Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073281 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073281
Unique NameTCONS_00073281
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1554

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073281 ID=TCONS_00073281|Name=TCONS_00073281|organism=Clytia hemisphaerica|type=transcript|length=1554bp
cccccccccggtttcgccggccctgcagtacagccctcactaaccggtca
ttattacATTGGTACTTACTTTGTGCataacctcccccccccctcgggGA
CACGTTTATAAGAGACAAAATATATACCAAAAAGCGTGTAGTTGACACCA
TTGTGCATTACTTAATCATTTTACTTTTGGTATTTGCTTCTATGAAGTCT
CTGAGTCTTGATATCTCTTTACGCTAAATATCTTTCCTTAACCCGTCTAA
ctaatgaaaataatgaaaagttATTTGACCATTCCTAAATACTGCGGTGC
CAAAATGACTGTAGACTAATAAACTCGTCATAATCTTGTTTGAGGGTTCC
TGACTGAAGAGAGATATCTCGTCATCGGTTGTTAAAAGGTTAAAAGTAGc
tcaaaaaaagtaaataaggTTCTTAAATTTCAGGAATCAATCTTGAAGAT
TCTTTGGAATACATCCTCATGCATTGATCACGTGTTTGAATAATAGCACC
ATCTTGAATCAGCCTCATTTCACAGATCTCCCGAACGTCAAACGAAATAA
AATTGGATAAAGGCCATACATCAATACCACTTTGTAGCACCAGCTCACCA
ATATAAACATCAGGATTAGGATGTggttttgaccaatggaatttaCGAAT
CCCACTGTCAACGACATCAAAAGACATTAGATACGCATTCTCGATAAAAC
GTGGATAACCTTTAATTAGTGTCTTTTTAGCACTATGGAAAGTCGTGGTT
CGGTTTGAATCATACACTACATGCCCAGCGTACAGTTCAGTGCTAGGTAT
TCTTGGGTCAGACAGTAAGGAGAACATCTTGGGTGTGTTTAAGAACATAT
GACTTTTAATTCTAGCCAGGAAGGTGAACTCACAATTTTGGTCAACCCAC
TCCATACTTGCCATGAGTTTTAATGTCTCTTTCCGTGATGAACTTGACCA
AAAtccaatgacgtcattatgACGTAATTGCTCTTCTTTGAAAGCAGCTC
GTTCAGCTAGCCCGTTTGGCACGTCAACAACAAATACAATTTTCCAGTCT
AGAGATTTCATGCCGTCTGAAGTCAAGATTCGCTCCTTCTCTGATGCCCA
TGTCTGTCGATACAGATTTCTTCTTGTCGTATTTGTATTATCGAGACAAA
GCACCAAAAGTTGGTACGGATTTCTACATATTCCTGTCTCGATTTGCCTG
TTGTTACCATGGTAAATATAATCTCGATGGTATGGTTTCGATTCATCAGG
TTTGATATCAGCTTTTTGAATATCCGAGTCAAATTGTTTAATCAAGTCCA
TCGATAAAGATTGAGTTTGCTCGATTAATTTTTCGATCTCTTGTGAATTA
CTGTTTTGCGAGTTTGCGTCAGACAGATGatattttgagcttttttttgA
AGTAATTTTGACTTGAATGCGATTATCAGCCCCTGTTCCGATGTCTAGCC
TTTCTTCTTGATGATTTAAAGTCCAAACATATATgaatccaatcaaaaca
aagaatatGATACATATTGTGTATAACACTGTTTTGgaccaatttctttt
ttct
Run BLAST on NCBI

