGGTTCCGAAAAAGTCCTTCTTTTTCAGTTAGCNAAATACA TACAAGAAACAATCTAAATTTACCTGTCTGTAGGTTCCGAAAAAGTCCTT CTTTTTCAGTTAGCTCGGTGACACAGTCATAACGTTGTGTAATGGTAGAA ATgtctggaaaaataaaaaagaatcgtTCAAACTCAAACGTTAAATACTT TGGATGAATGCCAATCAATATTTAGATAATACCTTGACATGAGTTTTCAT ATGAAGAATTTGTTTGATGTTCCGATGGCGGATTAGcagccgcccacgct aaagctctaacgGAGCGggtcaatttcccatcggagaggaatgatagtcg gcctttgcgCATAAACAtataaatatttcggttggacccgccaatccccg aaaacgagggctggattaccagacctcccgctgcaaaNttcccatcggag aggaatgatagtcggcctttgcgCATAAACAtataaatatttcggttgga ctcgccaatccccgaaaacgagggctggattaccagacctcccgctgcaa aattcttgacgcggaCTCGCAAAATTCCGTATTGTAAAACTTTcagatat tgatttttttttcgacctttagagctttagcgtgtcggatgaaaattttt gtatctgggtgccagataaatgaaaaataaacttaccGCATGGGGGTTGA AGTATGTTTGAGCGCAGAAGACgacctgaaaattgaaataNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNttccagacta aagaaatatgaaatatcgcaaatatctcgatgctctcgaccaatcaaaac gctgatatttttttgggtcggcaataagaATGGTTATTTACACTCTTTAa gcaatttcttcaaaagttcaatattttcagttattcgaaaactcccggtt attcgaagtaaattcttaCCCCCTTGGATTAACCGTGAGTCTACTGTaga ctcttaaaaaaagaaaaagctcaGAAATAATTGAATGAGTGGGCTTATCA TAGTCTATTTTTACATAAAGtcaattagtactagtaatcgcaaatgcaaa ttacggtattttctcctttgttacgagtgattaatcgttaattgcacgac aaaacatacgattccgaggtaatcgtcagtaaataagtaaataagtcttt tgtaaacattcgaaaacctcctttttggacctacctccgggtaccccggt ggaggtcctttaaattaacccatgtccgttcgttcgtccgttcgtccgtt cgtccgttcgttcgtctgttgccagcttttctcgggattggctcattagt ttgatctgattttttgcactatgatgcaaaatggcaatgcccaaaatgtg acggagcccgattttcggaaaattttccggccgaaaattccggaaatatc ccggaaaaactgtttttttggcactttctcgagatttttacgcacggagc gagcgttagcgagcggagtgcgactcttttggcaaacgcatgcgcgtaag caaaatttacaaaatttcaatgatatgcgggcgctaaaaatggaaattca ccttttttttcgtctagccgctattccaccatgtttagcctctggaatgt ttcaactttgaaaatttcgtgaaaattagcattttttgagaagaagtcgt tgcaatgtcgatctttcgcaaatttaaaaacccactttcccttggaaaaa attgacgttttttgtttttttgggaccaTTGAGGCAAAAGGTACCTGTTC accgcaaaaattccaaaagttGACGAAGTGGTCAGACATCGGCTGATTCC TGCTCTGGGTGGTGGTCACATCATCAACGATAAAGAACGCATCATGTTGT CCTTACCACCACGTCTTGGTGGTTTGGGACTAAAGATCTTCGAAGAAGAA GCTGAAAGCAACTTTCAAGACTCGATGAACGCCACAACAACTCTTCAAAA TCAGATTCTGGGTTCGAATGACGAGANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACCGTTGaaaac attaggggtaaagggacccaatgacgtcacggtattgggaaaaacttcaa aatgcgatatctcgagtttgaagaagagttgggaggtcgttgatcCCTCA TTttatcgagaattttatggggaatgagatgggaAGGTTTTATAACGCTT GAGTAGGACTTTCGATTtcggctgaatttttagccattttcagttgatga cgtcatcaaaactaaaaaaatgcgataactagagattggaaaggagtagg gaggtcgttgacccctcattctatcaGAAATTTATTgaggaataagatgg gagggtttataaggcttgagtaggactttCAAGTTTGGCTGAatctttag ccattttcagttgatgacgtcatcaaaacataaaaaaatgcgataacttG AGATTGCAAAGGAGTTTGGAAATGGCTAACCACTTATCTGATCAGACGAT TTATCGAGAATGCAATGAGAGGGGTTCAATAAGGCTTTAggacgacttta aataaaaattggttaacatttgggtaagtggtgtgagaaaatcaaaacaa aacagccgaaaagaactgaactctcggaataaatacacgctttttctttt ataagaataacttctataagaatatcagggtgagatttcgggtttaaaac aataggcctgttgtttagaacaatagaaaaataagaataatgctcaccct caaccaaagtacactattcttataaaaaaaagcgtgtaatcggaaaactt taaaaaaaaatattttttgatgagctcttattctattctttccaaaaagt cagtgaaattaaaactgatgaaaattattacaaaactactcgaCGCACAC GTGACACGAcccaaagcaaataaattcagcTTTCGGCACTTTCTTCGTTT GTGAAagccaaacagttttttttatcaatgtatgcataaaaacttgaaat tctttatacttgtcaagaatattttccataaacaaaacaaggaaaattca atgtctttgattGAACCAGGTAACGAGGAATATTTGTAAAAAGTCTCTCG TGACGTGTCTCCGCTCCCCAATTCTCCACAAAACTGTGTCTTTGtgactt ttcagcatcaattcttcaacaatctTGAACACTTTTTACTTCAAAAATTC GACACCTTTACAGCTTGACGATAGTTGAAAGTTGAGAAGTTCCCcaatta gtttttgttgcaaaaatgttgtttcagaccATTTATAGCTATTTAAACCA GTACAGTATGCATTTTCTCTCATCCATGCATCGAAAAGTTTTATcaatga agaatttcttctcaatcgaaaaaatacaatacatccTCTTTTTCTGTGTA TACTGTAATGTATAATAATTTCACGtctctgaaaaagctgctgcATTCGT GCATTTACTTTGAagcttctggatcgaaaattttttctttattttgatct tTGATGTGCATTTTTTCGGCGTTCGAATCTAGCGttcgaatctaacaaga ttttcgaacaaaaacattcgaaattataaAGACCCAGAATTCTCGAGTTA tcttttccgagttaaaaaaccgagttacgaaaaaaacCGAGCTATCCTAT CCCGAGAATATATCGGAACAattagactagcaagcgtctgtctttccttg gacacaggaacgcgggaatagtgcttataataaagagttcttataaaaaa tagaaattgtcgcgggagagtggattggaaagacAGACTAGTTCCAAGTG GTGCAATACGGGATTTTGCTTCAATCTAATCTCAGGCAACGTTCCCTCGA AAAAGAGGGAAGATAAAATGAATGGACACgccttattttttcttctattc tcATCGCAATATTTGAGTTTCTCGGAGTTATGGATGAGAAAAAAGATATA aacacaaaaacagaaaaacgtGGCGAGAACTTCGGAGGACTTCTCCAACT TTTTTGCTAGAGAAattttttaatgcttttaaatgtttataaacacAGAT TTAAACTGTCTTGGCATTCTCTATCTGAGATAATTTATTCATACATTGTT TCTGGCTTGGTTGGGACGTTGATTtattcacaaaaacaaacaaactcatA TCTGCATATATGGATCatactttcactttttcatgtgATTGTTgtgattg aaagattttttgattatGTATGGTTATAAACATTCATGACATCTTTTAAC ACTGggatctttgaaattttgttNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNATTGAATGCTTTTTACGTGGAAACAATATTCTGACAAGCTGACC ACTGAGACACATCTTGGTTCTATTTGTgaatgaaaataacaacattttaC ATTGAGATGACAGGTTTCCTGGGCTTTCGGATGCTGGATTTCACTACCTT TGACTCTAAATGGTAGATGTACGAGGATGTTTTGGGTTTTCACTACTGAC AGacttccagggggggggggcacttaggcaaaattaagTATGGGACATGC CGCTGaccagggtccctttttcagacTCTTGAGATATCTGATATGGTCcc aaaatttactaaaattttcaagatgtaGACAATTTTTAGGGTGGAAATTT AacaatatttgaatttttcgtctactttaaGTCACTTTTGCCAATTTACA GGGTTAAAGNaaatatttgaatttttcgtctactttaaGTCACTTTTGCC AATTTAGATGGTTAAagtgggaaaatattttgatttttttcgatcgaatc atttttcgttctgaaagggtcccaaatttttaacaaacattcatatctca caggggacagggtccacttttcaaactccagcgtgGCACGTCCCGGTTAT TCGCCAAGGTGCCCCCGGCAGACTTCTACCTTGTAATTTTGTGTTGTCCT CTGGTGTTGTTGAACAAGTTCAGACTGAAATTTATACGTGAAAGTCTTTC AAACCTACagtttgaaaatttatgaaaattttgattggatttttgccaat ttaaaaaaatctacttAGATTTGGAAGTAATTTTATGTAGGTACTTTATA TAATTGTTATAGCAAAATTAAAGATCAATATGAACAAATACATATAATTT TATGTTTAGTAAAAATTgttgcttttttgaaaacatttttctttttggct tctacaaaaaaaaaagttttcttatgcCTGCAGTGGCCtgatcttttata tttttgatgccgtttttctaaaaaaattttcatctttttcatttgaaaaa gatttttccccttatatatatgaatatttttgttttggggTACCTAGCTG GTAGGTACAGTCCAGTTCATATTCTTTTCATTCACAAAAATATCATACTT TTTGTGAACAGTTTTAACTCCTTGTCTTGTTGTTGGTATCTTATTAGTGC ATTTATGCATGAATTATGGAATTATGGAAGaaagaacttttttcaaaaac ttttttcaaaaaaaaagcttCTAAATTGACTGATATTCCATTGTACATTG TACtcactttcttttataatacattaaaatccaaaaataatcAGGATGTG AATGTTTTAATTTGAGTGAATTGAatttagttaaaaaaaaaaaaataata ataaaacatAAAAAGCACAGAGTTTTGTCTTACTTTTTTATTCCAATCCG CGAGAGTGAGTGCGCTGTTTTTAGTGAGCACTCCGCCGCGGTATAAAAAG CACTCCACCGTTTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNAAGCACTCCACCGTTTATTTAGTAAATAGCGCCTCTTGGA ACTAGTcgttgtattcagtgaacatatagaaaaatagatcctattgcaag tttaatctgcagcgaaatacaacgacgtggtttactagtctacggAACAA TTAGAAATCGATTTCAGTAAAGTTAAAAGTTTATTTATTACCCTTTCGTA GACGTCATTTACGGCCAAAAAGACGTCATCATCACAAGATTCgcagtatt ttgagtttttcgggaaaaaagtacgatattcttttgagcaACGGATTAAT AGCCTCGACCTCTTCTCACATAGTGGCGGGCTCGAAGCATCTatagaatc cctttcgctttgcgaacacgagactcgttctccgtgcgtaacccctttta tgATTgatatcattagttttttctgattttttgctcaaagatgcgtatta acaatgcccaaaacatggccgagtccgattttggattccatgaatttctc gagttgttctcgTATTATTCTGTATTTTCCATGGTTTCTgccccccttaa aataaggggggagcaaaaaaattgccttttaaaaaaggggggatttttgt aattttttaaaaataaggggGATCCTTTATCAAGGGCTGCAAGAATCtat taaaacaagaaaaaaggaaggactaaaatttgaaaattgttgtTTGAATT TCAGATGTTATGTCTTTggttttattgataataattttctttatctaatA ATATCTTCTTTCCCGTTTTCGTGCTCACAATTTCATGCCCACTTTTTTGC AGACCATGCTATATTGAAACTTATGTACATTAGAACAACTTTTAACAGCC TAAATTAAAACCATAAAAATCTCCCTAATTAGATAACggtttaaggtgtt ttgagggtgtaaaaagtgaaaaatttcttcgtcgcccaaccatggtgggt gaCATTTTTTCCAAAGTCTTGTCCCTCCCCCTCAAATGGCTCGCCAGGGC CCATGAATCTGCATCCTCTCTTCCCTCTCTCTCTCtattgtaaaaaattg tttgctgAAGGGTACAAAGATTTTCTTTAAATAGTTGGTCGACATCAATG ATCTTTAAcataaatgatttttgaaatttgcagcagagacttatttttac aagttCTGTCACATCCAAAATAATTGTCATAAGGATGAAATCTTACTTGT GTTTTAATGCTAAAATTTTCTACTTGGTAAGACCTTTTGCTTAACCTAAC TTAAACTAGGACTACAATCAGAAGACATTCCCAGTTCCAATCTAAATAAT AAACATAATTTGCAAGGCCTAAGATATAAGCAAAACACAACTGTTATACC AGATACTGCATCTTTTGATTggttttattcataaaaagttttttttattt gtatcaTTTGATTATAGGATCCAGTTTATTTCcaatttatgatttctttt tatttattgaaGTTTTGATGGCATTGATATCAAACCAATCATTGTACTTT GTTATCGTCAAACTCTAAAGATAAAAATCTGAGGGGGactcctttatttt ttatttcaagggGTGGGGGCATTCTAACAAGGGGTACTggtaatttttgt tcgatttaaggggggagttttctttaagggcaaaattgcattttaagggg ggactgAAAAAGTAGGCAGAAACCATGTTTTCATAcaattgttctcattt ttcaattgtcttattacatcaatcttcaggtaggtccattcagcatgtag cttgtttttttttacattgcagtgtaatttttctttgttttcaattaaaa gaagctattgtaacgtaaaatttctttgttctttttatattgaagaaaaa aatgtctttgttttttattatatagtaaaaaaaagtctctgacacaggac ttgggggagaaaagaataaggggacaaaagtgtcccccgccgaagagtgc aaaaagtggtaatagtgcaattaacgattaatcgcactcctctaaaccaa ttagattcgagtaattttgcacggctgacgattataTAAGGTTTTTGTTC GGTGCGAGTCTATACCGAGTCTATACACAGAGTCTTGCCGCaattttttg