Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073265 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073265
Unique NameTCONS_00073265
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1304

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073265 ID=TCONS_00073265|Name=TCONS_00073265|organism=Clytia hemisphaerica|type=transcript|length=1304bp
AGAAGCTCATCAAAATCACATTAATAGAAGAATTCGTCGCGCTAAATAGA
AAATCGTTAAAAATTTTACTTCAATGACAAGACAGTGCTCGTAAACAGGG
TGAAACATGCTGATAGAAAGGGTACCGTATTTCAATCTCatcttcatttt
gattttattggaaatttatAGAACTGACACCAGAGCTTTTAGAAGTCGAT
TCCAATTAAGAGACAATGGTGTTGAAAAGAACTCTGTTGCATTGGAAACC
GATATGAATTTTACGCCGGGTAGATGCGTTCCAATTACGTTTAACCAAAC
GGTAACGAAACGTGGCTGTATTCCCGTTAAAATACAGAACAATTTATGTT
ATGGGACATGTGGCTCAATGTATATACCGTACGGGAATCCATTAAAAAAT
GATACTCGGAAAGAAACATTTTTCGATTGCAGACATTGTATACCAAGTAG
ATATCAATTGATCCGGCTACCTATGTATTGTCCGGGTAGGCGCCGAAAAC
ACCGGACAAAACGAGTTTTGCTTATTCATGATTGTAGTTGTAGTAGTAGA
ACTTGTTATTTGCATTCTTGGAACAAGCGATGAATGGCGGACAAAAAGGG
AAAGAGATTTCGAGATGTCAACATATCATTCAAAGAAATATCGCTATTTA
ACAGACTTTGAAACCGTGAAAATACGTCAATACTGCAACCGTTTCTTTCT
GATACACATATTTATCGCAGGAATGTTTTATCAGCTTCAAATTCGAATAT
TATTTGTGATGAAAGTTTAGAAGATCATCTCTAAGCTAACTACAGAAAAC
TATAAATGGGAAATCTTTTGACACCGATATCACCTTAACTATTGATAAAA
GTTCGACTGGTGATGGTAACCCTGGTCAATTTACATATACACATGTGTGA
TGTCTTTAATACAGACTGAATGAATGTTTTCAAGTGATATGGTAGACATA
CTGTATGTAGAACAAAGTGTTTCTTTAAGAATTAAGACGAAAAGAAGACT
TTTTAGCGTGCTAAACGACACTCGTCATTATAATACCAACGCAACAATAT
ACAGATTTTTGTCTGCGGAAAAACTTTGGAATATAAATTTGAGTCAACCT
AGACGAGTCAACTTATCAAGAGTAAGAATAAATCATGATGGGGTAGGCTT
TGCGCGATTATGAtactaatttcatttttttttatatattgcttttaaaa
ataatatcaaaatagCTGgctattttgtcaaattttatgttttgtaaaTA
TAAAGATTATCTTAATTATTTTCGTAAATTGAATAACGAACACCGAGAAC
AGCT
Run BLAST on NCBI

protein sequence of TCONS_00073265-protein

>TCONS_00073265-protein ID=TCONS_00073265-protein|Name=TCONS_00073265-protein|organism=Clytia hemisphaerica|type=polypeptide|length=158bp
MLIERVPYFNLIFILILLEIYRTDTRAFRSRFQLRDNGVEKNSVALETDM
NFTPGRCVPITFNQTVTKRGCIPVKIQNNLCYGTCGSMYIPYGNPLKNDT
RKETFFDCRHCIPSRYQLIRLPMYCPGRRRKHRTKRVLLIHDCSCSSRTC
YLHSWNKR
Run BLAST on NCBI

