Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073262 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073262
Unique NameTCONS_00073262
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3225

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073262 ID=TCONS_00073262|Name=TCONS_00073262|organism=Clytia hemisphaerica|type=transcript|length=3225bp
TTGTAAACACGACTGATTGAACAGATATAAAATCACATTCGAGCAGGTAG
AAACTCTACTATTATTCAAAGACTGGGAAATTGAAATCGTACAAAGAGAG
ACGATGGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCAT
GTGTCAAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAA
AAATAGATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGA
AGTTCACTACCAAGGCAACtaagaataaacaaaaatcagGCAATCATTGT
GAAGGAACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTA
TCGTTGAAAGGTtcgaaaatgaaacaaaaacaattgtTGATAGCAATGAA
GTCAAAACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAG
AAAAGGTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTA
ACCTACGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATC
GAAATTGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTC
GAAGATTTTAAGTCAGGTAGATATAATAGactggaaagaaaaaacctcAA
AACACAAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTT
TATGACCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGT
TAAGCTGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCC
GGTTACGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTT
GATAAGGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCggaatt
tgaatattttaaatacCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATG
GAGGCTCAATTTGTGATTTGGCAACTAAAATGGCAAGgAAAGTAATCGAA
GAAAAGCTATTGGCAGATGAAATACGAATGATCAGGCTTTGGCAACTCCA
GACTTGGCGAACTGTATACAAAGTCTCATATTTGAACCAGCAGTATCAAC
TTTCATCTCAAAGTATTTTCGGTAAAAACCAAAAGATCTCAGTAGTATCA
AGACTCGATGAGCCTTTTTTGATGGAGAATTACATACCGTGTGAGCATTT
CCAATGTCAAAAACATATCATGTCTTGTCGACTTCCTTTTCATAACAAAA
CAACTCATATCCGTGAGTGGAGGTCTTCTAAATGTAGTGGATACGTTGTA
GACCTATTGTATGAGTTATCAGTAGAAATGCATACAGAATTCGAACTTTA
CGTCGCCTTTGATGGGGAGTTCGGAAGATGCGTCAATCGTTCCACCAATG
AATGGACAGGGATGATTGGAGATGTCCTGAGGCGAGAAGCTGATTTAGCT
ATCCAGGGAATCACCATAACAGAAGAACGATTAAAAGTTGTCGATTTCAC
TTTACCATATTTGCAGAGTCGGATCGAGATTCTAACATTAAAGGAAATGC
CAAAAGAACAGTTGTTCTCCATGTATTTTCTTGAGTTATATGACTTAGAG
GCAAGATATGTTTTGGTGCCATTGTTTTTACTATCCATCTTATCAGTATA
TGTATCTGAAAACATAATCATCTTCAAATCTAATATAACAAAACGAAAAC
AGAAGCGTAGAAACAAAATGGAGCTCAGAGATCTAGGTTTATATTTTGCA
GGATCGGTGTTCCAAAAAGGTGATTTAGGAGCAGCAAACCCGAAGACTTA
TAGTGGGCGTTTTGTAAGCTTGTCATGGTCATTTTGTTTCTTGGTGTTGA
CATCACTGTATACTGCTCTTTTAACAGCTGATCGTGTGGTGACTGGTGGA
TATAGCTCATTCCATGGCATGAAAGATCAGCGGATCTTAAACCCAACATC
AGCTTTCAAGTTTGGTACCATCAATAATACAGTCCTATCTGACTACTTTA
AGACAGCGCCATTGGCAAGTGCTCTACGTATCCATCACTTTATGAAGCGT
TATCACCAAAATGATTATAATGTTACATTACCACTCCTCGAAAGAAGCTA
TTTGCATGCTTTCTTTGCAGAGCACGTTTTCGTGCTCCCGCACGTCAAGA
AGTACGAATGCAAATTCAAGGCTCATAAAACACCAATCCCAGAGGCTAGT
TATGGTGCTGTAGTGGCTAAAGGATCACCTCTAAAAGGACTTGTTTCACA
GGCTATTCTCAAACTTAACGATGCTAAAATTTTGGATGAGTTAAAGGAAA
GATGGTTTACAAACGCATGTGAGAATACAGAATCGACGAATATAAACCCA
TTCAACTTAATATTCTTTTCATCACTTTTCATGGTTTTATTGTTTGCTGT
TGTACTATCTTTCATCGTATTAGGAATNAAATACAGAATCGACAAACATA
AACCCATTCAACTTAATATTCTTTTCATCACTTTTTATGGTTTTATTGTT
TGCTGTTGTACTATCTTTCATCGTATTAGGAATTGAAATTTACGGTCGCT
GCATTTACGAGAAATCCTTTATTTACGAACAAGTCAGATTGATACGAGtg
acaaaaaaacaaagtgTGGCTCGTAAAGAAGATGAATGGGATTATTTTGA
AAGAGAAATTGTAGAAAATGTTTTTACACACTGGAGAAATTTTGCTCAGA
ACAAAGGCTATGGAAGCAGGCCTGCTTATGTTTGATTTGTCACGTGCATT
CGTTATGGTTTCGTATGTTTTTTTGGAAACGAAATTAAGTGATTTTATTG
GCTAAAGATATTTATTCCAATGATTAACCAATAACATCCCATTCTCACAG
TGGGACCCCCTAccactgaaaaaattggtcaaaatattgacccaagtgga
aaattatattccaattttgtccccactgaaaaaagCGGAATAAACAAGTC
CTCAGTGCAAAATTATATGCTGTTCTTTGCCATCCCCATTGAATTGAAAA
CAACGTTATTCGAGTTCCAGCCATTAAGAAcattggaatatcaatcccgC
CGACTTTCAGTCCGTTTTTTATCACCATACCCGCTGACAAAATCCTACCG
GATCTAAGAGAAGGGTCCAATAGTCCAATAGAATAGCTTTATTTCGTTTA
ACTATATATTATAGAACCGTCGTAGCGTTTTTTTTGGTATAGTTTCGATT
GGAAAGAATACTTCTCAGAGTCGCG
Run BLAST on NCBI

protein sequence of TCONS_00073262-protein

