Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073303 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073303
Unique NameTCONS_00073303
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2581

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073303 ID=TCONS_00073303|Name=TCONS_00073303|organism=Clytia hemisphaerica|type=transcript|length=2581bp
gtCAGTACTTTGCAAGTTTATAAACGGAACTCTTAAGTTCCGGCATTGTT
CCGGATGATCACAATGCTGACATCATCTGTttggaaaatgaaagtgattt
ccATGAATTTCCAACTGTTTTTTTCCTGAGTTTTTGTTGTGTCAGCCAGA
CGTGAATGACCacattattttttattcaaataaagAGTTGGTGCATCATT
CCAAACTGAAAGATGGCTACAAAAAGAAATATGATTTTACGGATTCAAAC
ACCTGAAGGGATGAGGCGAATTCAAGTTGGTGGAGCTGATACTGTTAATA
CACTATACGAAAagGTCCAATCTTTTCTAAAACTCCAAACGAATGGCTGG
TCCATTTACAAAGACAGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAG
GAAAACATTGAAAGGCCTTCAACTGAATCATGGTGATGTTATTTACATGA
AAGAAACTGGCCATTTTGTATCCAACAGTCCTACCTCTATGGACGATCGA
CCCTCATCCAGTCAAAGCACTGACTCGACAACAGTGCAAACAGAGAAGGA
AGACAACACTTCAAAACTGGATGTTGTAGAAGACGAAATCGATGTCTTAT
TATCGCATCAATCAGGTCTCATCAAACGAGATCGGCATCCTCTTCTATGC
CGGCACGGTAaacaaggacaatgtttaaatTGTGCGCCACTGGAACCTTA
CAACGAAGACTACCTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCAT
TTCACGCATACTTGAAGAAAATGAAATCTGGCGTCGCGAAAGGCAAATAT
ATATCGTTAGAAGACGTAAATTGCAAAATCAAACCAGGCTGTACGGAGCA
TCCACCCTGGCCTAAAGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCA
TGCTAAATAGACAGACATACAGACATGTGGACAATATCATGTTCGAAAAT
CCTGTCATCATGGATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCA
GAGGATAGGTATATTATATGGTAAATATGAGAAACACGAGAACGTTCCTT
TGGGCATCCGAGCGACAGTAGCTGCCATTTATGAACCTCCTCAAGACAGT
AATAAAGATCGTATTCAACTCCTCCCCAACCCACAACAAGAGAGTGTTGA
TATACTGGCATCTTACTTTGGTCTCAAACAGGTTGGATGGATAGTTACCG
ACCTAATACCGGACACCGAGAAAGCCGGACTGGTCAAACACTTACGTCAC
GCCAAAACACATTTCCTGAGCGCACAGGAATGCATGATGGCGGCCGACTA
TCAAAACAAACATCCCAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTG
GTTCGAAATTCGTCACTGTCGTAGTGTCAGGTGACGAAGAGCAACACATT
CATTACGAAGGATGGCAGGTATCGAACCAATGCATGGCGTTAGTACGTGA
CCAATGTCTTGTTCCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAG
AGTCATCCAGTGAACAGTTTGTACCTGATGTTTTCTATAAAGTCAAAGAT
GAATACGGAAATGAAGTGACGAAGATTGGTCGACCCATGCCCATCGAATA
CTTTCTCATCGAGGTACCAGCAGGCTTCCCAATGGAACCTCAATCCACTT
TCATTTCAAGCGACCCAACAAATTTATTTCCCATCGAAAACAGAACGCAA
ATGATGGAAAACCAGAACTTCGAGACATTAACGCAACATTTGAATCGTTT
GAAATCAAGTGACGTGAATCTGTTGGAACATTTCTTAGATTTCCATTTTC
TTCTCTTCATCATGACCAATGAATTCATATCCATAAGGCACAAAATGAGC
GATCTGTGTAAAGCATTAAAACAAAGAGATCAAATGTTGTTTCATCAATG
GTTGGAATCTGACGAATGGAAAACCGTTGAAACTATGGTACAAACTCACG
CACCCATGGCAACGGACAGCCCGATGGACGGAAGTGATGCTGTTCCCATG
GAAACAGACAATAGTGTGACTATTACTGGTTGGACGTGTCCGCATTGCAC
TTTTATCAACAAAAATCCAACTTCAGACACATGTGATATGTGCACACTAC
CAAAAAGTTAATTACTTTGAATTAGACTTTgtggtatattttttacaatc
tGACTTCTCTTCAATATCGCTGCTCtttagatttttaaaagaataaaaat
ttaaCTGAGATTTTGGACTTTGTTTTCTTCCGAAACTTTGCAATCTTTTA
TACATCGGTGGGTCTTTGGCAGAAAATTTCATCCCAACTCAAGAAATGGG
AGTTTGTTTTTAAGAGTCAACTACAATTCTAACAGCTTTGCGATAATTTT
GCTGCACTTgatttttgttggtttgttggCCTGCGTTTTGTTAGCAAGTA
AGAATTAGTGTGTTTTCAATTGttcaatttttgttgatttttcgtAAAAT
AGTAGGACcaatatcaataattttttataagaactttaaatatttattaa
gttttattttgaaaatatcaaaaaagatTCTCAACATTTTTGGACGATTC
TACTTAATCTTCAGTTCAAGATATGTTCTGT
Run BLAST on NCBI

protein sequence of TCONS_00073303-protein

>TCONS_00073303-protein ID=TCONS_00073303-protein|Name=TCONS_00073303-protein|organism=Clytia hemisphaerica|type=polypeptide|length=632bp
MATKRNMILRIQTPEGMRRIQVGGADTVNTLYEKVQSFLKLQTNGWSIYK
DRGLNDELSKSSRKTLKGLQLNHGDVIYMKETGHFVSNSPTSMDDRPSSS
QSTDSTTVQTEKEDNTSKLDVVEDEIDVLLSHQSGLIKRDRHPLLCRHGK
QGQCLNCAPLEPYNEDYLKSLKPPAKHLSFHAYLKKMKSGVAKGKYISLE
DVNCKIKPGCTEHPPWPKGICTKCQPGAVMLNRQTYRHVDNIMFENPVIM
DRFLNYWRKTGGQRIGILYGKYEKHENVPLGIRATVAAIYEPPQDSNKDR
IQLLPNPQQESVDILASYFGLKQVGWIVTDLIPDTEKAGLVKHLRHAKTH
FLSAQECMMAADYQNKHPNPSKESKTGRFGSKFVTVVVSGDEEQHIHYEG
WQVSNQCMALVRDQCLVPTVDDSALGYIKESSSEQFVPDVFYKVKDEYGN
EVTKIGRPMPIEYFLIEVPAGFPMEPQSTFISSDPTNLFPIENRTQMMEN
QNFETLTQHLNRLKSSDVNLLEHFLDFHFLLFIMTNEFISIRHKMSDLCK
ALKQRDQMLFHQWLESDEWKTVETMVQTHAPMATDSPMDGSDAVPMETDN
SVTITGWTCPHCTFINKNPTSDTCDMCTLPKS
Run BLAST on NCBI

transcript from alignment at scaffold_9:112670..134111+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073303 ID=TCONS_00073303|Name=TCONS_00073303|organism=Clytia hemisphaerica|type=transcript|length=21442bp|location=Sequence derived from alignment at scaffold_9:112670..134111+ (Clytia hemisphaerica)
gtCAGTACTTTGCAAGTTTATAAACGGAACTCTTAAGTTCCGGCATTGTT CCGGATGATCACAATGCTGACATCATCTGTttggaaaatgaaagtgattt ccATGAATTTCCAACTGTTTTTTTCCTGAGTTTTTGTTGTGTCAGCCAGA CGTGAATGACCacattattttttattcaaataaagAGTTGGTGCATCATT CCAAACTGAAAGATGGCTACAAAAAGAAATGTAAGTTTGGTTcccttttt ttgcttttcattTCATTAGCCCAGGCCAGGCCCAGAAGTGAGAAGAGAAG GGAACCCTTCAAACACCTTTGTATTTGTCATCAGGGCTGTGAGTCTATTT TAGTAGACTCAAAAACAAGTTTAatatgtaccgtcaactgctctaactcg GGAGAAAGTTGGTCGAAATATGGGATTATTGATATCTGGACTGTATTTTT ACTTACTGTTattaaggggtcactcacaaatcaattttaggttagaagaa cgtcaattgacgtatattacagtcagggaaatccctcaattgcggtatac tgcaattcttgaatatactgcaattgcggtatatgaaaaatttaaaagtg acgtttataccgcaattgcagtaagaaattactaccgcaattgagggatt tccctgactacTGTATTATATGAGTGGGTGGGTTAAAGGTTGTTGATGTT TTTCAgaaacatcgatttttcattccatgccaaacttctcgccatgtttc tgtttgatcgctttgtttgttttgaaaaccaaaacaaacggcccgatgtt tatgtcttttctttgtttgaggaggaccctgccgacgcaccggactgtcc ggtgtatttgtctggtggcaaaaagtatcctttcactacaccggacgcaa tacgGTGTTTTGATTACTCCGGTGGAAAAAAGCATCcctctccgacaccg gacatctgacttccttaagtccggtgtagagatggtctggtggtaaaaaa gttctcattttacaccggactttcgcgtgtccggtgttcgttaaatccgg tgcgtcgacagggcccttttgttcttttgtttgaCGGCCTGAACGGCCCT TCAATTTTTGCAGATGGCAGTTCTTACTGTCGCTACACAtactacggaga taattaatatcgggaattttgtgaacaagtttagaaattatctctgtttc ttcttttttaaatataaactatgcgagccgtagtgaaaatcaagatgACT GACGCATaggttcagccccccccccttattttttggggggggctaagaaa tattttggcctttaaagagcctgggggctaaaattaccaaaatatttggg gggacctagattgttggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACTTCTCTCTA CGGGGgcgggagaacaatgtttttgtttttgtttatcttgggacctgaag tgttaggggacctagcacaatgcaattttttggggggagttaaattgttg gggggaccttactttgttggggggagctagaaacctggctgaagctatgt gACGGAACAGAGCGATGAAGgcagtttttatcgattttcggggatatcaa ggtgtttgacgtttttgggtgtgggtgggtgggtcagcttttaaaacgtc aattgacgttcttttaacctaaaatcgatttgtgagtgacccctaaatCC CAGACGGTACTATCTAATCGAATGTTCGATTATTGTGATCGAAGCCAGAC GGTACTATCAAACATTCGATTGTGattgaagtaatcaataatgatcgata aCAATCGAAGGTTATCAGTGACCacttatcgattctatcggtgatcgaat actcactcAACTCCAAATTATGGCATTTTTATCGACCATTTTTGATTCGT TCGATCGtttcgattactgttcgattactttcaatcactttcgatcatat tgaataccttcaattttatcaaatatattcCCAGTAgcagagcatcaaaa taatcttAAACCGAGTATATCTCGGCCAATTAAAACACATGATTCACGCg cgaaaaccactttcgttttctccgaccaatcagaacgcgcaaaaaccact ttcgttttctccgaccaatcagaacacgcgatatgagttacttgaggaaa cccagggcaAAGGCACACAAAATGGTGGGCGAAAAGGGTGGGAAATAAGG AGGTCAATCTTTATGGCGGgtcttctttttgtgctttggttttaggtcag tttttttggtttttcttaaagatatatcatagtaattggttatcgaagca atcaattggttatcgaagttgtcaaagttatcgaaagtaatcaataacaa tcaaagtattCAAACGGTAATCGATTCGTCGAAGgtttgttaagaaagtg atttcaaaatttttttgaaattttggtactcaaaTTTGATTGTTAATCGA TAAATGGTTGTTCAATTGCttcgatcattatcgattatttcgataatcga atttatcgattagtacTGTCTGgtcgaagtaatcaataatgatcgataat aatcgaaggtGATCAGTAATAATCGAAGGTGATCAGTGACCacttatcga ttctatcggtgatcgaatactcactcAACTCCAAATCATTGCATTTTATT TGaccattttcgatttgttcgatCGTTTCGATTACTGTTCAATTACTTTC AATCACTTTCGATCATGTTGAATACCGTCGATTATGTCGGATATGTTTCC TGTAGCAAAGCGCCCAATGAAATATGAGACTGAGTTTATTTCGTCCAATA AAAACACAGGATTTACGTGTGaaaccactttcgctttctccgaccaatca gaatgcgCGATATGTGTTATTTGAGAAAACCCTGGGCGAACACACTCAAG ATGGCGGGGAAGTATTGAAGGTGGTTCTTACGGCTTCGTTTTGTGTTTTG GTTTTAagtcaatgtttttggtttttccaaGGTATCTATGTAATCAACTG GTTATCAAAGAAATCAATAgttatcgaagtaatcaattaGTTAtcaaagt tatcgaaagtaatcaataacaatcaaagtacttgAACGGTTATCGAGTCT TTGAACGGGTTTACCGTCGCATTGGAAAGAATATTTGATGCGGCAAaagt tcattattcattatttttcaatacaCATCGGCCCGAACCTTCAGTGTAAA GAAAGTTGCCTTTTTGCCACTTTTAcccattgaaaacaaaaaaccttTGG ATATTTAGACTCCCAAAACATTGTAGAGTCTTTTGATTATCAAactaaga gaaaaataaaaagttttaacctTTAAATCTAATCATATTTCCTTTGTGTT TAAACTGTCAAAGTCATGTTCCCTCATgcgccgccatcttgaatttagaA TTAGAAGCATGTCGGAAACTAGAACCGAGTTTACAATAAAAACGCACGAT TCACATAggaaaaccactttcgttttctccaaccaatcagaatgccAATG TGAGTTATTGTGGAACAACTGCAATGGAACGACTTCAAAATCAATCAGCG GGCCGAGAGGGCACAAAAAAGCCGAcgatcagcgttttgattggtctttg gaaaaaaattatgtcaTGGCGCAACAATTTGTCCGCCGGATTAATTAAAA GTCTGGCTACTTTCTTCTGTCCATGCGGGAATGCGCCCGCTCCCTTGTGG GACCGACCTTTACTCAGTTATGTTGTGGATCATCGTCGATCGAAAACCAA AGGTGACTTTAAAGAGGGTTGTGAATGTGAAAGGTGATTGTAGATACTGG AACTGGaaatatttctggaaaaaaaaaaattatgaacttttattaaaata atgaacttttttgagtgGCAGCTCGAGGGCATGCGGGCGGTCGACGGTAA ACCCGTTCATTAATTCCCCTCGCCTTAGCGCCCCGCCGAAATTCATATCA AAgactgactctcaagcaaaaaaaatgtgccgcaaaacttctagaaaggg aatcatgaaaaaataacctggcgctttttaatgaaattaacattctcaaa aactatgagaaattacctaaaatttgagccatagatgaaaaaatttgtac caagccaaccttgagaactaatttgaagatcaaattcccaagaaaaagat taaCGGCAacgggagacggaacccacctagatccgcgcactgcagAATAG GCTATTTTccggaaattttgccagacctcaaacactgacccatttacatg tgcgaaattgtttttaatttagcgtcataaacaaggccttaaaaatcgaa gtgcTATCTCAGGaataggctgcacgcatcccctctgatatgatttgata taggggatgcgtattgtctaaaatatttctgtcccaacttacccccgtct tttcttgtttcttttttgattatgcgtcatagcaatacaatgacttcttt ttttctttgttcaatgaatgaaaattgataattatgaaaacaacagcaca atgacttcctttttttctttctttgatttgatgtgacgaaattatgtaaa