transcript from alignment at scaffold_89:179095..180450-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073265 ID=TCONS_00073265|Name=TCONS_00073265|organism=Clytia hemisphaerica|type=transcript|length=1356bp|location=Sequence derived from alignment at scaffold_89:179095..180450- (Clytia hemisphaerica)
AGAAGCTCATCAAAATCACATTAATAGAAGAATTCGTCGCGCTAAATAGA AAATCGTTAAAAATTTTACTTCAATGACAAGACAGTGCTCGTAAACAGGG TGAAACATGCNAAAATTTTACTTCAATGAAAAAAAAGTGCTGGTAAACAG GGTGAAACATGCTGATAGAAAGGGTACCGTATTTCAATCTCATCTTCATT TTGATTTTATTGGAAATTTATAGAACTGACACCAGAGCTTTTAGAAGTCG ATTCCAATTAAGAGACAATGGTGTTGAAAAGAACTCTGTTGCATTGGAAA CCGATATGAATTTTACGCCGGGTAGATGCGTTCCAATTACGTTTAACCAA ACGGTAACGAAACGTGGCTGTATTCCCGTTAAAATACAGAACAATTTATG TTATGGGACATGTGGCTCAATGTATATACCGTACGGGAATCCATTAAAAA ATGATACTCGGAAAGAAACATTTTTCGATTGCAGACATTGTATACCAAGT AGATATCAATTGATCCGGCTACCTATGTATTGTCCGGGTAGGCGCCGAAA ACACCGGACAAAACGAGTTTTGCTTATTCATGATTGTAGTTGTAGTAGTA GAACTTGTTATTTGCATTCTTGGAACAAGCGATGAATGGCGGACAAAAAG GGAAAGAGATTTCGAGATGTCAACATATCATTCAAAGAAATATCGCTATT TAACAGACTTTGAAACCGTGAAAATACGTCAATACTGCAACCGTTTCTTT CTGATACACATATTTATCGCAGGAATGTTTTATCAGCTTCAAATTCGAAT ATTATTTGTGATGAAAGTTTAGAAGATCATCTCTAAGCTAACTACAGAAA ACTATAAATGGGAAATCTTTTGACACCGATATCACCTTAACTATTGATAA AAGTTCGACTGGTGATGGTAACCCTGGTCAATTTACATATACACATGTGT GATGTCTTTAATACAGACTGAATGAATGTTTTCAAGTGATATGGTAGACA TACTGTATGTAGAACAAAGTGTTTCTTTAAGAATTAAGACGAAAAGAAGA CTTTTTAGCGTGCTAAACGACACTCGTCATTATAATACCAACGCAACAAT ATACAGATTTTTGTCTGCGGAAAAACTTTGGAATATAAATTTGAGTCAAC CTAGACGAGTCAACTTATCAAGAGTAAGAATAAATCATGATGGGGTAGGC TTTGCGCGATTATGATACTAATTTCATTTTTTTTTATATATTGCTTTTAA AAATAATATCAAAATAGCTGGCTATTTTGTCAAATTTTATGTTTTGTAAA TATAAAGATTATCTTAATTATTTTCGTAAATTGAATAACGAACACCGAGA ACAGCT

Coding sequence (CDS) from alignment at scaffold_89:179095..180450-

>TCONS_00073265 ID=TCONS_00073265|Name=TCONS_00073265|organism=Clytia hemisphaerica|type=CDS|length=477bp|location=Sequence derived from alignment at scaffold_89:179095..180450- (Clytia hemisphaerica)
ATGCTGATAGAAAGGGTACCGTATTTCAATCTCATCTTCATTTTGATTTT
ATTGGAAATTTATAGAACTGACACCAGAGCTTTTAGAAGTCGATTCCAAT
TAAGAGACAATGGTGTTGAAAAGAACTCTGTTGCATTGGAAACCGATATG
AATTTTACGCCGGGTAGATGCGTTCCAATTACGTTTAACCAAACGGTAAC
GAAACGTGGCTGTATTCCCGTTAAAATACAGAACAATTTATGTTATGGGA
CATGTGGCTCAATGTATATACCGTACGGGAATCCATTAAAAAATGATACT
CGGAAAGAAACATTTTTCGATTGCAGACATTGTATACCAAGTAGATATCA
ATTGATCCGGCTACCTATGTATTGTCCGGGTAGGCGCCGAAAACACCGGA
CAAAACGAGTTTTGCTTATTCATGATTGTAGTTGTAGTAGTAGAACTTGT
TATTTGCATTCTTGGAACAAGCGATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045452XLOC_045452Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073265-proteinTCONS_00073265-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073265-exon-scaffold_89-1575043694:180345..180450TCONS_00073265-exon-scaffold_89-1575043694:180345..180450Clytia hemisphaericaexon
TCONS_00073265-exon-scaffold_89-1575043694:179095..180292TCONS_00073265-exon-scaffold_89-1575043694:179095..180292Clytia hemisphaericaexon
TCONS_00073265-exon-scaffold_89-1510915933:180345..180450TCONS_00073265-exon-scaffold_89-1510915933:180345..180450Clytia hemisphaericaexon
TCONS_00073265-exon-scaffold_89-1510915933:179095..180292TCONS_00073265-exon-scaffold_89-1510915933:179095..180292Clytia hemisphaericaexon
TCONS_00073265-exon-scaffold_89-1491911889:180345..180450TCONS_00073265-exon-scaffold_89-1491911889:180345..180450Clytia hemisphaericaexon
TCONS_00073265-exon-scaffold_89-1491911889:179095..180292TCONS_00073265-exon-scaffold_89-1491911889:179095..180292Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:179095..180450 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.218464 0.0690534 0.24993 0.389969 0.218421 0.304369 0.328253 0.884701 4.99915 4.2518 5.61129 5.11357 1.11883 0.922397 0.172208 0.0360407 0.375911 0.320874 0.185745 0.135095 0 0 0.13328 0 0.0359612 0.0366388
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006207Cys_knot_C
IPR004133DAN
IPR029034Cystine-knot_cytokine
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073265 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top