>TCONS_00073262-protein ID=TCONS_00073262-protein|Name=TCONS_00073262-protein|organism=Clytia hemisphaerica|type=polypeptide|length=810bp
MEWVLLKVCLLLATRMCQETLAAVISPNHDGKKIDLENNVRQNSTKDLRS
SLPRQLRINKNQAIIVKEPRDFNIIYVENRTAIVERFENETKTIVDSNEV
KTRLSLKDKLQSLVKRKGITISLLNQDQESMLNLRTKDCILPTTFDVLIE
IVTRFEPKELILIYHSKILSQVDIIDWKEKTSKHKEFKFIDFKIKEDDLY
DHTGKILKEISRSTDVKLIILFTPLEITNLIFRLRSEKFRMITGGTWIVD
KGIYPEADRPPKMAEFEYFKYRVVLNSASMRYGGSICDLATKMARKVIEE
KLLADEIRMIRLWQLQTWRTVYKVSYLNQQYQLSSQSIFGKNQKISVVSR
LDEPFLMENYIPCEHFQCQKHIMSCRLPFHNKTTHIREWRSSKCSGYVVD
LLYELSVEMHTEFELYVAFDGEFGRCVNRSTNEWTGMIGDVLRREADLAI
QGITITEERLKVVDFTLPYLQSRIEILTLKEMPKEQLFSMYFLELYDLEA
RYVLVPLFLLSILSVYVSENIIIFKSNITKRKQKRRNKMELRDLGLYFAG
SVFQKGDLGAANPKTYSGRFVSLSWSFCFLVLTSLYTALLTADRVVTGGY
SSFHGMKDQRILNPTSAFKFGTINNTVLSDYFKTAPLASALRIHHFMKRY
HQNDYNVTLPLLERSYLHAFFAEHVFVLPHVKKYECKFKAHKTPIPEASY
GAVVAKGSPLKGLVSQAILKLNDAKILDELKERWFTNACENTESTNINPF
NLIFFSSLFMVLLFAVVLSFIVLGXKYRIDKHKPIQLNILFITFYGFIVC
CCTIFHRIRN
Run BLAST on NCBI

transcript from alignment at scaffold_89:158105..169414-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073262 ID=TCONS_00073262|Name=TCONS_00073262|organism=Clytia hemisphaerica|type=transcript|length=11310bp|location=Sequence derived from alignment at scaffold_89:158105..169414- (Clytia hemisphaerica)
TTGTAAACACGACTGATTGAACAGATATAAAATCACATTCGAGCAGGTAG AAACTCTACTATTATTCAAAGACTGGGAAATTGAAATCGTACAAAGAGAG ACGATGGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCAT GTGTCAAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAA AAATAGATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGA AGTTCACTACCAAGGCAACTAAGAATAAACAAAAATCAGGCAATCATTGT GAAGGAACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTA TCGTTGAAAGGTTCGAAAATGAAACAAAAACAATTGTTGATAGCAATGAA GTCAAAACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAG AAAAGGTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTA ACCTACGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATC GAAATTGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTC GAAGATTTTAAGTCAGGTAGATATAATAGACTGGAAAGAAAAAACCTCAA AACACAAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTT TATGACCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGT TAAGCTGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCC GGTTACGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTT GATAAGGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCGGAATT TGAATATTTTAAATACCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATG GAGGCTCAATTTGTGATTTGGCAACTAAAATGGCAAGGTAAGAGAGTTTG AAATAAAAATGGCCCCAACCAGCTTACTCTGTAATTTGTACCAGAGTGTA TCTCACGTTTATCGCTTCGTAGTACACTCTGTGCGCATTGTCTGTTTGAT AAAAAAATTCCCGTACGGAGACCCCTGCGATGAATTTTGATTTATAAATA ACAACACTTCTCTCCTCTCTCACCAACACTCCATCGCAGCGGTCGGTTTA AAAAATCTCAAATGAGAAAAAACAATGACAACAGACCCTCTACGGCCTCT ATGGGTTTATGTACAGACAACAACCGGCTCGTCCAATGTCTATCAAGCAA ATCGTCTAAATAGCATTCGAAATTTTCGAGAAAAGACAACAGATTAAGCT TATGTAGGAAATATCTTCACTGTCCCCAATTTATCTCAAACATCCTTTTG GAAAACCCGTAGTCGTGACCCACAAAATTGAGGACGATAAAAAAGTTGAT TTACCGTCGTCCTCAGTTGATCAGGATCTAGACAAATTAGAGATTTACCG TCTCCGTCGTGTTAATAGCGAGTTTATGTATTTGCACTTTTGAGGACGGT AAAGTCCTGAAGCGATTTGGAATAACCCGCAGTTCTGATCCGCAATATCG AGGACGGTAAAAGTGCTGATTTACCGTCGTCCTCAGCTGGTCAGGATCTA GTCAAATTAGAACCTTACCGTCTCCGTCGCAGAAAAACACACATACATAA ACTCGGTAATATCGTGTTTTTAGTAGGTTTTCTTTTTTGATTTTTACTCA AAATATTTTGTTTTAGGAAAGTAATCGAAGAAAAGCTATTGGCAGATGAA ATACGAATGATCAGGCTTTGGCAACTCCAGACTTGGCGAACTGTATACAA AGTCTCATATTTGAACCAGCAGTATCAACTTTCATCTCAAAGTATTTTCG GTAAAAACCAAAAGATCTCAGTAGTATCAAGACTCGATGAGCCTTTTTTG ATGGAGAATTACATACCGTGTGAGCATTTCCAATGTCAAAAACATATCAT GTCTTGTCGACTTCCTTTTCATAACAAAACAACTCATATCCGTGAGTGGA GGTCTTCTAAATGTAGTGGATACGTTGTAGACCTATTGTATGAGTTATCA GTAGAAATGCATACAGAATTCGAACTTTACGTCGCCTTTGATGGGGAGTT CGGAAGATGCGTCAATCGTTCCACCAATGAATGGACAGGGATGATTGGAG ATGTCCTGAGGCGAGAAGCTGATTTAGCTATCCAGGGAATCACCATAACA GAAGAACGATTAAAAGTTGTCGATTTCACTTTACCATATTTGCAGAGTCG GATCGAGATTCTAACATTAAAGGAAATGCCAAAAGAACAGTTGTTCTCCA TGTATTTTCTTGAGTTATATGACTTAGAGGCAAGATATGTTTTGGTGCCA TTGTTTTTACTATCCATCTTATCAGTATATGTATCTGAAAACATAATCAT