ttttttagcttcaaatttcctagtgtgactaactgtcctTGTTGTtacaa atacatcctgtaggtgactgatgttgttttttctgaaagcttgatttcct agtgtgactaactgacttcTTCTGTTATTCATATATCACAAAAATAGATA TGTCTAAAAAAGCTGCATCCGACAAAATTAATTAACCATTAGCGTCGTCT TTTAATGTCTTGTTCAAGGGGCTTTTATCTAACAGGCTGTGCGATGAGAT GAATATATGTCAGCAAGAGCCTGTTTTCTTAGTTGATGTAAGCAAACTTG AATCGCTCAATAAAATTTAGCGCATAGAAAATACAAGAGAGAAATTTTCA ATACGCTGTTCATTATctgaaatcaaatgactttggaggttcggtaaaat ggtggctgaattgccatcccatgttttgtcagataatagtcccaagttag agtagTTGACGGTAGCTTATTTTCTTGCTAGACTCACTCGATCTAAAGAT CTATaaagtttcacttttttacaGGTTTGAATTAAAGGCAACCCTGCTGA GACACCAGACTGCCCAGTGTTTTGTCCGGTGCCTTAAAGTATCATTAAAT TCATTATTAACTCATTTGCTGAGTAGGTGGTGACTGGGgaacaatcccac aatcctgAGATTGTAAGGCAAATGTGCTACCCACCTGAGCTACCCAGCCA TTTAAATAAACCCAGCTACAAACAATTATACAAAAAGaacatattgaaaa ttttatacaACACAAAAGCAGAATGTTTTGTGTAGACAACTATGCaatta gtagggggccaagcctggggtttTGCAACATCTTTTTTTACGACCTAACC ATTTTTATTCTATTCCAAAgtacagtatattacaagatatttttgagagg gaggacgggGATTAGGCCcaggaaaactttttgtgaccaaaatagtgacg tctTAGGCAAAACTGCTGTTGTGCACGGAAATAAACTGACAAAGTTTGGA ACTTCGATTGAAGTGAATAATACgattgttcaaactgaaaattaactgac aaaatattaaacgaaaaatataaattttcaaatattaacaaaatatgAAT TTGGTTTTCTCCTCTCTTTGACCAACCATAAGAAAACAAGGGTATAGCCA GGTATATATagcttttttaatgtttacaatCCCTACACAAAAAAGGATAG AAAAAATCCCAAGCATAGAATATCTCCTAAATTTAAGGGATCTAGCctgg aaataaacaaaaaagcttCTAAATGGACCAAATAAATGCGCTGAAAAGGA aagggaaaaatgaaaaaatccaaaaGATACTACCCTGAAATATATACACT AGGAAATATTACCAACAATGTAATGACCAATATGTATATGTCCCAAAAAT GGGACTAAAGGTTCAAGGGACTGATAAATGGAAAGACTGTATGTCATGAA ATGTCATGaaataatgttttgttttaaataagtTTTCTACAGttaatttt ggtttttgttcTATTAGGCAaacccaaaaaatatttttgtttctggTCCA CTGGCtgggtgaaaattttttttttcacacattCTCTTGCAAAGGGCAGA AAGGAATTGAGGAGAGGACCCTTTTGAAAGAAGTCTTCCAAAACCTGTTG AATCGTTTTTCGTTTTTGTATATAGATGTCTGTACCTTTAAGTTTATGTT ATTGAAAAAGGTGAACCTTTGTTTGAAAGACATTGCTGATTACGGTTTCC TTACATAAGTTAAACTAGTACTGGTATCAAATTACTgcaattttaattca aaaagaCCATTTTTTAAACTTCTATGAGTACTTCAAAAAATTGTGTAAAT GAGTTTTGCtattgaaattcagaaaataaattttgcgaCAGGCCAAGAGA GTTTTTCCTTTGTCACCTGGTGGACCGCAAACGAAAATGTTTTTCAGATT TGCCTAACAAAAAATGTCTAGgtaatttcctttgtttcattTCTTTTAAA TCCTTTTGTAATCAACTCAACATCGTACATTCTGAGTCAGTTTATAGCCT GACAGCATGGAGTTGAGCATAGTTTGTGGGCCCAATGTACATAGTAGGTG GAAATTTGTTAGATTTTTTTAGGTCCtttgacttttttagtcaaaccACT TGATATACGTATTTTCGGAAAGcaaaggggtaggggaatcaaaataacat gGGTGGGTGCCAATTTTCTTCCGGACACTTTGGTAcgtttttcggacaaa tatgacagtctcaggcaaaaatcatagggtcaaaatttaatgaaaatttt atctTGAGAAAACAGAgatctgttgtatatttttggaaagctctcaaaaa attaagattagagatgtATTgtgagtataggtgatttctgtacctagaTA TtgacgattttttatttttgatcacaTTTTTACTTAATAACGTGTGCTTT TGGGAAAATATAAATCTCAAAATATCATCCCTCTATTAAAAGTTTGTGAT TACTACCATTTGAAAAGTAACGCACACTCTAAGGTGTGAGAAGGGGTCCT CGAGAAACTTGTGTGCCAAAAGGGTCacaaatttgttgtttttttagagA GAGCCTTGATGATAACATTTATCTTCAGAAAGAAAGTCATAGAAGTAATT AGCCTACAGAAATTTATGTTACACTTTTATGTAATTTAGATGATTTTACG GATTCAAACACCTGAAGGGATGAGGCGAATTCAAGTTGGTGGAGCTGATA CTGTTAATACACTATACGAAAaggtaaaatttatattattttgaaatgga tattttttcaatttgctACTCTTGTCCCCTCTCCCTGTCGACTTTATTTA AACTTTCCGATATTAATAGCAGTGAAAGAAAGAAACAGGAGACTTCAGTG TGCTCAAGCGCTAAGCAGTCCAAGCCCCCTGGCGCAAAAGTTTCTGGTGC TACTTCTGCCACTTGGGTAAGCAAAGCACCAGCTAGTAATAGATCAGGGA GCACATTCAATCTTTTGCCCTATTCTGTAGTTGTCAAGGACATTTCTACT CTTCTTCtattctattttttctttttcttacatTCTTTTACTCTTAACCA ACAAAAAAAAGACCGAGCAAACCTCGTCCAATGGAATGTCAAGTGgttct gaaagatttctgaaatCACGTACTAATTCTGACTTGGAGGAGTTTAATAG CTAAATGTGGAGAGGCTCAGTGATATTTGACCAACTCattgtacaatcat ggtcgaaatagaatgagaattccggttattttaacgtttttcaagattta aagttctggcgagaaagtcgattttgggctatctctttaacttaatcgaa tatttcaatttgggaggagttggcagacttccaggctatattctgagtct tattggactatttttgagtttttggatcctgagatcctaaggtcctaagt cttaagtctagtgttaaaactcagagttaaaactctacccttcaaaccta ctttagagcacttacaaatcgattgtggtttcaaaacttcccggtggatt tcccttttttctcaaatattacgtccatgattgtagttagTACCTTAGCA CATCATATAACTCAATTTGAAAACATCTCACCAATCTTTCAGGTCCAATC TTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCT TGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAA CTGAAGTAAGTGAATTCTCTAGCTCTCCCAAGGGAGTAACTACTACATGA TTTGTTGATTCTGTGCAATACCTGTTTTGCTAACAATCATTCCTCCCAAT TAAGGCACTGTGGGTGGAAAAGGTTCGAAGTAGATATTAACAACAATCAA CCCTCTATCTATTACATTTGTTATTAAATAACTTTTGTAAATATGGTTAC AGACAAAGGAAGAAAAGGCAAATGACcataaaagaaaattgtttgttcAT TATGCACAAATAGATCACGTTCCATTTTGTTCTTCTCTTGTCTGTTAATA GTCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAAC AGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACTC GACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTTG TAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAAA CGAGATCGGCATCCTCTTCTGTACGTCCTTTAGCCCTACCTTCCTTTATA TAGCactagtttaggtataaacttatttctttttttatgatttttgttgg cgaaaacaaaaatcataaaaaaagaaataagtttatacctaaactaatAT AGCACCGCCTTTTATCTAAAATCAAGAACGCTGAGTTCTTATCAACATCT CACCAAAAAACGAGGCTTATTATTAGACTTTGATAAGCTTACTGTTAACG TAGCCCTGAATATCTACCAACCACCACAGTGCTAAGGATATATTATCTGT TAGCCCTTTCATTTCCCGTTTGTTTAGTTTTAAGCCACTGCCTCCATCGT TGCATTTTCAACAGAAACAGCTATTTATAGAGAGAGACCTGCAACATACA ATTTTTCCACTCCTTTTTTTTAAGATGCCGGCACGGTAaacaaggacaat gtttaaatTGTGCGCCACTGGAAGTAAGTAACAacattttttacaagttt gCTTTCTTAAGAAGGAAAAAAGAACTCTGATGTACTACTGGACGTAGGGT TGTAGGTTTGATTTCCCAATATTTCACAATGATTATTTcatttctctctc ttttttgaaaatctaacaACCCACTCACGTGCATCATACGTCACAAATTT TGTTGCCATGGTTATATAAGGGAATTTTTAATTGTCTATTATTCGGTATA GAAAAAAGTAAACCACTAtgaattatatatttttggaatcgtGTTAATGA GCTCTTTAAGAATATAATCataagtttcattgaaaatcacACATATTAAT TCCCCTTTAAACAGGTTAATAACATCGCTCAATCAAACCAATATTctatt tttaccctcaaaatgaTAGATGTACCCAATCTTTCTCTTTTCAGCCTTAC AACGAAGACTACCTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCATT TCACGCATACTTGAAGAAAATGAAATCTGGCGTCGCGAAGTAAAATAATC TTctatttcttcattttattcATGCGTGACTTTTTTCATAACTGCCTGCT TGTCATGCGATTTCCAATCAATAATGTTTGTCTAAACATGGTATAGTTAA ACCCGATTGGTATTAATTCATCTAAGGGTGACTACTCAACCTCTTTAATA GTGTATTAGCCTGCTCTTTTAAAGCTTTATTTATCATGGGTGGCCAGGAC GCCATCAGAATATGAGATTATCCATTTTTAAGAAGTTACCTTCGTCCAAC TACAAATATTATTGACTTATATATTTATCTGTATTCGAAAAGTGTCTTAA TGTTCTGTCTTTAGATGGAAACCAGTCACAGAGTCACAAAACTCATAGTA ATGGACCTGTAAACTTTTAACTTTGAACCTGCTGTTAAAAGCATTGAAAT TTTTTGCCGCGCACATGATTAGGATCATGAAATCTAAActtattttactt tcttttatCAGAGGCAAATATATATCGTTAGAAGACGTAAATTGCAAAAT CAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGCACCA AATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGGTTTGATTGGTTCAA AATATACATGCATGCTTTTTTAAACCTTCTTTTTTAACCAAGAATGggac cattccattttatatccatacaggggggtggacgaacctttccagagggt aatctgAGAAAAGTTTTAGTTCGTCCTCCCTCACttaaaggtatgaaaag aatctttccaagggtatttttgctaattttgccTTTTTCCAGGGCGTATC CacatattttcaataatttttttttgaaaaggttcgtccacacCCTCTGT ATATTTAATGAAACAGCCCATTGTTCTACATTACTACATTTCTTAACTTT ATCTACAGACATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTC ATCATGGATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGGTATG CTCATAGTTCTTTGTTGCCATAACcataaaaaaatcagcaaatcttGATT GAAAACATCTTGACTCAAACACTCACCATTCTTTCAAATACACCCTTACT GATTAAGATAgttaaaaagatttctttcatcTCCAGTTGAATGATAAAAC CCTGTTCTGGTCCtaaaatttatatatttaaCTTCAAAGCGTTCTGAATT AATGTGCAGGTGTAGACATATCATATAATCTTagaaagaaaacattcgaa attgtCAAACAATCAACTGACGAAACGTACGCTGTTTGGTTTTGATGATT CGATTTGAAAGTTGCAAATGTTCTGGCAAGATCAGTGTTCTCATCATAGC CATTCAGATCTCACTTTTTAAAAACtctcaaatcaaatttttattctgTT TCAGAGGATAGGTATATTATATGGTAAATATGAGAAACACGAGAACGTTC CTTTGGGCATCCGAGCGACAGTAGCTGCCATTTATGAACCTCCTCAAGAC AGTAATAAAGATCGTATTCAACTCCTCCCCAACCCACAACAAGAGAGTGT TGATATACTGGCATCTTACTTTGGTCTCAAACAGGTGAATAGAGAATTAT TTAAGGTCTTCGATTATTTTTTGGTCCAATTGTATTATTTACACGTTTAA CCCTTTGCTGTGCGCTCAGCCTCTAAGGAGACTGGTaacgaaaatacaag aaaaattctGTTCAACGGCGGTATCAATTACCCAATGTAGGAGTGCTTGT GAAAAATGTAAGATACTCTTGCATTGAGGTGTTAAATTAACGTCGAATTG ACACCCTTAATGGAGGGTTTTGAAAAGAATAAGGCCCTACcttttaattc aaaaggggcctaagtccattttagtcattttgagaaaatcgcaattaaag tttttccttgattctgaaaccatttttaatggtaaagctttgaagtaaat gttttctgaaagccaTAGCTATAAGTTGATTTTCTAATGAAAAGGCATTC GTTTGGAAAGTAGATATTTTTGTACGTAACAGGTGCAACTTAGTAAATCT TGCagaatggacttaggccttttttgaattaaagatgaattttgaaaaat gtgtgaGGGTTAATTTCTGCCTTTTAAAGTTCAAAACCTGCACATATGAC ATTCCAAAATAAAGCCACTTACACCTAGATTCaagataaagaaaaaagac aatcttagtaaaataaagaaaaacccaattaaactttttaggaagcatgg acttaggcccattTGCAATTCAATTGGACTTAAGCCTCTTCAAAACTTAA CAAACTTATTTTtgtggacttaggcccttttaTTGTAAAAAGATGATGGG CTTAGGCCTCTTTTGATTTAAACATCACTTTTATCAGAGCTTCAGTACGA AACTTTCAgcctttttaactttaaaaactaCTTGTTATGTACATCAAAAG AAAGCAAACGAGccagagattgagaaaaaccaaagatctcaaatttcata aaaatggacttaggccccttttgaactgGGGGGTActtggacttaggccc cttttgaattaaggtagcgaaGGGTTCCTGTTTGATCTGATTTTATTTTC CAACTGAAAGAAAACTTGCTCTCTCTTCACTTACCACTAGGTTGGATGGA TAGTTACCGACCTAATACCGGACACCGAGAAAGCCGGACTGGTCAAACAC TTACGTCACGCCAAAACACATTTCCTGAGCGCACAGGAATGCATGATGGC GGCCGACTATCAAAACAAACATCCCAATCCTTCCAAGGAGTCCAAAACGG GCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGTGTCAGGTAAACCTCAT TTCTCAATGATAAACTCAAaccaaaaaattcaacttttgatttcttCACG AGCTTCAAAAATGGTAGAATTTCAAGGCGTGCGCCAtattttaagagcca ttttttgtAAGGGCCATCAGGTTTTGAAACATGAAGTCtcagattttctt gaaatttcaacCAGAGCTTCATATTCGGATCTTGGGATCTTTCAACTTTG CCTTTGATGCTAGTCGGGTCAGGGGGGgttgaaaagatttttaaaatcga TATCGAATCGAATTTCACTCTGCACTATGCGATAACTAATACTTAGAGCT GAGAAAGGGCATCTGAAAACCCTATTTTGAAAagaataaatatttgaaaa agttggttttgaatctttcataaattttgaaaaaagcaagTTATTTGGAT ATTCCAATCAATAATTATAAGTGCTTGAAGTTAGACTCTCATTTAATTAC CAGGTCTAAAATGGCTAAATAATTTGAAACTTTAACAAGCCGTATCTCAA GAACCGCTTCGAATTAGATGATGAAATTGTGTCTCACAAGATCTggttaa