gacccacgagatacccacgtaaattttttggacccacgagatacccacgt aatTCTTTTTGGACCCATGAGATACCCACGTAAATtctttttggacccac gagatacccacgAAGGCACGAGACCCACGTAACCCACGAGGGCACAAGCC ACGTAACTCACGAGACCCACGAGGGCATGCAAGGCACGCAAATAATCACA CTACTATTGAAAGGACGGTAGAACTTTGAGAACCACTATGTTGTTCTGAA AACATCATTCGTGTGCACagagttgttaaaagcaaactaactttttaaga tgatcaattaggtccatATGATCATAAAAACAAGTGGTgagaaaattttg accattttgctgtaccatgtttgtttatgaaatatgctgacaaagcatat GAGCCCCCTCTTTCTGATTTGCACGCCAGGGGCCATGTCTGAAAGAAATT CAATGTTCCAATCTAATATTGAAGAAAAATCACATTCTCGAAAGCATAAA ATTTAAGGGGTACTgtggaaaagaaaaagaagatttttaagcGGGGATTC GGAAATAAGGGGCACATTACAAATGGAATTCCAAATTGAGGGGGGAAATG GATGAGGGGTCATTTGCTGTTCAAGGGGGGACTGGAAAACATCGATGAAA CCATACTTATTATCATCaactcgggtgaaacaaggcatgtcccgttataa aatacatcgaaaaaacacgtcataagtaagattcaaatgacgtcattatt gaaaaatagcgataacttcaattttattaatgcAATCATTTAAGGCAAGA TCTGGAATCCACCCTCTACTTGAGAATCCAAATGATGAAAACTCCATTAA GTATGACGATAAAAGTAAAGCTGACATCCTCCAGAACCAATTCTGTAGTG TTTTTACGCGTGAGCCACTCGAGGAGCTCCCTGAATTTGATTCNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCAATCAGT TTAACATCTATAGTTTGCCGAATAATGGAAAAGATTCTCAAAACCCATAT TATGACATATCTTGATCAAGAGAAATTACTATCTAGCAAACAATATGGCT TCATCAACCGCCGGTCAACTGTAACGATACAATTACTAAACTACCTAGAT GCTTGCACCGAAGATATTGGAAACGGTAAAGCCGTAGACGCAATATACTT TGACTTTGCAAAAGCATTCGACTCAGTTCCTNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAgttattttataacgt caaaatcagtttttggccgatatcttgagattggcttgatgtaaattttt gacccagcacttttcgaaatcctctcgttgatacgaatcttttgagctat atatgaaagttaatgaataatgagaagcggtgtgcgtcacgcaaaatata tttgggacatgccttgttttaCCCGAGAAGTACTAATTGATATTCGAAAA TTTTACAGGTATTACCACCACGATACTAACTAGCATAGTGTCTTGTACTa gtaactgcttgacccccctgCTGTGTAACCCCTATTTTAGTAGAAATCTT TtggataaaaaaaacaataaaaagcaAAGTGCTTTAAGATATTATATCAG TATTATGAACAGAAATGTTCCCTTTATTAATCTTTAGGTCAATAGCCTTC ACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTG GAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACT TGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatc AACGGAGCCGTTCTGGATTCATAAACCAGGTATATGCTTTTGCTAATATC ACTCTGTAGAGCACAGTCAATGGACTTCATCatagagatttttgtttaat gATTGaggctgaaaaattgaaattgttgaagaacAGCCTTTTTTACGCCG AATATTACCGgctaaatataaaataaaacgcGTGCAGAGTGTAAACCCAC AGTAGCAACCAAAGAATCAATATCTTATCGCGCTTCCAAATAATCCCaag tttctcaaaaaaaaacttttgcaggGGGCagcaataaaatcaaaatcaga gTTGGTGAAAGTTGAAAGATGAAAGATACATCGCTAGTATGAATCTTTGG AATTGGATGGTCTCATGTGTACTTGGCATTATATGAAGGAttcacaaaaa ttaattttggttaTCCAGCTCCTTGACTTGATTTGTAACAGATAAGCCGA TTTCACATTTCACCCTGATTTCCGGCCACTATACAGCTCTCACTCCCAAC TTTTGGAATCCACTTCTTTTCCTTCCACAGCCGCAAGAAGTATCATTATT ATGCATTAAAATCTTGCTTTAGGTAACCAGACTGGGAGCCAAACTATTAG AGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaagaa gaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaag ttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGTC GAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGAA CACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATAA AGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACATT TTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGGTAT TCAATTTTATCACATTCAACAAAGAtctaaatctttaaattttgaagacA TAAAACTTAAGATCTTGAAACTGAGTCTTTTATCTCTTGTTATTTACAAT CGTTAAAATTGGGTCATTTCTTGATTTAgagttcgaaaattatttcagaA GAACCAAAACAAGATCTTGCAATGTAGTCTTGCCGAAGTAATTAATCATA ATATGAAGGTAAGTATAGCCTAATTGTGATGTCTCTTTCTCATTTACATA CTGGGGTTTTTGTTTCAACAGTTAATAAAGTTCATTTTTGCTTTATACTA TTATTGAATTTCGGTGCTTCAGCAAAACCTATTCAAACTTTTCCATTACA GCCAACCCGCGATCGTGGAATGTTCCACGCTCTACATCAGTAATTTCCTT TACATTGTTTTTCGCAGGAAACAGCTATTAAAGTGCTTGATTGTTGTATT AACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGATAACGACGA AAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATTTCTACTATG ACTTGCTGGATAGCGACCAGAAAGGTATAGACTATACCAATTATAATAAT TATATTATAGTCTAGCAGCTTTAGCGTTTGCTAAACTCCTCTTCGCCGAA AAAGACAACGTAAAGTTCGCTTATCAAAATAAATCGACCGTTGTCAGGGT GATAAAGGCTAATGTAGCCTGGGGTCCATTTAGGCTTTTTGATTGACTGG AATAATTATGCGGTTAAGTTTCACTGGACTCGGCgccatcaaaattttca aaaaagctcatttaaaaaaagtttaagcCATAAGGAGACTCTAGTCTAAG GTTAATGTAGCTCGCATACTCAAAATAAGTATCACCTGAATACTAGTAAG TGACAATTTTTGAAACGTATATTGTTTCGAAAATACATTTATCTGATATA CAGTCTCTTGGCACCGGAAAAGACTTTTAACATCTAGCctgaaaattata aaactatGAATTATTTACCTCCTATTAGGAGAGGTATTCTCCAAGAAACA AATATAGGAATCggacattttcttgaaaaatgaagacatgTTTGCTTGAA AACTCTCACTTATGTGTGGTTGTTAGTCTTAAagttatagtttgttttta gGAAACGCCCCTAAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATT TGATCATCTACAATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCA CCAAAAAAGTAAGATCGGTGTCGATTGTATGTCTGTAAGAGGTCTTAAAT AATTCCTATTCTGAAAAGCGCTAAACAAAGAATGATATAAGTGGTATATT AGAATGGGTGTTTGCATTTTTACAGTGAGTTTGGATTTGActcgttttta tttttccagagGTATCCGCACaactaaaattaatttatttttactttaaa acgtTCGTCCGCAACatatataaatattaaaaatggaACAGCCAAATATT TATCCACTCTTGTTTTTAGGCTGCTGTCTCTCACCCCACTGTTGTAATGT TGGTAGATCGAAAATGGAATACCTTTGGAAAGCGTCGAATTTTGTAAGTT TCtttgatgaaatggaaaattgCTCGCTTCACAGAGTGATCATTCAAAAA TTTAACCAGGTGGTGGTCATGGTCAAGCGGAAAAtattaaatttctcaaa aaaagtaaCATCTTAATGAACTTAAATTAAAGGCTTTTTTAGTGATAAGA AAGAAACATGAAAGTCTTTGCTTAAAGATTGATCTTTTTATTAGTTTGGC ATAATGCGCCGAGGCTTGGTTACTTAAAGGGCCCCGGCTGGGCATATAGA CACTTAgtcaaaattttattggttCCTATTCTTTTCGTCAATGTGAACCC CTCGCACTTTGTTACTTTCAATGATTCGAACATAAATTATCTTGCTAGAC TACCCTAGAAGTTCAAAGATTAAATCATACTACAgattttaatttgaaga aaatatattttttaaattaacaatttttttaaaattttgtttgttaTAGT ATGTTCATggctttgtatttatttttcctaTTGATGTTGGCATTGGGATT ATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACATGGTTATCAAAATGA TTGTCGTTATATTCAACATTCTTTATACTTTCGAAGAAGTCGATCAAATG TTTAAGTATGTAAACATTTAAACGCCGGCAAATAgcataaatatcttttt aatggtATACCAAACACAGATttctataaagcccgaagggctagatggag tgctttaagccttttcaagcaaaaaagttaatatattaaaaaatattgtt gcctttgttttcgaaaattcgCAAAGCTTAGTCAAGCgctaaaattctat tgtaatgtcacgtgacctcaGTAGGATTGCCTACCAAatcacggcacact tttcagccaaaaaacgcttcgggctttataaatttaGTCTGGCGGCGAAA ACGGCTTTTTTGCATCAACCCttacaagtagtaaatatgggtttttattt tattttctcattatatggtccattgggaccccaaaaccggtttttgccaa gctggcaaagctggggaaaattttttatgggggcttgaagggggtagggt cattttagcctgggggtccttNNNNGAATGCAATAtttaatgctgacgtc agcatttttgagagaatttccagcgaaagataccagttttaacagatgcg tctcgaaaagtactatcgattagaggggtcatttatagggtttcctaggc tagatcatgagatatttgagtttgaaattttgctgactgctgactcagcg tttttcaacgttttttgcccttttctgctgagtcagcaaaattttaaact ctaatatctcatgatctagcctaggaaaccctataaatgacccctccaat cgatagtactcttcgagacgcatctgttaaaactggtatctttcgctgaa aattttctcaaaaatgctgacgtcagcattaaaTATTGCATTCTTGAAGA CGTATCATCCAATTCCGGGGGACTAAGTCCactaaatgagacaaatgacc ccattttggagatctactcttcaagctctatctgatggcacaatcagttt tagctaaatgagaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNctatctgatggcacaatcagttt tagctaaatgagaacttcaaaaatcgactttctaaagacccccaggctaa aatgaccctacccccttcaagcccccataaaaaaatttccccagctttgc cagcttggcaaaaactggttttggggtaccaagggaccatatgatgggaa aataaaataaaaacccatatttactcattgtaagggtgatcctggatcgc cgccggactaATTTATGATAGCAGCCATCGTCTTACTCTCGAGCAACTAT CATCTCAGAATGATTAAAATGGTTTTGAGATTCTTTAAGCTTTCTTAGCT TAGACTTTTAAAACCAAGATTCTAGGACAATTGCCCCCAGACAATTACCC CCAGGACAATTGCCCCCAGACAATTACCCCCAGGACAATTGCCCCCAGAC AATTACCCCCAGGACAAATGCCCCCCCTAAAAAAGATCTCCCAAACAATT ACCTTTGAGACAATTATTTATTGTACAGTTAGTCTTTTTACTATTTCTCT TGTTATTCTTTAAAACTGCATTTAAGAATGCTGTACGAAAGTGTATCCgt gatttcatttttataaagctgaagaaaaaaaatttgctatcCCTCCCAGG AAACTGCCATAGCGTTCACAAActgctttttcatttttccaaaaaaatat aacTTACAATCAGAAAACTCACACTTGGCAAGTTAATATTTTCGGCCCCG GATAATGAAAATCCTGGGCCTGTAGAAATGGTTTTTACAGGCCTGTAAGT GACTCATTTTTAAAGggcaaccccccccccccgggaatggACAATTCCTA TTTATTCTCGTTCAATGTAGTCCAAAATTTTGTGTAATTATTAAGTTCAA ACTCCTAAACACTTATAAGGGGCATAAATTGAATGCTTTTAGTATCAGTC AAGAATAGAAATAAATTTAGTTCCGTGCTgtttcaggcagtcttcagtcG ATTTTTTTTGCAACGAATGCTTTTGGTATGTgcttaaaaattgttttcta atGTTACGAAAATATTTGTCTAGTTTTATTcgttttcattttgattttca gccCTAAACTTCAAACTGGCCCTCGTGAACCttaaaaaggatattcaaaG GGTAAAACAATGTCCTATTAATATGCAATTGTAAtttgctttcaattttt ctttctttgtttttcttttcagagaGGGTCGTGGATACTTTTGTGATTGG TTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCC TCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCAT CTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAG TAAGTATTCCATTTTCACCACACAAATAATGCGAGGCCACTCCTTTTGCC AGACCAAGATCTATCATTGACATTGTGCACAtagtaaatttaaaaattta ccaTGGTCGAAGCCTTTTTCCGCTGTTATACCTCATATTTTTTACACAGT TTTATTATTATTGAATTCTTATTTTCCAGGAAATTGGGTCCATACGCTAA AGTATTTTTCGACTTGTTGAAGAAGGATATTTGGGTCTTCTTGCAATTGT TCATTGTACTCATGGTAGCGTTTACTGGCAGTGTTTTCCTTGCATTGAAG