CTTCAAATCTAATATAACAAAACGAAAACAGAAGCGTAGAAACAAAATGG AGCTCAGAGATCTAGGTTTATATTTTGCAGGATCGGTGTTCCAAAAAGGT GATTTAGGAGCAGCAAACCCGAAGACTTATAGTGGGCGTTTTGTAAGCTT GTCATGGTCATTTTGTTTCTTGGTGTTGACATCACTGTATACTGCTCTTT TAACAGCTGATCGTGTGGTGACTGGTGGATATAGCTCATTCCATGGCATG AAAGATCAGCGGGTAAGATTTATACTTTTGCTCTAAATGCCGGTCTCAAC TTTCGCGNGTTCCATGGCATGAAAGATCAACGGGTAAGATTTATACTTTT GCTCTAAAGGCCGGTCTCAACTTTCGCGCGACATGAGCGAAATTACGTTT TTGTAATGTCATTGGTCGGTTGAAAAATGAAGCAATTCCATTGGTCGAAA TTGACGTAACAAATGAAAAAAGTAAAACTTCCTTCAACTTTTTTTATTGA TGCGAAACTTTTTTATGACGTAATCTTTTCTTCAGGCAAAAAAAGGTTAA GAAAAAAACTGTCACCCATTTCGTGGGAAAGTGGAGACCGGCCTTGAGTA AAAAACTTTTAAGGTGTTGATTTTTACTTTTACTCTTAATGACGAAATCA ATGCTTTCCATTATGGGAAGGTAGAGAATACCTGGAACAAAAATCAGCTA GGTGCTTTGCTTAGGGCTCTGGACATTTTTCGATTTTACACCAACTTTAA ATGGCAACCTCTGCATTTTAAAAAGATTAATGTATAACTTTTTTTATACG TTCTGTTAAACCTACCTTTTTAGAATTTAAAAATCGAAAAATTGAAATAA AAAAATGAAATAAAGAAGAAAACGAAGAGTTTTTCGAAGAAGAGTGTTTC ACCTTTCAAAGCCCTAATCTCGGTAAAAACTAAACATTTTGGAATTTTTT TTGGTTCAGGTGATGTATCTATTTAGTATCTAAAAATGAAATTTCGGAAA ATTTTTGTGGAAGTATCTTCCCTTTAAAATCTCAAAAAACCTCATTTTTG GCAACTTTCTCCACAGCTATAACTTTGGATGTAGCCANAAAAAACCTCAT TTTTGGCAATTTTCTCCACTAAATTTCCATAAGAAAACAGCTATAACTTT GGATGTAGCCAAATAGAAAATTTTTCCGAAAAAATCATAATAAAGAAATT ATTTGTCATTAACTTAATAAAATGATTTCCCCAAGGAGATTAGGCTTTTT TTGTGAAAAGTATATGAATAGCGTGGTTTTGACGTTTTATCAAGGTCCAT GTCACACTTTTTTCTTAATTACTCATGATGTAATTACTTAAATTCATTTT TTCAAAAGCAGTTTGTTCTTAAACATGTCAAAGAAGCGAAAACATAAGGT TTTATCTTCAAATTCTAAAATAGCGCACCGCGCTGAATCTAAAAATATAT TGTGTTTTTGACATAATCATTACTCTCGATGTGTTTGTACGAGTTCCAAT CCCATCAACCTTTGTGTTCATCTTTTTTGTACGTTAATTGCATCATTTGA CAAAAGATGTATAACAACTTGCACCTATCTTTAATTGAGCCGCATTGAAT TGTGGGATTGCAACTTGTACAAATTTCAAAGAAAGTGAAAAGTAATAATT ATGACGTACGTGTTGCGGAGCGCTATTGATTTTTCACAAAATTGGGTATG TCCAGAGCTCTTAAGGGTGTGTGGCCTGAAGGGGAACGGTTTTTATTTTC TTGTTTTTAAGGCCCATACTCTAAGGCCCGGGGGGGGGGGGACTAGGGCA AAATGGGTTACGGGGGTGCTCCGCTGGTCAGGGTACCTTTTTAAACCTCC ACGAGTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGCTGGTCAGGGT ACCTTTTTTAACCTCCGCGAGTCCCAGGTAGGGTCGCAAAAACACCAAAA TAGAAAAATCAGGCCCTCGTAGGGTAACTATTTTTGGAAAATTTGGGAAA AAAGTAGAAAATTTGATAAAATTTTGGAATTTCAGTCCCATTCAGGGTCA CTTTTTTCGCAAATTTCGAGTCTCACGTAGGGTCCATTTTTCGAACCTCA GCGGAGCACCCCCGTCGGTCGACAAGGGTAGTACCCCCCCGGGCCAATGC CGATAAAAATTCGAAAGTTTTTTGTTGAAGACCCCTAAAGAAATTCTTTA TACTTAAAAAAAAAAGGTTTCTGAATATCTTTTTTCAAAGGTGAGATATT TATCTCCAAACTTACCACTCCATGCGCGACCTTTCGGCCTCTCACTTTAA AAAAAGTTCGATTAAGTTCGATTTCAGTAATTGAACTTACTGTAATCGAA TTTTGTATTTTGAGAAGTTTGTGAGTATTTGACTAAAGTTCAACAACCGA ACTTAGTCAAACATTAATCGGCCTACAAAATTTGATTCAGTTCGACAAAG TTCGATTAAAAATACGGTGTTGGATTGGTTCGATTGATTATGTCTGGAAG AATAGATTGCTTGAGGAATTTCAAAGATTGAGGTTTTTGGTTTGGTGGGA AAATGAAAAAAGGTAATATGAATCATAATATAAAAGGTTCCAATTTTAGG TACCGACCGACCAACCTACCCATTTTTCAAATCTTCTCTAGGACATATGA ACCAAACAATCAATTGGGCCTGGATGGCCCCTAGCTATCATCGATTATCG TTTTTAATTTATATTTAATAAATCGATTAATTATCGATTAGCTATCGATT TTAATCAATAATTGATTTTATCGATTAGTAACGTCTGGATAACATAAATT GAGGCCAATATGTGGGAGTAAGAAAAGGCCAATATATTTTTCTGATGTAG TGGCGTGGTGAATATAATATATTTTCAAGCAAATTTTGTCTAGACAGACA ATAAAAAATAATTCATTGAAAACAATTTACCTGATATTTGATTATGCCGT CTTCTAAAGCCCAATGGGTGAATGCATGGCCAAGTGGATGTGGTAGAAGA AGAAAAATAATAAACAAAATTTGGCACCGATCAAAAANTTTTTGATTTTT TAAAGTATTTGCACGTTTTTTATTCAGTTCTTTCTATAGATTGTAAAATT TGCAAGATTTGCCATAGCCTAGCCCTACAGCAAAAGGTTTCAGTCCTAAT GACTGCAGTTTTTGAGAAATTCCATGTTTTTCATTGTTTGATCTGTCAAA GTTGAACTTGAGGGAATCACCTTTTCAGTAATGACTCTAAAAAGACGATT GCNTTGCAAGATTTGCCATAGCCTAGCCCTACGGCAAAAAGACTGACTGC AGTTTTTGAGAAATTCCATGTTTTTCATTGTTTGATCTGTCAAAGTTGAA CTTGAGGGAATCACCTTTTCAGTAATGACTCTAAAAAGACGATTGCTTAA ATGCCATGACAGAAAATACAATGGAAAAGCTATTAAAATCGAATCCCTCA TGAGCAAATGCCAAATTACAAATGCCAGTTGGTCTAAACGCACCCACAGA TTGGAAATTTCGAAATAAGCTCATTAATATTGCCAATCCTCAAAGGATTG TCGGGGATTGTCATTTTCATTAATCTTTATATAAACGTTTCCATTGAACG ACCAAAACTTATNACTATTAAAATCGAATCCCTCATGAGCAAATGCCAAA TTACAAATGCCAGTTGGTCTAAACGCACCCGGAAATTTCGAAATAAGGTC ATTAATATTGCCAATCCTCAAAGGATAAAAAATCTTTATATAAACGTTTC CATTGAACGACCAAAACTTATGAATTTGATTATCCTTCAACAATGCTTCA CCGCGATCTGTAGCTGCAAGTATGAAAAATCGGGGAAATTTCAATATACT