aatttcaagaaaatctgaGACTTCATGTATTTTAATAATCTGATATATAC AGGACGNaaaaaattcaacttttgatttcttCACGAGCTTCAAAAATGGT AGAATTTCAAGGCGTGCGTCAGGACAGGTACGAGCTGTGAGGCCTCAAAA GATTTACAGTgtgaaattcgaatttagcgctgttctcacttactaaaata aaaaccaaatttcggaacttgcgttttctctaagaaagtgtgaccactga aagaaaaacagaattgtgttttcaaccgtcattaggatctgggaaattca aattcTCAGCTGtaaccatgctatatatttcgccatcagtatataaaata agaaatcatagcatggatctccaggctagtctcaaaattgatttttccta aaggtttttataaaaaatgactCTTAATGTTAGTCTTACTCAGGACGGGC TAGATTTATTGTTTGGCTACgattctttttgtttgttttaccaGGTGACG AAGAGCAACACATTCATTACGAAGGATGGCAGGTATGTAGTTGTTACAAA GCCGCCAAGGGATCGGCTGGTGATCACAAATATCATATTCCTTCACACAC TCGATAGGATAACTGCTCACAGATTTCCCGTGAAAGTGTCTCCAGTTTTG GGGTCGGCCAGACCGCCATGTTGTTTTCTGTTTTACACTAGAttatcgaa cgttcgaatttcaaaacatccGAATCTCGCTGTTGACGACCAGATTAGAC TAAAATATTACAGACTAATTATCTTAGCTAAACAGCTGGACATCCTTTTA CGTGGGAAGCCCGATCCAGTCAGTAGTTAGAGACCAGTGGTGGCGACGAT CCATTGGTGCGCTatgaattagtatatgtaatcacatgataacgagtgca attcgagaataattgcacgagtgattttttgttattaattttccgaggaa aattcgaaacaaaaaaatcaccagtgcaattttcgaattgtacgagttat tatgtgattacaaGCTAATCGCACAATTGGTGTCACTGCTTTTTCCCCGT CAGGAAGAAAAATATACTGaactgttttatatttttctcttctctttatt ttttttctttcattgttgcttacagattttctttctcacaaaataaattt cgaatgcaattaaaccGTTCGATaataaaaatgtaagaaaaaacattaaa atttattttgtaaacattggcccGTCgatgaagagtgtgattaacgatta attgctctctttgaaagggaaccaaatgaaaaaaataactcatcgtgcga ttacaTTCGTAATTCTAGTAAACCGGCGAACTGAATCCTTCTTTGGGTTT GTTGATGTAGtataattaaaactttcaaatctGTGCCCGGTCTCAATTCT TATGGTAATACAATAATAGTAAAATAATAGTTTTAAAAACTTCCTTCGTC CTATCTCTAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTC TTGTTCCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCC AGTGAACAGTTTGTACCTGATGTTTTCTATAAAGTAAGTATATTTGGTTG AGACGCTCAATCCATGTCTGCCGAATGTATAATCAGCTGTTTTCTTGCAG CAAAGATTTGACATTCATTCAGACCTGAGCATTAAAATTGATAACAGTTT TATGAATATATATTTAAGTTATATTCGAAGCATACTCAATTTGAAGCGAT GCTCATATTAGTTGAGCCAAACTTCAGATGTTCCTATGTTTTTTTTTGAA AAATCAATTTCGATTTAGCAAAACATTGAAGCAGTTTCATTTTTACGCAG GTCAAAGATGAATACGGAAATGAAGTGACGAAGATTGGTCGACCCATGCC CATCGAATACTTTCTCATCGAGGTACTGTTTTTTCAATCAGACTTACCAT ATATAGTCCTTGGATGGTCTTTAAACGTTTTTCATGTTTTGTCAAGTTAC GTAACTTCTTCCATCATGCATCAAACAGCgtgaaattacgtaacttaata AAACACAATAGATCAGAACTAAAATGCTCACCGTAAATGATTTGAGAATT AATACAGTATATAAAGAAATCTGTCATTGAATGTTTATAAGTACTTAAAT GTGGAATTTGAATGTTTGAAGTTTTCTACTCAATTTGCAGACCTNATGTG TGCCGAATGTATAATCAGCTGTTTTCTTGCAGCAAAGATTTGACATTCAT TCAGACCTGAGCATTAAAATTGATAACAGTTTTATGAATATATATTTAAG TTATATTCGAAGCATATTCAATTTGAAGCGATGCTCATATTAGTTTTCTG AAAGTTTTCACCCAAAACTCTCGAGCCAAACTTCAGACGttcctatgttt ttttttgaaaaatcaatttcgaTTTGGCAAAACATTGAAGCAGTTTCATT TTTACGCAGGTGAAAGATGAATACGGAAATGAAGTGACGAAAATTGGTCG ACCCATGCCCATCGAATACTTTCTCATCGAGGTACTGTTTTTTTCAATCA GACTTACCATATATAGTCCTCGGATGGtctttaaagattttcatgttttg ttaagttactcttaggttccaaataaacgcccccccccccNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAGGCAGAATC CTATTCTGCCGAGGCAAACAGCAAATTTAGCCATTTGCCTCGGCAAAAAA ATGCcgaggcaaaaaaaattgaattgccAGGGCTGATTTGCCATCGTTAT AGTTAAATCACCCTCCGTATTTGTCTTCAAAGATTGTCCTACTTATATTC CCCTTATATTCCTTTACAGAAAAAGGATATCTGAATAAGCttctaatttt ttgttaaatttattACTAGGTACCAGCAGGCTTCCCAATGGAACCTCAAT CCACTTTCATTTCAAGCGACCCAACAAATTTATTTCCCATCGAAAACAGA ACGCAAATGATGGAAAACCAGGTAGAATGGAAAGAAAATTCTTCGGTTGG CAATATTTGAAGGCATATAATAACCCTTCTCTCCCCTTTTatgtttttcg aatattttgcTGGCATTGTTGCATTATTGATAATCCCGTGAAATAGATTG TTGATGAAATTCGCTTTATAGTGGAGTCTTCAAatctcgaacacgcacgg ggaatgcaaatttgttcaagttaaggaaatttcgagttatggaatttATA ATGCATGGttacaaaataatataaaacttgaaaaaatttcttgctgggcc agataaatttgataacaagtatagtaaaaaaaaattcaaaacgaatttca atttacaacattcaaaaaaaatcacaaaatttaaaaattactACCAGGTA ATTACAAGTTGTTAAATAATGTTAAATAACGTCaaataatgaataaaata aaatttttagttttcactttttttatcaaatataaaacttgttcgagata aggagacattcgatttatagaagttcgagttaaagagacttcaCTGTAGT TTAACTTTGACTTCTTTTTAGAACTTCGAGACATTAACGCAACATTTGAA TCGTTTGAAATCAAGTGACGTGAATCTGTTGGAACATTTCTTAGATTTCC ATTTTCTTCTCTTCATCATGACCAATGAATTCATATCCATAAGGGTGAGT TTACACTTTGTATTCCCTTGAATGAATTCCAGGGCAGTTTTTATTGTTAA CTTCTCTTAGCTTTGcgataagtaatagttatcggcaGTTGCAAGTACAA TATGAGGAATATTTTACGAATtgcgagatttttccgtactcGCCTAAAGG CTTGggaaatatacggaaaatccagaacgagtgaaatatttccatattgt acgagcaaatatctgataactggtttatcggtgacccaaaaaatgcactt tttttgttggaaaaagtACAGGGCACTTTGGTGTAGctaagtgacgttag attgctgctaccgctgTATATGTAAAGTACAATATATATTGTActgtttt taaccaatcagattgcagacaTTTTTTGGATTGCCGATAAAAATACAGAC CCAAAGTAATTTATGCTCATCTGGTTCTCTGAATGATACAATACTTGCTG AAAAGGACATAAGATTAGTAAACTAGTAGGTTTGGGGAGGAGTCTACGTC GCTTACGGGAGGGGGTAGATGTTTCTAGTTGAGTTCAGTGAATTTTGAGG TCAACAGGATTGATTCTTTAAGTAAGTTGCTTTTCATAATGGCTTTCTAC CTTCAATTGTAGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAAG AGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACCG TTGAAACTATGGTACAAACTCACGGTAAGGTCTACAAGAGTTGACTTCTC AACCTCAGTTGATCTAGAATCTGaaaatgtctgtctgtctgtctgtctgt gtatCCGCCAAAAGAATTAGGGGCAtcctgaaatttggtacactcGTTCT TTGGTTGAACATCTgggagtatttttttcaattttctaaaacTGTAATTT TCTAAAGGCTTGGGTACTAATCTTTTGGTTTATTttgcctatgaataatt tgaagctactgaagttgagcccagtacGTTGCGCATGTTCGGCTTTTTAT TTTGGATAGTCCAAATGAAAGTTTCCATCAAATTTACATTTTGACGCAGT GCACTCTACTTTGATGGGATTCATTTGCGCGGGGATTACTTTTCGCGGAT TTCctaatggaattttgaaaaggTCTTATCTGcgaaatttttttgtaatt aaattccaaaaaaatgttaaaagaacACTCTTTTCATTTTCCACTTTTGT TTCCCTTTCAGCACCCATGGCAACGGACAGCCCGATGGACGGAAGTGATG CTGTTCCCATGGAAACAGACAATAGTGTGACTATTACTGGTTGGACGTGT CCGCATTGCACTTTTATCAACAAAAATCCAACTTCAGACACATGTGATAT GTGCACACTACCAAAAAGTTAATTACTTTGAATTAGACTTTgtggtatat tttttacaatctGACTTCTCTTCAATATCGCTGCTCtttagatttttaaa agaataaaaatttaaCTGAGATTTTGGACTTTGTTTTCTTCCGAAACTTT GCAATCTTTTATACATCGGTGGGTCTTTGGCAGAAAATTTCATCCCAACT CAAGAAATGGGAGTTTGTTTTTAAGAGTCAACTACAATTCTAACAGCTTT GCGATAATTTTGCTGCACTTgatttttgttggtttgttggCCTGCGTTTT GTTAGCAAGTAAGAATTAGTGTGTTTTCAATTGttcaatttttgttgatt tttcgtAAAATAGTAGGACcaatatcaataattttttataagaactttaa atatttattaagttttattttgaaaatatcaaaaaagatTCTCAACATTT TTGGACGATTCTACTTAATCTTCAGTTCAAGATATGTTCTGT

Coding sequence (CDS) from alignment at scaffold_9:112670..134111+

>TCONS_00073303 ID=TCONS_00073303|Name=TCONS_00073303|organism=Clytia hemisphaerica|type=CDS|length=32283bp|location=Sequence derived from alignment at scaffold_9:112670..134111+ (Clytia hemisphaerica)
ATGGCTACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGAT
GAGGCGAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAA
agGTCCAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAA
GACAGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAA
AGGCCTTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCC
ATTTTGTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGT
CAAAGCACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTC
AAAACTGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAAT
CAGGTCTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaa
caaggacaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTA
CCTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACT
TGAAGAAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAA
GACGTAAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCC
TAAAGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGAC
AGACATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATG
GATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTAT
ATTATATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAG
CGACAGTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGT
ATTCAACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATC
TTACTTTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGG
ACACCGAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACAT
TTCCTGAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACA
TCCCAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCG
TCACTGTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGA
TGGCAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGT
TCCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTG
AACAGTTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAAT
GAAGTGACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGA
GGTACCAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCG
ACCCAACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAAC
CAGAACTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGA
CGTGAATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCA
TGACCAATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAA
GCATTAAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGA
CGAATGGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAA
CGGACAGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAAT
AGTGTGACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAA
AAATCCAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAA
TGGCTACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATG
AGGCGAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAa
gGTCCAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAG
ACAGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAA
GGCCTTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCA
TTTTGTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTC
AAAGCACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCA
AAACTGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATC
AGGTCTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaac
aaggacaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTAC
CTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTT
GAAGAAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAG
ACGTAAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCT
AAAGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACA
GACATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGG
ATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATA
TTATATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGC
GACAGTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTA
TTCAACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCT
TACTTTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGA
CACCGAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATT
TCCTGAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACAT
CCCAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGT
CACTGTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGAT
GGCAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTT
CCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGA
ACAGTTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATG
AAGTGACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAG
GTACCAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGA
CCCAACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACC
AGAACTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGAC
GTGAATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCAT
GACCAATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAG
CATTAAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGAC
GAATGGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAAC
GGACAGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATA
GTGTGACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAA
AATCCAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAAT
GGCTACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGA
GGCGAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAag
GTCCAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGA
CAGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAG
GCCTTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCAT
TTTGTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCA
AAGCACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAA
AACTGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCA
GGTCTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaaca
aggacaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACC
TCAAAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTG
AAGAAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGA
CGTAAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTA
AAGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAG
ACATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGA
TCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATAT
TATATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCG
ACAGTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTAT
TCAACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTT
ACTTTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGAC
ACCGAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTT
CCTGAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATC
CCAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTC
ACTGTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATG
GCAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTC
CCACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAA
CAGTTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGA
AGTGACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGG
TACCAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGAC
CCAACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCA
GAACTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACG
TGAATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATG
ACCAATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGC
ATTAAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACG
AATGGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACG
GACAGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAG
TGTGACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAA
ATCCAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATG
GCTACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAG
GCGAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagG
TCCAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGAC
AGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGG
CCTTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATT
TTGTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAA
AGCACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAA
ACTGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAG
GTCTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaa
ggacaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCT
CAAAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGA
AGAAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGAC
GTAAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAA
AGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGA
CATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGAT
CGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATT
ATATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGA
CAGTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATT
CAACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTA
CTTTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACA
CCGAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTC
CTGAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCC
CAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCA
CTGTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGG
CAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCC
CACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAAC
AGTTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAA
GTGACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGT
ACCAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACC
CAACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAG
AACTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGT
GAATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGA
CCAATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCA
TTAAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGA
ATGGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGG
ACAGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGT
GTGACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAA
TCCAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGG
CTACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGG
CGAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGT
CCAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACA
GAGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGC
CTTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTT
TGTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAA
GCACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAA
CTGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGG
TCTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaag
gacaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTC
AAAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAA
GAAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACG
TAAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAA
GGAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGAC
ATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATC
GATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTA
TATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGAC
AGTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTC
AACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTAC
TTTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACAC
CGAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCC
TGAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCC
AATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCAC
TGTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGC
AGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCC
ACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACA
GTTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAG
TGACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTA
CCAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCC
AACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGA
ACTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTG
AATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGAC
CAATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCAT
TAAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAA
TGGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGA
CAGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTG
TGACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAAT
CCAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGC
TACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGC
GAATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTC
CAATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAG
AGGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCC
TTCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTT
GTATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAG
CACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAAC
TGGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGT
CTCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaagg
acaatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCA
AAAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAG
AAAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGT
AAATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAG
GAATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACA
TACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCG
ATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTAT
ATGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACA
GTAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCA
ACTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACT
TTGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACC
GAGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCT
GAGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCA
ATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACT
GTCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCA
GGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCA
CGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAG
TTTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGT
GACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTAC
CAGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCA
ACAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAA
CTTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGA
ATCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACC
AATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATT
AAAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAAT
GGAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGAC
AGCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGT
GACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATC
CAACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCT
ACAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCG
AATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCC
AATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGA
GGCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCT
TCAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTG
TATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGC
ACTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACT
GGATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTC
TCATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaagga
caatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAA
AAGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGA
AAATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTA
AATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGG
AATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACAT
ACAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGA
TTTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATA
TGGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAG
TAGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAA
CTCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTT
TGGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCG
AGAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTG
AGCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAA
TCCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTG
TCGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAG
GTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCAC
GGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGT
TTGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTG
ACGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACC
AGCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAA
CAAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAAC
TTCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAA
TCTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCA
ATGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTA
AAACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATG
GAAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACA
GCCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTG
ACTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCC
AACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTA
CAAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGA
ATTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCA
ATCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAG
GCTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTT
CAACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGT
ATCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCA
CTGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTG
GATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCT
CATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggac
aatgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAA
AGTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAA
AATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAA
ATTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGA
ATTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATA
CAGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGAT
TTTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATAT
GGTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGT
AGCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAAC
TCCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTT
GGTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGA
GAAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGA
GCGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAAT
CCTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGT
CGTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGG
TATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACG
GTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTT
TGTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGA
CGAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCA
GCAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAAC
AAATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACT
TCGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAAT
CTGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAA
TGAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAA
AACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGG
AAAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAG
CCCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGA
CTATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCA
ACTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTAC
AAAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAA
TTCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAA
TCTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGG
CTTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTC
AACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTA
TCCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCAC
TGACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGG
ATGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTC
ATCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggaca
atgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAA
GTTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAA
ATGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAA
TTGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAA
TTTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATAC
AGACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATT
TTTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATG
GTAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTA
GCTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACT
CCTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTG
GTCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAG
AAAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAG
CGCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATC
CTTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTC
GTAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGT
ATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGG
TCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTT
GTACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGAC
GAAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAG
CAGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACA
AATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTT
CGAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATC
TGTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAAT
GAATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAA
ACAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGA
AAACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGC
CCGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGAC
TATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAA
CTTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACA
AAAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAAT
TCAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAAT
CTTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGC
TTGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCA
ACTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTAT
CCAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACT
GACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGA
TGTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCA
TCAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaa
tgtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAG
TTTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAA
TGAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAAT
TGCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAAT
TTGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACA
GACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTT
TTGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGG
TAAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAG
CTGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTC
CTCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGG
TCTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGA
AAGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGC
GCACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCC
TTCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCG
TAGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTA
TCGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGT
CGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTG
TACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACG
AAGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGC
AGGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAA
ATTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTC
GAGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCT
GTTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATG
AATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAA
CAAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAA
AACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCC
CGATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACT
ATTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAAC
TTCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAA
AAAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATT
CAAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATC
TTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCT
TGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAA
CTGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATC
CAACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTG
ACTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGAT
GTTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCAT
CAAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaat
gtttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGT
TTGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAAT
GAAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATT
GCAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATT
TGCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAG
ACATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTT
TGAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGT
AAATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGC
TGCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCC
TCCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGT
CTCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAA
AGCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCG
CACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCT
TCCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGT
AGTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTAT
CGAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTC
GACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGT
ACCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGA
AGATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCA
GGCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAA
TTTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCG
AGACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTG
TTGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGA
ATTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAAC
AAAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAA
ACCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCC
GATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTA
TTACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACT
TCAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAA
AAGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTC
AAGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCT
TTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTT
GAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAAC
TGAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCC
AACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGA
CTCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATG
TTGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATC
AAACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatg
tttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTT
TGAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATG
AAATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTG
CAAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTT
GCACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGA
CATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTT
GAATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTA
AATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCT
GCCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCT
CCCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTC
TCAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAA
GCCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGC
ACAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTT
CCAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTA
GTGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATC
GAACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCG
ACGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTA
CCTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAA
GATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAG
GCTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAAT
TTATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGA
GACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGT
TGGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAA
TTCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACA
AAGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAA
CCGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCG
ATGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTAT
TACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTT
CAGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAAA
AGAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTCA
AGTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCTT
TTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTTG
AACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAACT
GAATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCA
ACAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGAC
TCGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGT
TGTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCA
AACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatgt
ttaaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTTT
GAAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATGA
AATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTGC
AAAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTG
CACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGAC
ATGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTTG
AATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTAA
ATATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCTG
CCATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCTC
CCCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTCT
CAAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAAG
CCGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGCA
CAGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTTC
CAAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTAG
TGTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATCG
AACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCGA
CGATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTAC
CTGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAAG
ATTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAGG
CTTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAATT
TATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGAG
ACATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGTT
GGAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAAT
TCATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAA
AGAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAAC
CGTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCGA
TGGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTATT
ACTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTTC
AGACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAAAA
GAAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTCAA
GTTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCTTT
TCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTTGA
ACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAACTG
AATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAA
CAGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACT
CGACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTT
GTAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAA
ACGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatgtt
taaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTTTG
AAACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATGAA
ATCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTGCA
AAATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGC
ACCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGACA
TGTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTTGA
ATTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTAAA
TATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCTGC
CATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCTCC
CCAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTCTC
AAACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAAGC
CGGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGCAC
AGGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTTCC
AAGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGT
GTCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATCGA
ACCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCGAC
GATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTACC
TGATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAAGA
TTGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAGGC
TTCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAATTT
ATTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGAGA
CATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGTTG
GAACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAATT
CATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAA
GAGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACC
GTTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCGAT
GGACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTATTA
CTGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTTCA
GACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAAAAG
AAATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTCAAG
TTGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCTTTT
CTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTTGAA
CGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAACTGA
ATCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAAC
AGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACTC
GACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTTG
TAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAAA
CGAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatgttt
aaatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTTTGA
AACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATGAAA
TCTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTGCAA
AATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGCA
CCAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGACAT
GTGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTTGAA
TTACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTAAAT
ATGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCTGCC
ATTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCTCCC
CAACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTCTCA
AACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAAGCC
GGACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGCACA
GGAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTTCCA
AGGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGTG
TCAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATCGAA
CCAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCGACG
ATTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTACCT
GATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAAGAT
TGGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAGGCT
TCCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAATTTA
TTTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGAGAC
ATTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGTTGG
AACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAATTC
ATATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAAG
AGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACCG
TTGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCGATG
GACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTATTAC
TGGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTTCAG
ACACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAAAAGA
AATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTCAAGT
TGGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCTTTTC
TAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTTGAAC
GACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAACTGAA
TCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAACA
GTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACTCG
ACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTTGT
AGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAAAC
GAGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatgttta
aatTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTTTGAA
ACCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATGAAAT
CTGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTGCAAA
ATCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGCAC
CAAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGACATG
TGGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTTGAAT
TACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTAAATA
TGAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCTGCCA
TTTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCTCCCC
AACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTCTCAA
ACAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAAGCCG
GACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGCACAG
GAATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTTCCAA
GGAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGTGT
CAGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATCGAAC
CAATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCGACGA
TTCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTACCTG
ATGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAAGATT
GGTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAGGCTT
CCCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAATTTAT
TTCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGAGACA
TTAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGTTGGA
ACATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAATTCA
TATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAAGA
GATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACCGT
TGAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCGATGG
ACGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTATTACT
GGTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTTCAGA
CACATGTGATATGTGCACACTACCAAAAAGTTAAATGGCTACAAAAAGAA
ATATGATTTTACGGATTCAAACACCTGAAGGGATGAGGCGAATTCAAGTT
GGTGGAGCTGATACTGTTAATACACTATACGAAAagGTCCAATCTTTTCT
AAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCTTGAACG
ACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAACTGAAT
CATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAACAG
TCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACTCGA
CAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTTGTA
GAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAAACG
AGATCGGCATCCTCTTCTATGCCGGCACGGTAaacaaggacaatgtttaa
atTGTGCGCCACTGGAACCTTACAACGAAGACTACCTCAAAAGTTTGAAA
CCACCTGCAAAACATCTCTCATTTCACGCATACTTGAAGAAAATGAAATC
TGGCGTCGCGAAAGGCAAATATATATCGTTAGAAGACGTAAATTGCAAAA
TCAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGCACC
AAATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGACATACAGACATGT
GGACAATATCATGTTCGAAAATCCTGTCATCATGGATCGATTTTTGAATT
ACTGGCGAAAGACAGGAGGGCAGAGGATAGGTATATTATATGGTAAATAT
GAGAAACACGAGAACGTTCCTTTGGGCATCCGAGCGACAGTAGCTGCCAT
TTATGAACCTCCTCAAGACAGTAATAAAGATCGTATTCAACTCCTCCCCA
ACCCACAACAAGAGAGTGTTGATATACTGGCATCTTACTTTGGTCTCAAA
CAGGTTGGATGGATAGTTACCGACCTAATACCGGACACCGAGAAAGCCGG
ACTGGTCAAACACTTACGTCACGCCAAAACACATTTCCTGAGCGCACAGG
AATGCATGATGGCGGCCGACTATCAAAACAAACATCCCAATCCTTCCAAG
GAGTCCAAAACGGGCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGTGTC
AGGTGACGAAGAGCAACACATTCATTACGAAGGATGGCAGGTATCGAACC
AATGCATGGCGTTAGTACGTGACCAATGTCTTGTTCCCACGGTCGACGAT
TCAGCCCTGGGTTATATCAAAGAGTCATCCAGTGAACAGTTTGTACCTGA
TGTTTTCTATAAAGTCAAAGATGAATACGGAAATGAAGTGACGAAGATTG
GTCGACCCATGCCCATCGAATACTTTCTCATCGAGGTACCAGCAGGCTTC
CCAATGGAACCTCAATCCACTTTCATTTCAAGCGACCCAACAAATTTATT
TCCCATCGAAAACAGAACGCAAATGATGGAAAACCAGAACTTCGAGACAT
TAACGCAACATTTGAATCGTTTGAAATCAAGTGACGTGAATCTGTTGGAA
CATTTCTTAGATTTCCATTTTCTTCTCTTCATCATGACCAATGAATTCAT
ATCCATAAGGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAAGAG
ATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACCGTT
GAAACTATGGTACAAACTCACGCACCCATGGCAACGGACAGCCCGATGGA
CGGAAGTGATGCTGTTCCCATGGAAACAGACAATAGTGTGACTATTACTG
GTTGGACGTGTCCGCATTGCACTTTTATCAACAAAAATCCAACTTCAGAC