protein sequence of TCONS_00073281-protein

>TCONS_00073281-protein ID=TCONS_00073281-protein|Name=TCONS_00073281-protein|organism=Clytia hemisphaerica|type=polypeptide|length=376bp
EKRNWSKTVLYTICIIFFVLIGFIYVWTLNHQEERLDIGTGADNRIQVKI
TSKKSSKYHLSDANSQNSNSQEIEKLIEQTQSLSMDLIKQFDSDIQKADI
KPDESKPYHRDYIYHGNNRQIETGICRNPYQLLVLCLDNTNTTRRNLYRQ
TWASEKERILTSDGMKSLDWKIVFVVDVPNGLAERAAFKEEQLRHNDVIG
FWSSSSRKETLKLMASMEWVDQNCEFTFLARIKSHMFLNTPKMFSLLSDP
RIPSTELYAGHVVYDSNRTTTFHSAKKTLIKGYPRFIENAYLMSFDVVDS
GIRKFHWSKPHPNPDVYIGELVLQSGIDVWPLSNFISFDVREICEMRLIQ
DGAIIQTRDQCMRMYSKESSRLIPEI
Run BLAST on NCBI

transcript from alignment at scaffold_89:155406..156959

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073281 ID=TCONS_00073281|Name=TCONS_00073281|organism=Clytia hemisphaerica|type=transcript|length=1554bp|location=Sequence derived from alignment at scaffold_89:155406..156959 (Clytia hemisphaerica)
agaaaaaagaaattggtcCAAAACAGTGTTATACACAATATGTATCatat tctttgttttgattggattcATATATGTTTGGACTTTAAATCATCAAGAA GAAAGGCTAGACATCGGAACAGGGGCTGATAATCGCATTCAAGTCAAAAT TACTTcaaaaaaaagctcaaaatatCATCTGTCTGACGCAAACTCGCAAA ACAGTAATTCACAAGAGATCGAAAAATTAATCGAGCAAACTCAATCTTTA TCGATGGACTTGATTAAACAATTTGACTCGGATATTCAAAAAGCTGATAT CAAACCTGATGAATCGAAACCATACCATCGAGATTATATTTACCATGGTA ACAACAGGCAAATCGAGACAGGAATATGTAGAAATCCGTACCAACTTTTG GTGCTTTGTCTCGATAATACAAATACGACAAGAAGAAATCTGTATCGACA GACATGGGCATCAGAGAAGGAGCGAATCTTGACTTCAGACGGCATGAAAT CTCTAGACTGGAAAATTGTATTTGTTGTTGACGTGCCAAACGGGCTAGCT GAACGAGCTGCTTTCAAAGAAGAGCAATTACGTcataatgacgtcattgg aTTTTGGTCAAGTTCATCACGGAAAGAGACATTAAAACTCATGGCAAGTA TGGAGTGGGTTGACCAAAATTGTGAGTTCACCTTCCTGGCTAGAATTAAA AGTCATATGTTCTTAAACACACCCAAGATGTTCTCCTTACTGTCTGACCC AAGAATACCTAGCACTGAACTGTACGCTGGGCATGTAGTGTATGATTCAA ACCGAACCACGACTTTCCATAGTGCTAAAAAGACACTAATTAAAGGTTAT CCACGTTTTATCGAGAATGCGTATCTAATGTCTTTTGATGTCGTTGACAG TGGGATTCGtaaattccattggtcaaaaccACATCCTAATCCTGATGTTT ATATTGGTGAGCTGGTGCTACAAAGTGGTATTGATGTATGGCCTTTATCC AATTTTATTTCGTTTGACGTTCGGGAGATCTGTGAAATGAGGCTGATTCA AGATGGTGCTATTATTCAAACACGTGATCAATGCATGAGGATGTATTCCA AAGAATCTTCAAGATTGATTCCTGAAATTTAAGAAccttatttacttttt ttgagCTACTTTTAACCTTTTAACAACCGATGACGAGATATCTCTCTTCA GTCAGGAACCCTCAAACAAGATTATGACGAGTTTATTAGTCTACAGTCAT TTTGGCACCGCAGTATTTAGGAATGGTCAAATaacttttcattattttca ttagTTAGACGGGTTAAGGAAAGATATTTAGCGTAAAGAGATATCAAGAC TCAGAGACTTCATAGAAGCAAATACCAAAAGTAAAATGATTAAGTAATGC ACAATGGTGTCAACTACACGCTTTTTGGTATATATTTTGTCTCTTATAAA CGTGTCcccgaggggggggggaggttatGCACAAAGTAAGTACCAATgta ataatgaccggttagtgagggctgtactgcagggccggcgaaaccggggg gggg