TAGGCTTAAAAAACAACTTTTGGTTGTCAAAAGTCCACAAGAATTTGATA GAAAGTTGAAAATAACGTATAAAGCCCATTAAAAGAATTTGTTCTCAAAT ATTTGTTTTCACCCTTCCAAACGAGAGAGCTTTCGTTTTCTCCAGATCCC TCAATCCCCTAAAATCCCCTCTCGGATCCCTCAAATCGGAATCCTTATAA TTCCTATATTGTAGTTGGTTTCTGTAAATAAAATTTTGGGCTAAACTAAA CTCGACATCCTATATGTAAAGAGAATACAACAAAAAGTTTTTATCGTGTA TTAAAAATTTTAAAGAAATCTTAAATATCTTGAACTTGTGAATCCGATAC AGATCGCTGTGCTTTTGATTTCCCCCATAGTAAACGATTNGTTCTGTAAA TAAAATTTTGGGCTAAACTAAACTCGACATCCTATATGTAAAGAGGATAC AACAAAAAGTTTTTATCGCGTATTAAAAATTTTAAAGAAATCTTAAATAT CTTGAACTTGTGAATCCGATACAGATCGCTATGCTTTTGATTTCCCCCAT AGTAAACGATTATAGTTACTCAAGTTGCTGTTTATGAAAATTTTGTCTGG TAAGATAGCTTTTTCCTGTATTGCTGTTTTATGAAATTCTTTACTGGAGC GTAAAAGAGCTCCACAGATTTTTCGATTTTTAAAACGAACAATAGTTCTC CTTGGGAAGGGATGGTACTAGGTTGGATTGTTTATCAGTGGACTAGGTCA AATTGTNAATTCTTTACTGGAGCGTAAAAGAGCTCCACAGATTTTTCGAT TTTTAAAACGAACAATAGTTCTCCTTGGGAAGGGATGGTACTAGGTTGGA TTGTTTATCAGTGGACTAGGTCAAATTGTTTAACAGTGGACCGGACATGG ATAGATTGGATTGTTTATCAGTGGACTAGGNATAAACACTTTCGCTTCCT GAAAACCTAAAAACAAAAATCAAAACATCCCAAATGAGTGACCTGAGTGA TTCTAGATTTTAGTAGTGTTCTAGCTACTAATATCAGAAATCTCATCTGG CCACTCCACATGCATCCTTTAGGTAAAATCTCGTAGCAGACTCGAATAAG AGTACACCCCCTTCTCACTGGGAACGCTTCTCACTAGGAAAATTGGTCAA AATGATCGTACCCGTTGGAAAATTATACTTTTGTCCCCGCTGAAAATAAT CAGATAAGCCAATCCTCAATGCAAATTATAATATCTTTTTTCCTTACTCA CTGAATTTTCTAGACCGAAAACAATGGAATTAAAATCCCCAGTTATAAGT AAACATGGGAATATCAATTCCCATCGAGTTTAGGTCCGCTATTTTACCCC TACTGGCTGATAATATCCCACCGGGTCTGAGAGAAGGGGGTGTAAAAGTG ACCCACTTCACTGAAGTCGTTTGTGAAAAATGTTAAATACAGTTATATAG GTGATATACAGGGTGTCCGGAAAAAAAGTATCGAGTTCGAACATGATTCT GAGTAGAAGGTTGTTGCGTGTGTTTAAAAAAATGTAAGAAATTATATACC AACACAATAATTGTTTTTACAACAGTCATTATGATTAAAAATAATTAACT TTCTTTACAATTTTCAATAGCCCTTTTTACTATTCCCCTACCGCTGCCTA GTTTTACTTTTTTATTGTTCCATACATTCCATTTTTATTATTTTCATAGT TTTACATACGATTCTTTACAAACATGTTTTAATTGTTGCGTTTTNGAGTA GAAGGTTGTTGCGTTGTTTAAAAAAATGTAAGAAATTATATACCAACACA ATAATTGTTTTTACAACAGTCATTATGATTAAAAATAATTAACTTTCTTT ACAATTTTCATGTAGTTAAAGTTATTGAGAATTGTTTTTTGTAAAAGTTA TTCATAAAAGATGTCTCATGACAATAAACATGACACAGAAAAACTTTGAT AAACAATTTAGTGAAACACACACGAAAACTTTCTTTCCATACACCATAGA CTTTTTTTCGGGACACCCTGTACGATAATACAATAACTGTTATGTGATAA TGTCCTTCAGCTTTCCTTATTACCATACCAATACAGGGTGTCCCTAATTA AAGTATCGAGTTTGAACATGCGATTGAGTAGAAAAGTTTGTGTGTGTTAT CGCTAAAATATAAGAACGTTCTCCATCACACAGGTTTATTACAAAAGGTA GTTACAACGTATAAATTAATCGTAATGACAAAGAAAAAAGAGGGAGAGCT TAAAATACAATTTTGTGAACACACGCACATAAAACTTTATACTCATAGTT GTGTTTCGACTCGATACTTTAATTAGGGACACCCTGTATTACCAATAATC TAAGTAAAGCATCTTTGTAATTCGCAGAAAATTAGCAAGACTCAGCAACT TTGGTTTTCATAAAATTGGGGAAGCCGAAAACGACCAAACCAACAATTTA AGAAAATGAGGATGAAATCTTGGGGGTACTGTGAGGGACGAATCTAGCAT GGGACAATCAAAAGCACATCATTGTCTCAACCACCCGAAAACAGAGTAAA ACACCCCATTTTCCTTCTTGTTTCCAGATCTTAAACCCAACATCAGCTTT CAAGTTTGGTNACTGTGAGGGACGAATTTAGCATGGGACAATCAAAAGCA CATCATTGTCTCAACCACCCGAAAACAGAGTAAAACACCCCATTTTCCTT CTTGTTTCCAGATCTTAAACCCAACATCAGCTTTCAAGTTTGGTACCATC AATAATACAGTCCTATCTGACTACTTTAAGACAGCGCCATTGGCAAGTGC TCTACGTATCCATCACTTTATGAAGCGTTATCACCAAAATGATTATAATG TTACATTACCACTCCTCGAAAGAAGGTAAGCCTTAGACTACACGCATCCG CTCTGATATGTTATGATATAGGGGCTACGCAACATGTATGAAATTCACGT CCAACAGTTTCCCTTGTCTTTCTGTTTCAAAAACTTAATTAATAGTAAGT TGTATTTGAGAGATTTTTGAACTTCATTAAATTTAAGTTATAAATTTGAA TGACTAAAGGCTGATGCAATCATTGGATTTCAATTCCTTTTTATGAAAGT TGAAACAGGTTACCCCAATTTGGGTAACCCTCGGACGGGACCTTTACACA ATTAGCATACCCAATATCAATACATATCACAGGGGATACGTGCAGCCTAG TTAATATTTGGCTTTATAGAATTGACCACTATTCAATATTTTATCCACTC TGTTTACAATTAGAATTGAGCTCATTCAATATTCACCCAAATCAGGATGA ACAAGATCAAAGCAGTTCAACGAGGGCAGATTTTCATACTTTCATACGGA GCCACTACCTTTAGAAATTATGATTATGCGTGCCCGAGTTGAGTAATCAG AATCTACTGAAAAATTTGATTAGTAGATTTAGGCTAAGAGTGATTGACTT TCATTGCCTAAAATTGAAAGCTCCGTTTTATGAATCCTGTATGAACTTTA GAATTTTTTTGCCGATAGTAACTACACCCCCTTCTCACAGACCGACTTAT CCTCCAATTTTGTCCCCATTGAAAAAAATCAAATAAACCAATCCTCACTG CAAAATATTACGCTACTTTCCCCATCCCCACAGACTTTTCAGACAACAAA AGAATTGAAATCCCCAGCCATAAAAAATATGGGAATATCAATCCCCATCG AGTTTCAGTACATTAATTTCATCCCCACTGGCTGAAAAAATCATACTGGG TCTGAGAAGGGGGTATATAACTACAGCCTTACAAGCCTTACAAGATATCA CCCATTTTTCTCTATTTCTCTTCTTTTTCCAGCTATTTGCATGCTTTCTT