TCTGAAAAATCTGACGGTGGAAAAATGTAAgtttatcttttcaacatttt tgattcCCAACAGGCAACCTTTATTATCATATATTGAAGTCATATCTCTA TTGTTGGCAATATGTTTGgtacattttctttttcgaCCTCAAATTATGCT TGAATTGCATTCTTGTTGCTTAACTATGTGAATTTTCATTGATCTCGAAG AAAGTCTATCACATATAAAAACATATTAAAGGCCTAAGCTTTTCGGAGGA AAGTAATTGGCAAGAGTTTTTGATTTCAAGAATTGATGGTAAAAATGACA CGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCACGAGCACTGGCTGAG GGAAAAGAATTTGCTGATGATTATGACGGTGTCTATTCGTAAGTCTCTTT CACTTTAGTCTACGCAGGTGCTGTCGCGTCCTGTTTCCCTTGATCTATAT TTCAAATCTTCAGATCCTATGGGTGTGGAAAACCTAAACTAGCAGGGTAT ATTTTAGGAAGTTTTTTCTTGACTGCTGAACAAAATGTGCTCCAATTTTA CAGTGGTTCAGTGATCAATTTCTAGTGGGGTGACCCTTTGATGTCAGAAA TTCATATCTCAAGACTTTGAGTTGAgtttactttaggcgtacaaactttc gcgagcagaaactttcgcgaggacgaaaaatcgcgaaattcacgacattt actttcgcgaatttaacggaaaaatatttttCGCGAGCATAAAATTTCGC GAATCAAGACGTAAAATTGAGAATTTTCACATGAAAAGATGGCTTAGAGA Cacaaatacttcttgggttggcttgaaacatttgtcctttgacttattag tcttttagcagtctaaaaagtgccataaaagttacatttcattcaaagtt tgaagttttacagattttctattttgtcaagaatttttcgcgaacataaa ctttcgcgaatggcccttcctagaatttttaaagacatttactttcacga aaatggccaaaattcgcgaaaatcgcgaaagtttctgctcgcgaaagttt ctacgcctaaagtatatgGATTCTTCATTGGGTCTGTTCACTAACAAGCT TCTATTGAATGAATCAATTATCCAGTAAGCTGAAAAATGGAATGCCTTAA GAAAAGTAATGCTAGCAAGAACTAATTCTTAATCTTATGGTTTGTAACAC TTTTAATCTCATTTTAGCAGCaatttcattttagattttagtGAGAAATA ATTCCAtaacaaatttgccaaaattagtttccttaaGGTTAACTTGAAAC GATTTACGAAGCGGTTTCATAATTTGGCTTCATTATTTGGCTCAGTCATT GATAACCATGAACACTACAGCTTAATTATCACGCGTGTCTCAGTAGATTA CTCCATTTCATTGAATCTTTTTTACGTTTCTTATTCCTGATTTGATTGGC ACGCCTTTCATCCCCGGGCTTTCATCCAAGATCCTGGATGATTGCCATGA TTACTTTTGTTGCGCGTTGAGTGAAATCGGTGTTTTTCTTCACAGCTTGA TATGTAAAATTTATACACTGATACTCACGATGGTCCTTGATCCAATATTT TTCGGTGTTTTTTAGAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGG CAGCAATTATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCA CGTTATGAAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAG AGCCAAATATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTGTAA GAGAACTTTGATACTCTCATTTTGAGGGTTTAATTTTATACGCTTTTTAt acaagaaccagtaaattttgcctcgtgctgggctgttcttaattttctgg aattttcaggcttaaatgttttcatgatgttcttaatacgcatagtttct ttacttataaacttaaaatgggtttaaaatctgttaaaatcatcactttc ttagtaatttctgaaatcctAGGTTCAGGATTATTCTTAATTTGCTCTTA GGTTCTGGCCAATTTTCagtctaaaattgttcttataaaattgctcAATT ATCCACGATGACCCGTGAACCCGAACTTCCCCTGAGAACGCCGGAAACCC ATATTAAAAGAATTATAGTCGAAAGTTTTAAGTCCAGTAAAACTTGGATG TTCAGATGAAATTCTTCAGAGTCTTAAAACAACTTATTAGGATGACGTTT TCCAAATTAAACCCTTCAGGGCTAAACATTACAAAAGACCAATTTTGCCT TAGACTTGATGATTTGAGGTCAAGCCAAATTTTTGTTGTATATACCGTTT CTATTCTCTAGAATTTACGCATCAAGTATTATGAAAAAGCGGATTACGTT ACAGATGATGCAAAAGTCAAAGGTAatcaacgataccaaatttacaCTAT ATCTggtattagtactagtaatacCATGATTTGGAGGAGAGTCATTTGGG ATAAATAGCCCCGAACGTAGTAAATCACCCGGAGAAAAAGTCTTGAAATA TCTCCCGTTAATTGTAATGGCATGAGAAAATCTTAAAGTTTGTTTCTTTA TTATTCTACTGctgatttgaaaaatacaacATTCGAATACGACTTTTTCT CACTCAATCAAAACGATCGAATAATGTGATTACAAAAAGTAAGGCTATAA CGGCTTAATCGTTCCGCTGGTTGTCCCTTACATCTGTAAGCTAGGATATA ACCAGTCATATAATGGATTGGTGAATTAGGATCAACAGAAATCAGTATAC GTATATTGTAAATTGAAAAcactatttttcagaaattttaaccGATTGGC ACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCAATCAAGTAAGCC AACATTTTAAGCTctttttttagttctttttttttaattctctttctttG TAAGGGATTAGCTAAGCTTACCCAATTACAGCTACCCTGTACCAGAGCAA AAAGCGTGGCACGGTAATGAGTTTTAAAACCCGTAGATAAAGGGGTTGTA TACAGACAAAATTACAGTTGATTTTAATCATTTAAACGAatatcaaatct ttttttccagaaaattaCAAGAGAAGATGAAAGCATCGAAATGATAGAAA AAGTTATGTTGAAATAGCGCCAAAATGATGGCTCATCAGACACTCGATGA GAGGCGAAGGGAGACCTTTCTTTCACAAAATTGCTGAGTGTAGATTTTAG TTTAATAAAATATTTCGCGGGACGTATCCCACGTCTCGAGTTTTGGCATT GATCTATTTGACTTTCATGCCTTAACCCAGTTTCCAATAAAATGTGGACA GTACTAGACCTAATTTAAGCGACCAACACCTTGCCTCCACTCAATGAAAA GACGGGGGAAAATTGACGTAAAGTTGGTAAAtcttcaaatctttgtttgt aaCGTAATTGCGTCAAAAGAAAGCAAATCTAGAGAAGGCTCTTTAGAGCt tgaatatatattttaaagtctgtccagtATCCTTTGGACTTGTATTATCC TATAGAAAAATCACGGATCCCCCTTGTGCCCAGTGGTAATACTTCAAATC GATACGCTAGAGGCCAGAATATAGTAAAAcaggaggttcttggatcactc gtgggccaaaaatggtcaaaacctttaaaaaattgatttttgtcaaattt taacatttttttgactttttgccttataatctcgctggaaagactgactt ttgaatttttttttgcttgaccatgaagcacaatccgattcctacgagtt agaccaaaaattacgatttctaactcaaactgggcatttcaggagggctt cgccctcctatgtAAGTCCATGTTCAATATactcgacattggcacttagG GTTAACGCTTTAAATGTCGGCTACATTTATGCGGCTATAGATTAAAACAT TAGTACCAGCATTAAGTCTAAACtttaagataattttaaaattgtaatta tttgtaacttctttttttggctatagtatttttcttcttcagatttttat ttttgcatcaccctttttgtaactttttttagtCATACAGAATCACATTG TACTGTTTTATTTAAGAGTGGAATAAGAAAATTATA

Coding sequence (CDS) from alignment at scaffold_9:326480..364015+

>TCONS_00073312 ID=TCONS_00073312|Name=TCONS_00073312|organism=Clytia hemisphaerica|type=CDS|length=30735bp|location=Sequence derived from alignment at scaffold_9:326480..364015+ (Clytia hemisphaerica)
ATGTATTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGA
TTCAAAGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatc
cgtttcgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGC
CTTCACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCA
AGTGGAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTT
TACTTGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaat
gatcAACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGC
CAAACTATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaag
aagaagaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtc
tacaaaaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATAT
GCTGGCTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACT
ATTACCCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAAT
GATCCTGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTA
CGCCAAACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACG
AATTCAGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAA
TGTAGTCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAA
AGTGCTTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGA
TTGGAGTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGA
TCATATCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGC
CCCTAAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATC
TACAATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAA
GCTGCTGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAA
TACCTTTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttt
tcctaTTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAAT
GAAGTTGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTA
TACTTTCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTT
GTGATTGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTG
TTGATTCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGC
ATCGGCATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCG
CGTTCGAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAG
AAGGATATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTT
TACTGGCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAA
AAATAATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTG
AGAGAAGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGA
CGGTGTCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAG
CAATTATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGT
TATGAAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGC
CAAATATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTAC
GCATCAAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTC
AAAGaaattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAAC
CAGAGAAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAA
TGTATTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGAT
TCAAAGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatcc
gtttcgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCC
TTCACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAA
GTGGAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTT
ACTTGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatg
atcAACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCC
AAACTATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaaga
agaagaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtct
acaaaaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATG
CTGGCTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTA
TTACCCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATG
ATCCTGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTAC
GCCAAACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGA
ATTCAGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAAT
GTAGTCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAA
GTGCTTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGAT
TGGAGTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGAT
CATATCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCC
CCTAAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCT
ACAATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAG
CTGCTGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAAT
ACCTTTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttattttt
cctaTTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATG
AAGTTGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTAT
ACTTTCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTG
TGATTGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGT
TGATTCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCA
TCGGCATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGC
GTTCGAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGA
AGGATATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTT
ACTGGCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAA
AATAATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGA
GAGAAGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGAC
GGTGTCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGC
AATTATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTT
ATGAAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCC
AAATATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACG
CATCAAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCA
AAGaaattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACC
AGAGAAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAAT
GTATTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATT
CAAAGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccg
tttcgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCT
TCACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAG
TGGAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTA
CTTGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatga
tcAACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCA
AACTATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaa
gaagaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtcta
caaaaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGC
TGGCTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTAT
TACCCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGA
TCCTGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACG
CCAAACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAA
TTCAGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATG
TAGTCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAG
TGCTTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATT
GGAGTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATC
ATATCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCC
CTAAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTA
CAATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGC
TGCTGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATA
CCTTTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttc
ctaTTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGA
AGTTGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATA
CTTTCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGT
GATTGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTT
GATTCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCAT
CGGCATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCG
TTCGAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAA
GGATATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTA
CTGGCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAA
ATAATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAG
AGAAGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACG
GTGTCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCA
ATTATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTA
TGAAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCA
AATATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGC
ATCAAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAA
AGaaattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCA
GAGAAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATG
TATTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTC
AAAGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgt
ttcgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTT
CACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGT
GGAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTAC
TTGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgat
cAACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAA
ACTATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaag
aagaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctac
aaaaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCT
GGCTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATT
ACCCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGAT
CCTGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGC
CAAACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAAT
TCAGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGT
AGTCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGT
GCTTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTG
GAGTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCA
TATCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCC
TAAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTAC
AATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCT
GCTGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATAC
CTTTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcc
taTTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAA
GTTGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATAC
TTTCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTG
ATTGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTG
ATTCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATC
GGCATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGT
TCGAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAG
GATATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTAC
TGGCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAA
TAATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGA
GAAGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGG
TGTCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAA
TTATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTAT
GAAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAA
ATATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCA
TCAAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAA
GaaattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAG
AGAAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGT
ATTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCA
AAGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtt
tcgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTC
ACACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTG
GAGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACT
TGAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatc
AACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAA
CTATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaaga
agaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctaca
aaaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTG
GCTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTA
CCCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATC
CTGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCC
AAACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATT
CAGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTA
GTCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTG
CTTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGG
AGTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCAT
ATCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCT
AAGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACA
ATCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTG
CTGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACC
TTTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcct
aTTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAG
TTGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACT
TTCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGA
TTGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGA
TTCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCG
GCATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTT
CGAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGG
ATATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACT
GGCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAAT
AATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAG
AAGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGT
GTCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAAT
TATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATG
AAAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAA
TATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCAT
CAAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAG
aaattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGA
GAAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTA
TTCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAA
AGTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgttt
cgtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCA
CACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGG
AGGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTT
GAACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcA
ACGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAAC
TATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaa
gaagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaa
aaaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGG
CTAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTAC
CCTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCC
TGATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCA
AACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTC
AGagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAG
TCTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGC
TTGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGA
GTCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATA
TCATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTA
AGAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAA
TCATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGC
TGTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCT
TTGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttccta
TTGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGT
TGACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTT
TCGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGAT
TGGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGAT
TCCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGG
CATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTC
GAGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGA
TATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTG
GCAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATA
ATTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGA
AGCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTG
TCTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATT
ATCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGA
AAAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAAT
ATATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATC
AAGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGa
aattttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAG
AAGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTAT
TCTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAA
GTTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttc
gtcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCAC
ACTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGA
GGTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTG
AACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAA
CGGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACT
ATTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaag
aagaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaa
aaaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGC
TAGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACC
CTGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCT
GATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAA
ACATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCA
GagttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGT
CTTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCT
TGATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAG
TCGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATAT
CATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAA
GAAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAAT
CATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCT
GTCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTT
TGGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaT
TGATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTT
GACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTT
CGAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATT
GGTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATT
CCTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGC
ATCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCG
AGAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGAT
ATTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGG
CAGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAA
TTGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAA
GCACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGT
CTATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTA
TCGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAA
AAAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATA
TATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCA
AGTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaa
attttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGA
AGCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATT
CTAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAG
TTGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcg
tcaaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACA
CTAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAG
GTCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGA
ACAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAAC
GGAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTA
TTAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaaga
agaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaa
aaagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCT
AGTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCC
TGAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTG
ATAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAA
CATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAG
agttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTC
TTGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTT
GATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGT
CGATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATC
ATTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAG
AAACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATC
ATCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTG
TCTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTT
GGAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTT
GATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTG
ACATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTC
GAAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTG
GTTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTC
CTCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCA
TCTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGA
GAAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATA
TTTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGC
AGTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAAT
TGATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAG
CACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTC
TATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTAT
CGTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAA
AAGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATAT
ATTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAA
GTATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaa
ttttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAA
GCAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTC
TAGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGT
TGGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgt
caaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACAC
TAAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGG
TCTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAA
CAAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACG
GAGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTAT
TAGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaa
gaagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaa
aagttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTA
GTCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCT
GAACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGA
TAAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAAC
ATTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGa
gttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCT
TGCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTG
ATTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTC
GATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCA
TTTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGA
AACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCA
TCACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGT
CTCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTG
GAAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTG
ATGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGA
CATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCG
AAGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGG
TTCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCC
TCTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCAT
CTTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAG
AAATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATAT
TTGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCA
GTGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATT
GATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGC
ACGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCT
ATTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATC
GTGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAA
AGCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATA
TTTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAG
TATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaat
tttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAG
CAATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCT
AGTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTT
GGATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtc
aaaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACT
AAAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGT
CTTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAAC
AAGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGG
AGCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATT
AGAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaag
aagaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaa
agttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAG
TCGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTG
AACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGAT
AAAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACA
TTTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGag
ttcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTT
GCCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGA
TTGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCG
ATAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCAT
TTCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAA
ACCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCAT
CACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTC
TCTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGG
AAAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGA
TGTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGAC
ATGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGA
AGAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGT
TCAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCT
CTATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATC
TTTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGA
AATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATT
TGGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAG
TGTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTG
ATGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCA
CGAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTA
TTCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCG
TGGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAA
GCTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATAT
TTGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGT
ATTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaatt
ttaaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGC
AATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCTA
GTACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTTG
GATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtca
aaatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACTA
AAGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGTC
TTCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAACA
AGTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGGA
GCCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATTA
GAGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaaga
agaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaa
gttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGT
CGAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGA
ACACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATA
AAGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACAT
TTTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGagt
tcgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTTG
CCGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGAT
TGTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGA
TAACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATT
TCTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAAA
CCACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCATC
ACCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTCT
CTCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGGA
AAGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGAT
GTTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACA
TGGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGAA
GAAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGTT
CAACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCTC
TATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATCT
TTCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGAA
ATTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATTT
GGGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAGT
GTTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTGA
TGGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCAC
GAGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTAT
TCAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCGT
GGTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAAG
CTGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATATT
TGCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGTA
TTATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaattt
taaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCA
ATCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCTAG
TACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTTGG
ATATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtcaa
aatttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACTAA
AGGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGTCT
TCACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAACAA
GTCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGGAG
CCGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATTAG
AGCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaagaa
gaggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaag
ttttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGTC
GAGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGAA
CACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATAA
AGATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACATT
TTGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGagtt
cgaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTTGC
CGAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGATT
GTTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGAT
AACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATTT
CTACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAAAC
CACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCATCA
CCTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTCTC
TCACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGGAA
AGCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGATG
TTGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACAT
GGTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGAAG
AAGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGTTC
AACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCTCT
ATATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATCTT
TCATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGAAA
TTGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATTTG
GGTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAGTG
TTTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTGAT
GGTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCACG
AGCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTATT
CAGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCGTG
GTTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAAGC
TGCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATATTT
GCAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGTAT
TATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaatttt
aaccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCAA
TCAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCTAGT
ACAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTTGGA
TATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtcaaa
atttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACTAAA
GGAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGTCTT
CACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAACAAG
TCTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGGAGC
CGTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATTAGA
GCTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaagaag
aggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaagt
tttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGTCG
AGATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGAAC
ACCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATAAA
GATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACATTT
TGACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGagttc
gaaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTTGCC
GAAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGATTG
TTGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGATA
ACGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATTTC
TACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAAACC
ACAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCATCAC
CTCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTCTCT
CACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGGAAA
GCGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGATGT
TGGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACATG
GTTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGAAGA
AGTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGTTCA
ACGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCTCTA
TATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATCTTT
CATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGAAAT
TGGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATTTGG
GTCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAGTGT
TTTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTGATG
GTAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCACGA
GCACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTATTC
AGCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCGTGG
TTTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAAGCT
GCAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATATTTG
CAAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGTATT
ATGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaatttta
accGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCAAT
CAAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCTAGTA
CAAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTTGGAT
ATGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtcaaaa
tttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACTAAAG
GAGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGTCTTC
ACAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAACAAGT
CTATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGGAGCC
GTTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATTAGAG
CTTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaagaaga
ggaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaagtt
ttttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGTCGA
GATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGAACA
CCTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATAAAG
ATACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACATTTT
GACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGagttcg
aaaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTTGCCG
AAGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGATTGT
TGTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGATAA
CGACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATTTCT
ACTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAAACCA
CAAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCATCACC
TCTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTCTCTC
ACCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGGAAAG
CGTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGATGTT
GGCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACATGG
TTATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGAAGAA
GTCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGTTCAA
CGCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCTCTAT
ATGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATCTTTC
ATCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGAAATT
GGGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATTTGGG
TCTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAGTGTT
TTCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTGATGG
TAAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCACGAG
CACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTATTCA
GCTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCGTGGT
TTTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAAGCTG
CAGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATATTTGC
AAAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGTATTA
TGAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaattttaa
ccGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCAATC
AAaaaattaCAAGAGAAGATGAAAGCATCGAAATGAATGTATTCTAGTAC
AAAAGATGTTACTCCATTGATGGATCTTAACAAAGATTCAAAGTTGGATA
TGccttcaaaaaatgaagatgaatttctcaaaaatccgtttcgtcaaaat
ttcaaaagcaatgaattttggAAAAAGGTCAATAGCCTTCACACTAAAGG
AGGAAAGTCGTGGGATGATGCCTTGACAACTGTTCAAGTGGAGGTCTTCA
CAGCAACATGTGGGAACGATGATCCAATGATATCTTTACTTGAACAAGTC
TATGACAAATTTATTGTTctggaaaaagttaaaaatgatcAACGGAGCCG
TTCTGGATTCATAAACCAGGTAACCAGACTGGGAGCCAAACTATTAGAGC
TTGATAAAGAGAGAGCTACTCagcaaaatgaagaagaagaagaagaagag
gaggaggaggaagaagaagaagacctGGGTCCAGtctacaaaaaaagttt
tttctataTAGAAAACAAGCCGACTCTGTTACATATGCTGGCTAGTCGAG
ATTTGTTTGACCTTTGTGAGATCTATCTCAATGACTATTACCCTGAACAC
CTTTATTCACTCGACAACCCAACCATATTGCCCAATGATCCTGATAAAGA
TACAAAGTTTCGAAAAATGCCCTTTGAGTATGCTTACGCCAAACATTTTG
ACCAAACTGCAGCATTTCTAGCTGGTAAAATGGACGAATTCAGagttcga
aaattatttcagaAGAACCAAAACAAGATCTTGCAATGTAGTCTTGCCGA
AGTAATTAATCATAATATGAAGGAAACAGCTATTAAAGTGCTTGATTGTT
GTATTAACCCTGATTGGCCATTCGTACCAACTGAGATTGGAGTCGATAAC
GACGAAAGTTGGAGTAGACTAAAAGAAGATCCTCGATCATATCATTTCTA
CTATGACTTGCTGGATAGCGACCAGAAAGGAAACGCCCCTAAGAAACCAC