Coding sequence (CDS) from alignment at scaffold_89:155406..156959

>TCONS_00073281 ID=TCONS_00073281|Name=TCONS_00073281|organism=Clytia hemisphaerica|type=CDS|length=1131bp|location=Sequence derived from alignment at scaffold_89:155406..156959 (Clytia hemisphaerica)
gaaaaaagaaattggtcCAAAACAGTGTTATACACAATATGTATCatatt
ctttgttttgattggattcATATATGTTTGGACTTTAAATCATCAAGAAG
AAAGGCTAGACATCGGAACAGGGGCTGATAATCGCATTCAAGTCAAAATT
ACTTcaaaaaaaagctcaaaatatCATCTGTCTGACGCAAACTCGCAAAA
CAGTAATTCACAAGAGATCGAAAAATTAATCGAGCAAACTCAATCTTTAT
CGATGGACTTGATTAAACAATTTGACTCGGATATTCAAAAAGCTGATATC
AAACCTGATGAATCGAAACCATACCATCGAGATTATATTTACCATGGTAA
CAACAGGCAAATCGAGACAGGAATATGTAGAAATCCGTACCAACTTTTGG
TGCTTTGTCTCGATAATACAAATACGACAAGAAGAAATCTGTATCGACAG
ACATGGGCATCAGAGAAGGAGCGAATCTTGACTTCAGACGGCATGAAATC
TCTAGACTGGAAAATTGTATTTGTTGTTGACGTGCCAAACGGGCTAGCTG
AACGAGCTGCTTTCAAAGAAGAGCAATTACGTcataatgacgtcattgga
TTTTGGTCAAGTTCATCACGGAAAGAGACATTAAAACTCATGGCAAGTAT
GGAGTGGGTTGACCAAAATTGTGAGTTCACCTTCCTGGCTAGAATTAAAA
GTCATATGTTCTTAAACACACCCAAGATGTTCTCCTTACTGTCTGACCCA
AGAATACCTAGCACTGAACTGTACGCTGGGCATGTAGTGTATGATTCAAA
CCGAACCACGACTTTCCATAGTGCTAAAAAGACACTAATTAAAGGTTATC
CACGTTTTATCGAGAATGCGTATCTAATGTCTTTTGATGTCGTTGACAGT
GGGATTCGtaaattccattggtcaaaaccACATCCTAATCCTGATGTTTA
TATTGGTGAGCTGGTGCTACAAAGTGGTATTGATGTATGGCCTTTATCCA
ATTTTATTTCGTTTGACGTTCGGGAGATCTGTGAAATGAGGCTGATTCAA
GATGGTGCTATTATTCAAACACGTGATCAATGCATGAGGATGTATTCCAA
AGAATCTTCAAGATTGATTCCTGAAATTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045464XLOC_045464Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073281-proteinTCONS_00073281-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073281-exon-scaffold_89-1491911889:155406..156959TCONS_00073281-exon-scaffold_89-1491911889:155406..156959Clytia hemisphaericaexon
TCONS_00073281-exon-scaffold_89-1510915933:155406..156959TCONS_00073281-exon-scaffold_89-1510915933:155406..156959Clytia hemisphaericaexon
TCONS_00073281-exon-scaffold_89-1575043694:155406..156959TCONS_00073281-exon-scaffold_89-1575043694:155406..156959Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:155406..156959 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.94959 1.02889 0.418123 0.438288 2.73901 1.91142 8.51202 9.33404 9.1134 8.67281 3.84825 7.74717 3.57874 2.5688 9.33131 6.39734 1.00988 1.40042 0.196279 0.205392 0.382549 0.261232 0.756098 0.742395 0.538087 0.631881 0.253182 0.0772006 0.29277 0.805372
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0008378galactosyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006486protein glycosylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006486 protein glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0008378 galactosyltransferase activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073281 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top