TGCAGAGCACGTTTTCGTGCTCCCGCACGTCAAGAAGTACGAATGCAAAT TCAAGGCTCATAAAACACCAATCCCAGAGGCTAGTTATGGTGCTGTAGTG GCTAAAGGATCACCTCTAAAAGGACTTGTTTCACAGGCTATTCTCAAACT TAACGATGCTAAAATTTTGGATGAGTTAAAGGAAAGATGGTTTACAAACG CATGTGAGAATACAGAATCGACGAATATAAACCCATTCAACTTAATATTC TTTTCATCACTTTTCATGGTTTTATTGTTTGCTGTTGTACTATCTTTCAT CGTATTAGGAATNAAATACAGAATCGACAAACATAAACCCATTCAACTTA ATATTCTTTTCATCACTTTTTATGGTTTTATTGTTTGCTGTTGTACTATC TTTCATCGTATTAGGAATTGAAATTTACGGTCGCTGCATTTACGAGAAAT CCTTTATTTACGAACAAGTCAGATTGATACGAGTGACAAAAAAACAAAGT GTGGCTCGTAAAGAAGATGAATGGGATTATTTTGAAAGAGAAATTGTAGA AAATGTTTTTACACACTGGAGAAATTTTGCTCAGAACAAAGGCTATGGAA GCAGGCCTGCTTATGTTTGATTTGTCACGTGCATTCGTTATGGTTTCGTA TGTTTTTTTGGAAACGAAATTAAGTGATTTTATTGGCTAAAGATATTTAT TCCAATGATTAACCAATAACATCCCATTCTCACAGTGGGACCCCCTACCA CTGAAAAAATTGGTCAAAATATTGACCCAAGTGGAAAATTATATTCCAAT TTTGTCCCCACTGAAAAAAGCGGAATAAACAAGTCCTCAGTGCAAAATTA TATGCTGTTCTTTGCCATCCCCATTGAATTGAAAACAACGTTATTCGAGT TCCAGCCATTAAGAACATTGGAATATCAATCCCGCCGACTTTCAGTCCGT TTTTTATCACCATACCCGCTGACAAAATCCTACCGGATCTAAGAGAAGGG TCCAATAGTCCAATAGAATAGCTTTATTTCGTTTAACTATATATTATAGA ACCGTCGTAGCGTTTTTTTTGGTATAGTTTCGATTGGAAAGAATACTTCT CAGAGTCGCG

Coding sequence (CDS) from alignment at scaffold_89:158105..169414-

>TCONS_00073262 ID=TCONS_00073262|Name=TCONS_00073262|organism=Clytia hemisphaerica|type=CDS|length=9732bp|location=Sequence derived from alignment at scaffold_89:158105..169414- (Clytia hemisphaerica)
CTATTTGCATGCTTTCTTTGCAGAGCACGTTTTCGTGCTCCCGCACGTCA
AGAAGTACGAATGCAAATTCAAGGCTCATAAAACACCAATCCCAGAGGCT
AGTTATGGTGCTGTAGTGGCTAAAGGATCACCTCTAAAAGGACTTGTTTC
ACAGGCTATTCTCAAACTTAACGATGCTAAAATTTTGGATGAGTTAAAGG
AAAGATGGTTTACAAACGCATGTGAGAATACAGAATCGACGAATATAAAC
CCATTCAACTTAATATTCTTTTCATCACTTTTCATGGTTTTATTGTTTGC
TGTTGTACTATCTTTCATCGTATTAGGAATNAAATACAGAATCGACAAAC
ATAAACCCATTCAACTTAATATTCTTTTCATCACTTTTTATGGTTTTATT
GTTTGCTGTTGTACTATCTTTCATCGTATTAGGAATTGAATCTTAAACCC
AACATCAGCTTTCAAGTTTGGTACCATCAATAATACAGTCCTATCTGACT
ACTTTAAGACAGCGCCATTGGCAAGTGCTCTACGTATCCATCACTTTATG
AAGCGTTATCACCAAAATGATTATAATGTTACATTACCACTCCTCGAAAG
AAGGAAAGTAATCGAAGAAAAGCTATTGGCAGATGAAATACGAATGATCA
GGCTTTGGCAACTCCAGACTTGGCGAACTGTATACAAAGTCTCATATTTG
AACCAGCAGTATCAACTTTCATCTCAAAGTATTTTCGGTAAAAACCAAAA
GATCTCAGTAGTATCAAGACTCGATGAGCCTTTTTTGATGGAGAATTACA
TACCGTGTGAGCATTTCCAATGTCAAAAACATATCATGTCTTGTCGACTT
CCTTTTCATAACAAAACAACTCATATCCGTGAGTGGAGGTCTTCTAAATG
TAGTGGATACGTTGTAGACCTATTGTATGAGTTATCAGTAGAAATGCATA
CAGAATTCGAACTTTACGTCGCCTTTGATGGGGAGTTCGGAAGATGCGTC
AATCGTTCCACCAATGAATGGACAGGGATGATTGGAGATGTCCTGAGGCG
AGAAGCTGATTTAGCTATCCAGGGAATCACCATAACAGAAGAACGATTAA
AAGTTGTCGATTTCACTTTACCATATTTGCAGAGTCGGATCGAGATTCTA
ACATTAAAGGAAATGCCAAAAGAACAGTTGTTCTCCATGTATTTTCTTGA
GTTATATGACTTAGAGGCAAGATATGTTTTGGTGCCATTGTTTTTACTAT
CCATCTTATCAGTATATGTATCTGAAAACATAATCATCTTCAAATCTAAT
ATAACAAAACGAAAACAGAAGCGTAGAAACAAAATGGAGCTCAGAGATCT
AGGTTTATATTTTGCAGGATCGGTGTTCCAAAAAGGTGATTTAGGAGCAG
CAAACCCGAAGACTTATAGTGGGCGTTTTGTAAGCTTGTCATGGTCATTT
TGTTTCTTGGTGTTGACATCACTGTATACTGCTCTTTTAACAGCTGATCG
TGTGGTGACTGGTGGATATAGCTCATTCCATGGCATGAAAGATCAGCGGA
TGGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCATGTGT
CAAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAAAAAT
AGATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGAAGTT
CACTACCAAGGCAACTAAGAATAAACAAAAATCAGGCAATCATTGTGAAG
GAACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTATCGT
TGAAAGGTTCGAAAATGAAACAAAAACAATTGTTGATAGCAATGAAGTCA
AAACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAGAAAA
GGTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTAACCT
ACGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATCGAAA
TTGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTCGAAG
ATTTTAAGTCAGGTAGATATAATAGACTGGAAAGAAAAAACCTCAAAACA
CAAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTTTATG
ACCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGTTAAG
CTGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCCGGTT
ACGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTTGATA
AGGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCGGAATTTGAA
TATTTTAAATACCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATGGAGG
CTCAATTTGTGATTTGGCAACTAAAATGGCAAGCTATTTGCATGCTTTCT
TTGCAGAGCACGTTTTCGTGCTCCCGCACGTCAAGAAGTACGAATGCAAA
TTCAAGGCTCATAAAACACCAATCCCAGAGGCTAGTTATGGTGCTGTAGT
GGCTAAAGGATCACCTCTAAAAGGACTTGTTTCACAGGCTATTCTCAAAC
TTAACGATGCTAAAATTTTGGATGAGTTAAAGGAAAGATGGTTTACAAAC
GCATGTGAGAATACAGAATCGACGAATATAAACCCATTCAACTTAATATT
CTTTTCATCACTTTTCATGGTTTTATTGTTTGCTGTTGTACTATCTTTCA
TCGTATTAGGAATNAAATACAGAATCGACAAACATAAACCCATTCAACTT
AATATTCTTTTCATCACTTTTTATGGTTTTATTGTTTGCTGTTGTACTAT
CTTTCATCGTATTAGGAATTGAATCTTAAACCCAACATCAGCTTTCAAGT
TTGGTACCATCAATAATACAGTCCTATCTGACTACTTTAAGACAGCGCCA
TTGGCAAGTGCTCTACGTATCCATCACTTTATGAAGCGTTATCACCAAAA
TGATTATAATGTTACATTACCACTCCTCGAAAGAAGGAAAGTAATCGAAG
AAAAGCTATTGGCAGATGAAATACGAATGATCAGGCTTTGGCAACTCCAG
ACTTGGCGAACTGTATACAAAGTCTCATATTTGAACCAGCAGTATCAACT
TTCATCTCAAAGTATTTTCGGTAAAAACCAAAAGATCTCAGTAGTATCAA
GACTCGATGAGCCTTTTTTGATGGAGAATTACATACCGTGTGAGCATTTC
CAATGTCAAAAACATATCATGTCTTGTCGACTTCCTTTTCATAACAAAAC
AACTCATATCCGTGAGTGGAGGTCTTCTAAATGTAGTGGATACGTTGTAG
ACCTATTGTATGAGTTATCAGTAGAAATGCATACAGAATTCGAACTTTAC
GTCGCCTTTGATGGGGAGTTCGGAAGATGCGTCAATCGTTCCACCAATGA
ATGGACAGGGATGATTGGAGATGTCCTGAGGCGAGAAGCTGATTTAGCTA
TCCAGGGAATCACCATAACAGAAGAACGATTAAAAGTTGTCGATTTCACT
TTACCATATTTGCAGAGTCGGATCGAGATTCTAACATTAAAGGAAATGCC
AAAAGAACAGTTGTTCTCCATGTATTTTCTTGAGTTATATGACTTAGAGG
CAAGATATGTTTTGGTGCCATTGTTTTTACTATCCATCTTATCAGTATAT
GTATCTGAAAACATAATCATCTTCAAATCTAATATAACAAAACGAAAACA
GAAGCGTAGAAACAAAATGGAGCTCAGAGATCTAGGTTTATATTTTGCAG
GATCGGTGTTCCAAAAAGGTGATTTAGGAGCAGCAAACCCGAAGACTTAT
AGTGGGCGTTTTGTAAGCTTGTCATGGTCATTTTGTTTCTTGGTGTTGAC
ATCACTGTATACTGCTCTTTTAACAGCTGATCGTGTGGTGACTGGTGGAT
ATAGCTCATTCCATGGCATGAAAGATCAGCGGATGGAATGGGTCCTACTG
AAAGTATGTCTTTTACTTGCAACCCGCATGTGTCAAGAAACCTTAGCTGC
CGTAATATCGCCGAATCATGATGGTAAAAAAATAGATTTAGAGAATAATG
TTAGACAGAATTCAACAAAGGATCTTCGAAGTTCACTACCAAGGCAACTA
AGAATAAACAAAAATCAGGCAATCATTGTGAAGGAACCACGAGATTTTAA
TATCATTTATGTTGAAAATCGAACCGCTATCGTTGAAAGGTTCGAAAATG
AAACAAAAACAATTGTTGATAGCAATGAAGTCAAAACAAGATTATCTTTG
AAAGATAAGTTACAATCCTTGGTTAAGAGAAAAGGTATCACTATATCTTT
ACTAAATCAAGACCAAGAAAGCATGCTTAACCTACGGACGAAAGATTGTA
TTTTACCAACCACGTTTGATGTTCTGATCGAAATTGTAACAAGATTTGAG
CCAAAAGAACTAATTCTCATCTACCATTCGAAGATTTTAAGTCAGGTAGA
TATAATAGACTGGAAAGAAAAAACCTCAAAACACAAAGAATTTAAATTTA
TCGATTTTAAAATCAAAGAAGATGATCTTTATGACCATACAGGGAAGATT
CTAAAAGAAATAAGTCGCTCCACGGATGTTAAGCTGATTATCTTATTCAC
ACCTTTGGAAATCACGAATCTCATTTTCCGGTTACGCTCAGAAAAGTTCC
GGATGATTACTGGAGGAACTTGGATTGTTGATAAGGGAATATATCCTGAA
GCTGATCGGCCACCAAAAATGGCGGAATTTGAATATTTTAAATACCGTGT
AGTGTTGAACTCAGCTTCCATGCGCTATGGAGGCTCAATTTGTGATTTGG
CAACTAAAATGGCAAGCTATTTGCATGCTTTCTTTGCAGAGCACGTTTTC
GTGCTCCCGCACGTCAAGAAGTACGAATGCAAATTCAAGGCTCATAAAAC
ACCAATCCCAGAGGCTAGTTATGGTGCTGTAGTGGCTAAAGGATCACCTC
TAAAAGGACTTGTTTCACAGGCTATTCTCAAACTTAACGATGCTAAAATT
TTGGATGAGTTAAAGGAAAGATGGTTTACAAACGCATGTGAGAATACAGA
ATCGACGAATATAAACCCATTCAACTTAATATTCTTTTCATCACTTTTCA
TGGTTTTATTGTTTGCTGTTGTACTATCTTTCATCGTATTAGGAATNAAA
TACAGAATCGACAAACATAAACCCATTCAACTTAATATTCTTTTCATCAC
TTTTTATGGTTTTATTGTTTGCTGTTGTACTATCTTTCATCGTATTAGGA
ATTGAATCTTAAACCCAACATCAGCTTTCAAGTTTGGTACCATCAATAAT
ACAGTCCTATCTGACTACTTTAAGACAGCGCCATTGGCAAGTGCTCTACG
TATCCATCACTTTATGAAGCGTTATCACCAAAATGATTATAATGTTACAT
TACCACTCCTCGAAAGAAGGAAAGTAATCGAAGAAAAGCTATTGGCAGAT
GAAATACGAATGATCAGGCTTTGGCAACTCCAGACTTGGCGAACTGTATA
CAAAGTCTCATATTTGAACCAGCAGTATCAACTTTCATCTCAAAGTATTT
TCGGTAAAAACCAAAAGATCTCAGTAGTATCAAGACTCGATGAGCCTTTT
TTGATGGAGAATTACATACCGTGTGAGCATTTCCAATGTCAAAAACATAT
CATGTCTTGTCGACTTCCTTTTCATAACAAAACAACTCATATCCGTGAGT
GGAGGTCTTCTAAATGTAGTGGATACGTTGTAGACCTATTGTATGAGTTA
TCAGTAGAAATGCATACAGAATTCGAACTTTACGTCGCCTTTGATGGGGA
GTTCGGAAGATGCGTCAATCGTTCCACCAATGAATGGACAGGGATGATTG
GAGATGTCCTGAGGCGAGAAGCTGATTTAGCTATCCAGGGAATCACCATA
ACAGAAGAACGATTAAAAGTTGTCGATTTCACTTTACCATATTTGCAGAG
TCGGATCGAGATTCTAACATTAAAGGAAATGCCAAAAGAACAGTTGTTCT
CCATGTATTTTCTTGAGTTATATGACTTAGAGGCAAGATATGTTTTGGTG
CCATTGTTTTTACTATCCATCTTATCAGTATATGTATCTGAAAACATAAT
CATCTTCAAATCTAATATAACAAAACGAAAACAGAAGCGTAGAAACAAAA