AAGAAGGAATGGATAAAAGGGATCGATTTGATCATCTACAATCATCACCT
CTGCAAGTGTTAATTAATAATGAAGTCACCAAAAAAGCTGCTGTCTCTCA
CCCCACTGTTGTAATGTTGGTAGATCGAAAATGGAATACCTTTGGAAAGC
GTCGAATTTTTATGTTCATggctttgtatttatttttcctaTTGATGTTG
GCATTGGGATTATTTGGCAGTGAAAATTGGGGCAATGAAGTTGACATGGT
TATCAAAATGATTGTCGTTATATTCAACATTCTTTATACTTTCGAAGAAG
TCGATCAAATGTTTAAagaGGGTCGTGGATACTTTTGTGATTGGTTCAAC
GCATTTGACTTTCTTGGTATTGCCACCATTTATGTGTTGATTCCTCTATA
TGCGTTTGGTGAATACAAAGCTTTTTATGGAGTTGCATCGGCATCTTTCA
TCCTCAACTTCATGCGTGCCTTCAAATTCTTTTCCGCGTTCGAGAAATTG
GGTCCATACGCTAAAGTATTTTTCGACTTGTTGAAGAAGGATATTTGGGT
CTTCTTGCAATTGTTCATTGTACTCATGGTAGCGTTTACTGGCAGTGTTT
TCCTTGCATTGAAGTCTGAAAAATCTGACGGTGGAAAAATAATTGATGGT
AAAAATGACACGCTAACTTTCTGGTCAACGATGTTGAGAGAAGCACGAGC
ACTGGCTGAGGGAAAAGAATTTGCTGATGATTATGACGGTGTCTATTCAG
CTCCCCTCGTGATGTTTCTGTTACTCAATATGGCAGCAATTATCGTGGTT
TTGAGCAATATGCTAATCGGTCAAATCAGTGCACGTTATGAAAAAGCTGC
AGAAAATGCACGAGTGGAAAGTGCCATTGCAAGAGCCAAATATATTTGCA
AAATCGAGAAAAGCAGATTCCTCTGTGGTAATTTACGCATCAAGTATTAT
GAAAAAGCGGATTACGTTACAGATGATGCAAAAGTCAAAGaaattttaac
cGATTGGCACGAGTTGAAAAAAGATACAGAATCAACCAGAGAAGCAATCA
AaaaattaCAAGAGAAGATGAAAGCATCGAAATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045481XLOC_045481Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073312-exon-scaffold_9-1491911889:326480..326610TCONS_00073312-exon-scaffold_9-1491911889:326480..326610Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:326480..326610TCONS_00073312-exon-scaffold_9-1510915933:326480..326610Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:326480..326610TCONS_00073312-exon-scaffold_9-1575043694:326480..326610Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:326891..327993TCONS_00073312-exon-scaffold_9-1491911889:326891..327993Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:326891..327993TCONS_00073312-exon-scaffold_9-1510915933:326891..327993Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:326891..327993TCONS_00073312-exon-scaffold_9-1575043694:326891..327993Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:353817..354008TCONS_00073312-exon-scaffold_9-1491911889:353817..354008Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:353817..354008TCONS_00073312-exon-scaffold_9-1510915933:353817..354008Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:353817..354008TCONS_00073312-exon-scaffold_9-1575043694:353817..354008Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:354552..354925TCONS_00073312-exon-scaffold_9-1491911889:354552..354925Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:354552..354925TCONS_00073312-exon-scaffold_9-1510915933:354552..354925Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:354552..354925TCONS_00073312-exon-scaffold_9-1575043694:354552..354925Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:355059..355137TCONS_00073312-exon-scaffold_9-1491911889:355059..355137Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:355059..355137TCONS_00073312-exon-scaffold_9-1510915933:355059..355137Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:355059..355137TCONS_00073312-exon-scaffold_9-1575043694:355059..355137Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:355347..355503TCONS_00073312-exon-scaffold_9-1491911889:355347..355503Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:355347..355503TCONS_00073312-exon-scaffold_9-1510915933:355347..355503Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:355347..355503TCONS_00073312-exon-scaffold_9-1575043694:355347..355503Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:356081..356187TCONS_00073312-exon-scaffold_9-1491911889:356081..356187Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:356081..356187TCONS_00073312-exon-scaffold_9-1510915933:356081..356187Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:356081..356187TCONS_00073312-exon-scaffold_9-1575043694:356081..356187Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:356449..356522TCONS_00073312-exon-scaffold_9-1491911889:356449..356522Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:356449..356522TCONS_00073312-exon-scaffold_9-1510915933:356449..356522Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:356449..356522TCONS_00073312-exon-scaffold_9-1575043694:356449..356522Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:356979..357134TCONS_00073312-exon-scaffold_9-1491911889:356979..357134Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:356979..357134TCONS_00073312-exon-scaffold_9-1510915933:356979..357134Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:356979..357134TCONS_00073312-exon-scaffold_9-1575043694:356979..357134Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:359402..359578TCONS_00073312-exon-scaffold_9-1491911889:359402..359578Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:359402..359578TCONS_00073312-exon-scaffold_9-1510915933:359402..359578Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:359402..359578TCONS_00073312-exon-scaffold_9-1575043694:359402..359578Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:359759..359905TCONS_00073312-exon-scaffold_9-1491911889:359759..359905Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:359759..359905TCONS_00073312-exon-scaffold_9-1510915933:359759..359905Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:359759..359905TCONS_00073312-exon-scaffold_9-1575043694:359759..359905Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:360160..360267TCONS_00073312-exon-scaffold_9-1491911889:360160..360267Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:360160..360267TCONS_00073312-exon-scaffold_9-1510915933:360160..360267Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:360160..360267TCONS_00073312-exon-scaffold_9-1575043694:360160..360267Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:361495..361675TCONS_00073312-exon-scaffold_9-1491911889:361495..361675Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:361495..361675TCONS_00073312-exon-scaffold_9-1510915933:361495..361675Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:361495..361675TCONS_00073312-exon-scaffold_9-1575043694:361495..361675Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:362241..362301TCONS_00073312-exon-scaffold_9-1491911889:362241..362301Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:362241..362301TCONS_00073312-exon-scaffold_9-1510915933:362241..362301Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:362241..362301TCONS_00073312-exon-scaffold_9-1575043694:362241..362301Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:362712..362772TCONS_00073312-exon-scaffold_9-1491911889:362712..362772Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:362712..362772TCONS_00073312-exon-scaffold_9-1510915933:362712..362772Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:362712..362772TCONS_00073312-exon-scaffold_9-1575043694:362712..362772Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1491911889:362990..364015TCONS_00073312-exon-scaffold_9-1491911889:362990..364015Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1510915933:362990..364015TCONS_00073312-exon-scaffold_9-1510915933:362990..364015Clytia hemisphaericaexon
TCONS_00073312-exon-scaffold_9-1575043694:362990..364015TCONS_00073312-exon-scaffold_9-1575043694:362990..364015Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073312-proteinTCONS_00073312-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:326480..364015 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0361557 0 0.030703 0.0300381 4.05464 3.30388 13.2639 14.2092 8.77995 9.59035 10.6486 11.0981 9.70301 8.81662 0.0513259 0.0605887 0.0339274 0.0278196 0.0288257 0.030164 0.0436967 0.0127882 0.0207277 0 10.5296 12.3162 0.0371824 0 0.0100325 0.0102215
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005821Ion_trans_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005216ion channel activity
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
GO:0006811ion transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016020 membrane
molecular_function GO:0005216 ion channel activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073312 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top