ACATGTGATATGTGCACACTACCAAAAAGTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045473XLOC_045473Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073303-exon-scaffold_9-1491911889:112670..112899TCONS_00073303-exon-scaffold_9-1491911889:112670..112899Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:112670..112899TCONS_00073303-exon-scaffold_9-1510915933:112670..112899Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:112670..112899TCONS_00073303-exon-scaffold_9-1575043694:112670..112899Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:120659..120742TCONS_00073303-exon-scaffold_9-1491911889:120659..120742Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:120659..120742TCONS_00073303-exon-scaffold_9-1510915933:120659..120742Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:120659..120742TCONS_00073303-exon-scaffold_9-1575043694:120659..120742Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:121612..121724TCONS_00073303-exon-scaffold_9-1491911889:121612..121724Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:121612..121724TCONS_00073303-exon-scaffold_9-1510915933:121612..121724Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:121612..121724TCONS_00073303-exon-scaffold_9-1575043694:121612..121724Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:122021..122239TCONS_00073303-exon-scaffold_9-1491911889:122021..122239Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:122021..122239TCONS_00073303-exon-scaffold_9-1510915933:122021..122239Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:122021..122239TCONS_00073303-exon-scaffold_9-1575043694:122021..122239Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:122644..122692TCONS_00073303-exon-scaffold_9-1491911889:122644..122692Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:122644..122692TCONS_00073303-exon-scaffold_9-1510915933:122644..122692Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:122644..122692TCONS_00073303-exon-scaffold_9-1575043694:122644..122692Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:123114..123208TCONS_00073303-exon-scaffold_9-1491911889:123114..123208Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:123114..123208TCONS_00073303-exon-scaffold_9-1510915933:123114..123208Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:123114..123208TCONS_00073303-exon-scaffold_9-1575043694:123114..123208Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:123681..123804TCONS_00073303-exon-scaffold_9-1491911889:123681..123804Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:123681..123804TCONS_00073303-exon-scaffold_9-1510915933:123681..123804Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:123681..123804TCONS_00073303-exon-scaffold_9-1575043694:123681..123804Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:124128..124214TCONS_00073303-exon-scaffold_9-1491911889:124128..124214Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:124128..124214TCONS_00073303-exon-scaffold_9-1510915933:124128..124214Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:124128..124214TCONS_00073303-exon-scaffold_9-1575043694:124128..124214Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:124624..124803TCONS_00073303-exon-scaffold_9-1491911889:124624..124803Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:124624..124803TCONS_00073303-exon-scaffold_9-1510915933:124624..124803Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:124624..124803TCONS_00073303-exon-scaffold_9-1575043694:124624..124803Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:125860..126058TCONS_00073303-exon-scaffold_9-1491911889:125860..126058Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:125860..126058TCONS_00073303-exon-scaffold_9-1510915933:125860..126058Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:125860..126058TCONS_00073303-exon-scaffold_9-1575043694:125860..126058Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:127114..127151TCONS_00073303-exon-scaffold_9-1491911889:127114..127151Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:127114..127151TCONS_00073303-exon-scaffold_9-1510915933:127114..127151Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:127114..127151TCONS_00073303-exon-scaffold_9-1575043694:127114..127151Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:128080..128202TCONS_00073303-exon-scaffold_9-1491911889:128080..128202Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:128080..128202TCONS_00073303-exon-scaffold_9-1510915933:128080..128202Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:128080..128202TCONS_00073303-exon-scaffold_9-1575043694:128080..128202Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:128470..128541TCONS_00073303-exon-scaffold_9-1491911889:128470..128541Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:128470..128541TCONS_00073303-exon-scaffold_9-1510915933:128470..128541Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:128470..128541TCONS_00073303-exon-scaffold_9-1575043694:128470..128541Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:131489..131590TCONS_00073303-exon-scaffold_9-1491911889:131489..131590Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:131489..131590TCONS_00073303-exon-scaffold_9-1510915933:131489..131590Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:131489..131590TCONS_00073303-exon-scaffold_9-1575043694:131489..131590Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:132141..132263TCONS_00073303-exon-scaffold_9-1491911889:132141..132263Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:132141..132263TCONS_00073303-exon-scaffold_9-1510915933:132141..132263Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:132141..132263TCONS_00073303-exon-scaffold_9-1575043694:132141..132263Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:132882..132993TCONS_00073303-exon-scaffold_9-1491911889:132882..132993Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:132882..132993TCONS_00073303-exon-scaffold_9-1510915933:132882..132993Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:132882..132993TCONS_00073303-exon-scaffold_9-1575043694:132882..132993Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1491911889:133481..134111TCONS_00073303-exon-scaffold_9-1491911889:133481..134111Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1510915933:133481..134111TCONS_00073303-exon-scaffold_9-1510915933:133481..134111Clytia hemisphaericaexon
TCONS_00073303-exon-scaffold_9-1575043694:133481..134111TCONS_00073303-exon-scaffold_9-1575043694:133481..134111Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073303-proteinTCONS_00073303-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:112670..134111 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 3.34482 2.62193 6.12508 6.2624 3.67471 4.60841 3.56608 3.12821 5.48593 5.21024 0 0 0 0 0 0 0 0 0 0 22.807 24.0638 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR024682Npl4_Ub-like_dom
IPR007717NPL4_C
IPR007716NPL4_Zn-bd_put
IPR016563Npl4
IPR001876Znf_RanBP2
IPR029071Ubiquitin-rel_dom
Vocabulary: Biological Process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
Blast
BLAST of TCONS_00073303 vs. Swiss-Prot (Human)
Match: NPL4 (Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 289/628 (46.02%), Postives = 414/628 (65.92%), Query Frame = 3
Query:  228 NMILRIQTPEGMRRIQVGGADTVNTLYEKVQSFLKLQTNGWSIYKDRGLNDELSKSSRKTLKGLQLNHGDVIYMKETGHFVSNSPTSMDDRPXXXXXXXXXXXXXEKEDNTSKLDVVEDEIDVLLSHQSGLIKRDRHPLLCRHGKQGQCLNCAPLEPYNEDYLKSLKPPAKHLSFHAYLKKMKSGVAKGKYISLEDVNCKIKPGCTEHPPWPKGICTKCQPGAVMLNRQTYRHVDNIMFENPVIMDRFLNYWRKTGGQRIGILYGKYEKHENVPLGIRATVAAIYEPPQDSNKDRIQLLPNPQQESVDILASYFGLKQVGWIVTDLIPDTEKAGLVKHLRHAKTHFLSAQECMMAADYQNKHPNPSKESKTGRFGSKFVTVVVSGDEEQHIHYEGWQVSNQCMALVRDQCLVPTVDDSALGYIKESSSEQFVPDVFYKVKDEYGNEVTKIGRPMPIEYFLIEVPAGFPMEPQSTF-ISSDPTNLFPIENRTQMMENQNFETLTQHLNRLKSSDVNXXXXXXXXXXXXXIMTNEFISIRHKMSDLCKALKQRDQMLFHQWLESDEWKTVETMVQTHAPMATDSPMDGSDAVPMETDNSVTITGWTCPHCTFINKNPTSDTCDMCTLPKS 2108
            ++I+R+Q+P+G++RI     +T  T  +KV      Q NG+S+Y +R    E++ SS K+L  L++ HGD++++  +     +S       P                      +VVEDEID  LS Q G I R R P LCRHG  G+C++C PLEP++EDYL  L+PP KH+SFHAY++K+  G  KGK+++LE+++CKIK GC  H PWP GICTKCQP A+ LNRQ YRHVDNIMFEN  + DRFL++WRKTG Q  G LYG+Y +H+++PLGIRA VAAIYEPPQ   ++ ++LL +P+ E VD +A+  GL++VGWI TDL+ +  + G V++ R+  T+FLS++EC+ A D+QNKHPN  + S  G FGSKFVT V +G  +  +H+EG+QVSNQCMALVRD+CL+P  D   LGY KESSSEQ+VPDVFYK  D++GNE+T++ RP+P+EY +I++   FP +P  TF IS +P   FPIENR  + E Q+F +L  +L++  SS    L+   DFH LLF++TNE + ++  +S L +A++ R++ L   W  S++W T+E +  T   +    P          + ++ T   W C HCTF+N+ P +  C+MC+LP++
Sbjct:    4 SIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAP--------------NVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNP---FPIENRDVLGETQDFHSLATYLSQNTSSVF--LDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCST---VGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQ-PGTGHCEMCSLPRT 608          
The following BLAST results are available for this feature:
BLAST of TCONS_00073303 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPL40.000e+046.02Nuclear protein localization protein 4 homolog OS=... [more]
back to top