TGGAGCTCAGAGATCTAGGTTTATATTTTGCAGGATCGGTGTTCCAAAAA
GGTGATTTAGGAGCAGCAAACCCGAAGACTTATAGTGGGCGTTTTGTAAG
CTTGTCATGGTCATTTTGTTTCTTGGTGTTGACATCACTGTATACTGCTC
TTTTAACAGCTGATCGTGTGGTGACTGGTGGATATAGCTCATTCCATGGC
ATGAAAGATCAGCGGATGGAATGGGTCCTACTGAAAGTATGTCTTTTACT
TGCAACCCGCATGTGTCAAGAAACCTTAGCTGCCGTAATATCGCCGAATC
ATGATGGTAAAAAAATAGATTTAGAGAATAATGTTAGACAGAATTCAACA
AAGGATCTTCGAAGTTCACTACCAAGGCAACTAAGAATAAACAAAAATCA
GGCAATCATTGTGAAGGAACCACGAGATTTTAATATCATTTATGTTGAAA
ATCGAACCGCTATCGTTGAAAGGTTCGAAAATGAAACAAAAACAATTGTT
GATAGCAATGAAGTCAAAACAAGATTATCTTTGAAAGATAAGTTACAATC
CTTGGTTAAGAGAAAAGGTATCACTATATCTTTACTAAATCAAGACCAAG
AAAGCATGCTTAACCTACGGACGAAAGATTGTATTTTACCAACCACGTTT
GATGTTCTGATCGAAATTGTAACAAGATTTGAGCCAAAAGAACTAATTCT
CATCTACCATTCGAAGATTTTAAGTCAGGTAGATATAATAGACTGGAAAG
AAAAAACCTCAAAACACAAAGAATTTAAATTTATCGATTTTAAAATCAAA
GAAGATGATCTTTATGACCATACAGGGAAGATTCTAAAAGAAATAAGTCG
CTCCACGGATGTTAAGCTGATTATCTTATTCACACCTTTGGAAATCACGA
ATCTCATTTTCCGGTTACGCTCAGAAAAGTTCCGGATGATTACTGGAGGA
ACTTGGATTGTTGATAAGGGAATATATCCTGAAGCTGATCGGCCACCAAA
AATGGCGGAATTTGAATATTTTAAATACCGTGTAGTGTTGAACTCAGCTT
CCATGCGCTATGGAGGCTCAATTTGTGATTTGGCAACTAAAATGGCAAGC
TATTTGCATGCTTTCTTTGCAGAGCACGTTTTCGTGCTCCCGCACGTCAA
GAAGTACGAATGCAAATTCAAGGCTCATAAAACACCAATCCCAGAGGCTA
GTTATGGTGCTGTAGTGGCTAAAGGATCACCTCTAAAAGGACTTGTTTCA
CAGGCTATTCTCAAACTTAACGATGCTAAAATTTTGGATGAGTTAAAGGA
AAGATGGTTTACAAACGCATGTGAGAATACAGAATCGACGAATATAAACC
CATTCAACTTAATATTCTTTTCATCACTTTTCATGGTTTTATTGTTTGCT
GTTGTACTATCTTTCATCGTATTAGGAATNAAATACAGAATCGACAAACA
TAAACCCATTCAACTTAATATTCTTTTCATCACTTTTTATGGTTTTATTG
TTTGCTGTTGTACTATCTTTCATCGTATTAGGAATTGAATCTTAAACCCA
ACATCAGCTTTCAAGTTTGGTACCATCAATAATACAGTCCTATCTGACTA
CTTTAAGACAGCGCCATTGGCAAGTGCTCTACGTATCCATCACTTTATGA
AGCGTTATCACCAAAATGATTATAATGTTACATTACCACTCCTCGAAAGA
AGGAAAGTAATCGAAGAAAAGCTATTGGCAGATGAAATACGAATGATCAG
GCTTTGGCAACTCCAGACTTGGCGAACTGTATACAAAGTCTCATATTTGA
ACCAGCAGTATCAACTTTCATCTCAAAGTATTTTCGGTAAAAACCAAAAG
ATCTCAGTAGTATCAAGACTCGATGAGCCTTTTTTGATGGAGAATTACAT
ACCGTGTGAGCATTTCCAATGTCAAAAACATATCATGTCTTGTCGACTTC
CTTTTCATAACAAAACAACTCATATCCGTGAGTGGAGGTCTTCTAAATGT
AGTGGATACGTTGTAGACCTATTGTATGAGTTATCAGTAGAAATGCATAC
AGAATTCGAACTTTACGTCGCCTTTGATGGGGAGTTCGGAAGATGCGTCA
ATCGTTCCACCAATGAATGGACAGGGATGATTGGAGATGTCCTGAGGCGA
GAAGCTGATTTAGCTATCCAGGGAATCACCATAACAGAAGAACGATTAAA
AGTTGTCGATTTCACTTTACCATATTTGCAGAGTCGGATCGAGATTCTAA
CATTAAAGGAAATGCCAAAAGAACAGTTGTTCTCCATGTATTTTCTTGAG
TTATATGACTTAGAGGCAAGATATGTTTTGGTGCCATTGTTTTTACTATC
CATCTTATCAGTATATGTATCTGAAAACATAATCATCTTCAAATCTAATA
TAACAAAACGAAAACAGAAGCGTAGAAACAAAATGGAGCTCAGAGATCTA
GGTTTATATTTTGCAGGATCGGTGTTCCAAAAAGGTGATTTAGGAGCAGC
AAACCCGAAGACTTATAGTGGGCGTTTTGTAAGCTTGTCATGGTCATTTT
GTTTCTTGGTGTTGACATCACTGTATACTGCTCTTTTAACAGCTGATCGT
GTGGTGACTGGTGGATATAGCTCATTCCATGGCATGAAAGATCAGCGGAT
GGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCATGTGTC
AAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAAAAATA
GATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGAAGTTC
ACTACCAAGGCAACTAAGAATAAACAAAAATCAGGCAATCATTGTGAAGG
AACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTATCGTT
GAAAGGTTCGAAAATGAAACAAAAACAATTGTTGATAGCAATGAAGTCAA
AACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAGAAAAG
GTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTAACCTA
CGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATCGAAAT
TGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTCGAAGA
TTTTAAGTCAGGTAGATATAATAGACTGGAAAGAAAAAACCTCAAAACAC
AAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTTTATGA
CCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGTTAAGC
TGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCCGGTTA
CGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTTGATAA
GGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCGGAATTTGAAT
ATTTTAAATACCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATGGAGGC
TCAATTTGTGATTTGGCAACTAAAATGGCAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045451XLOC_045451Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073262-exon-scaffold_89-1575043694:168428..169414TCONS_00073262-exon-scaffold_89-1575043694:168428..169414Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1575043694:166703..167648TCONS_00073262-exon-scaffold_89-1575043694:166703..167648Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1575043694:160190..160353TCONS_00073262-exon-scaffold_89-1575043694:160190..160353Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1575043694:158105..159232TCONS_00073262-exon-scaffold_89-1575043694:158105..159232Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1510915933:168428..169414TCONS_00073262-exon-scaffold_89-1510915933:168428..169414Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1510915933:166703..167648TCONS_00073262-exon-scaffold_89-1510915933:166703..167648Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1510915933:160190..160353TCONS_00073262-exon-scaffold_89-1510915933:160190..160353Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1510915933:158105..159232TCONS_00073262-exon-scaffold_89-1510915933:158105..159232Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1491911889:168428..169414TCONS_00073262-exon-scaffold_89-1491911889:168428..169414Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1491911889:166703..167648TCONS_00073262-exon-scaffold_89-1491911889:166703..167648Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1491911889:160190..160353TCONS_00073262-exon-scaffold_89-1491911889:160190..160353Clytia hemisphaericaexon
TCONS_00073262-exon-scaffold_89-1491911889:158105..159232TCONS_00073262-exon-scaffold_89-1491911889:158105..159232Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073262-proteinTCONS_00073262-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:158105..169414 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0.342859 0.612865 0.574929 0.700202 0.181783 1.00097 0.448615 0.941525 0.151038 0.282529 0 0.174987 0.591025 1.47628 0.135394 0.177623 0 0.115993 0 0.0700914 0 0 0 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: Molecular Function
TermDefinition
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
molecular_function GO:0005234 extracellular-glutamate-gated ion channel activity
molecular_function GO:0004970 ionotropic glutamate receptor activity
Blast
BLAST of TCONS_00073262 vs. Swiss-Prot (Human)
Match: NMDZ1 (Glutamate receptor ionotropic, NMDA 1 OS=Homo sapiens GN=GRIN1 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.981e-32
Identity = 104/431 (24.13%), Postives = 195/431 (45.24%), Query Frame = 2
Query: 1226 CRLPFHNKTTHIREWRSSKCSGYVVDLLYELSVEMHTEFELYVAFDGEFG---RCVNRSTNEWTGMIGDVLRREADLAIQGITITEERLKVVDFTLPYLQSRIEILTLKEMPKE------QLFSMYFLELYDLEARYVLVPLFLLSILSVYVSENIIIFKSNITKRKQKRRNKMELRDLGLYFAGSVFQKGDLGAANPKTYSGRFVSLSWSFCFLVLTSLYTALLTADRVVTGGYSSFHGMKDQRILNPTSAFKFGTINNTVLSDYFKTAPLASALRIHHFMKRYHQNDYNVTLPLLERSYLHAFFAEHVFVLPHVKKYECKFKAHKTPIPEASYGAVVAKGSPLKGLVSQAILKLNDAKILDELKERWFTNACENTESTNINPFNLIF--FSSLFMVLLFAVVLSFIVLGXKYRIDKHKPIQLNILFITF 2485
            C  P        R      C G+ +DLL +L+  M+  +E+++  DG+FG   R  N +  EW GM+G++L  +AD+ +  +TI  ER + ++F+ P+    + IL  KE+P+       Q F      L  L    V V L+LL   S +       FK N    +++  + + L    ++F+  V     +G   P+++S R + + W+   +++ + YTA L A  V+        G+ D R+ NP+  F + T+  + +  YF+     S +  H  M++++       +  +  + LHAF  +   VL      +C           + +G  + K SP K  VS +ILK ++   +++L + W     +  +S +  P  L F   + +FM++   +V    ++  +    +HK  +   + + F
Sbjct:  436 CTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGR-----FKVN---SEEEEEDALTLSS-AMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRH--MEKHNYESAAEAIQAVRDNKLHAFIWDSA-VLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVR--YQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAF 852          
The following BLAST results are available for this feature:
BLAST of TCONS_00073262 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NMDZ13.981e-3224.13Glutamate receptor ionotropic, NMDA 1 OS=Homo sapi... [more]
back to top