Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073260 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073260
Unique NameTCONS_00073260
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1807

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073260 ID=TCONS_00073260|Name=TCONS_00073260|organism=Clytia hemisphaerica|type=transcript|length=1807bp
CACGAAACCTTCAATCTAATCGAATTTTCTACATAATAAATTTCGATGTT
ATGTCATTTCATATCAATGaaaaaattgtagaaaaaatACAGAAATAATT
ATTTAGCCGCTGGTGTCACGCACAATGTCAGAAACAACTAACAATAATAC
AAGGTTAGTTTTTAACGTGGGCGGCCAACGCCACGAGGCATTTTTATCAA
CACTAAAAGCTATACCTGGAACTCGTTTATCATggattgctgaaaatttc
atgcTATTGAAACATTCGCCTGCATATGACCCTAtcaaagaagaattttt
ttttgatcgTAGCCCGACGGCATTTGTTCAGATCCTAAACTATTTTCGAA
CCGGCGAATTGCATTATCCTACCAACGTCTGTGGACCCTCATTTGCGACG
GAGCTCCGGTTCTGGGGCCTTGATGAAGAGCAAATGCAAAGCTGTTGCTG
GGAAGGTTTCACTGCAAATAGAGATAAAGACGCAAAGCTGAAAGGTTTTA
AAGGGCCACATTTCGAAATGGATTCATTAGCAGCCGACGAAGACAATTTC
GAAGCACTAGGAAAGCGTTACGAGATTCGCTATAAACTGTGGAAGTTCTT
TGACGATGCATATTCTTCTAAAGCAGCTAAGatttattcTTCAATCCATC
ACGTATTGTTGCTGATTTACATCATACTCCCCATCATAAACTCCATGTCT
TTCATCAAAGACCCTCCAAACGAAAAAGCAAGAAACGCTGGTCTATTCAT
TAATTACAGTGAAATCGTTTTAAACATCTTCTTTACAATGGAGCTTGTCA
TACGATTCATGATATTcccaaacaaaaagaaattcatCCGATCACGATTA
AACATTGCTGATTTCATGTCTATCATTCCGATTTATATTGATATATTATT
TTGCCAATACCCATCGTATAAAAGCTATAAAAACTATATCAATATTCTCG
TCGTGTTCCGCATCTTGAAGATTTTCCGCTCGTTTCGTTACAATTACACA
TTACAAGTACTTTTTAACACACTGAAGTCATCGTTACCTGAACTTCTTCT
GCTGGTTTTCTTGATGATTTTGTTAGCAACCGTTTTTGCGTTCGGTTGTT
ATTTTACCGAACAGGAAGATCCGAATACTGAGTTCCATTCTGTTCTGCAT
AGTCTATGGTGGGCTTTCATTACTATGACAAcgGTTGGATATGGCGACAT
GTATCCAAACAGTTGGTTCGGACGAGTTATCGGTATTATGGCTGCTATAT
GTGGTTTACTCATGGTGGCTCTACCAGTATCAGTTGTCGCTACAAATTTC
TCAATCTATTACAGCTATGCTAAAGCTAGAATATCACTACCTCCAAAAAA
GGAAGTCCGATATGCAAAAGACGCTAACAATTTCTTAGGACAACCTACGA
GTAATGACGAGAAAGAAAGACTTAAACGGAATAAAATTCAACCGGGTACA
CCCTGTGTTACACCAATTAAATTGAGTCCGGTGACTAACAGAAAACCCCG
GTCACAGACATTACCACCAATGAATGATGAACGCTTTTCAAAAATTCACC
GGGCCGTTCAAAAGATGAGACAAGACGGTTTGTTAAGtagtaaaagaaag
aaaatggatTTACCAACTCTTGTTATGGTGCTGTCCAGTAAAGGAGATTG
GACCCAACCAAAgtagtgaagaaaaaaaacagaaaagtgtGGAAAAATCC
ACAGccctatacaccttttcgaccgtagtcgcacgggcatttttttgtcc
actttatcccactaaaaccgtcccaatccttttttgacgcatttttctat
tgtctat
Run BLAST on NCBI

protein sequence of TCONS_00073260-protein

>TCONS_00073260-protein ID=TCONS_00073260-protein|Name=TCONS_00073260-protein|organism=Clytia hemisphaerica|type=polypeptide|length=513bp
MSETTNNNTRLVFNVGGQRHEAFLSTLKAIPGTRLSWIAENFMLLKHSPA
YDPIKEEFFFDRSPTAFVQILNYFRTGELHYPTNVCGPSFATELRFWGLD
EEQMQSCCWEGFTANRDKDAKLKGFKGPHFEMDSLAADEDNFEALGKRYE
IRYKLWKFFDDAYSSKAAKIYSSIHHVLLLIYIILPIINSMSFIKDPPNE
KARNAGLFINYSEIVLNIFFTMELVIRFMIFPNKKKFIRSRLNIADFMSI
IPIYIDILFCQYPSYKSYKNYINILVVFRILKIFRSFRYNYTLQVLFNTL
KSSLPELLLLVFLMILLATVFAFGCYFTEQEDPNTEFHSVLHSLWWAFIT
MTTVGYGDMYPNSWFGRVIGIMAAICGLLMVALPVSVVATNFSIYYSYAK
ARISLPPKKEVRYAKDANNFLGQPTSNDEKERLKRNKIQPGTPCVTPIKL
SPVTNRKPRSQTLPPMNDERFSKIHRAVQKMRQDGLLSSKRKKMDLPTLV
MVLSSKGDWTQPK
Run BLAST on NCBI

transcript from alignment at scaffold_89:120537..123740-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073260 ID=TCONS_00073260|Name=TCONS_00073260|organism=Clytia hemisphaerica|type=transcript|length=3204bp|location=Sequence derived from alignment at scaffold_89:120537..123740- (Clytia hemisphaerica)
CACGAAACCTTCAATCTAATCGAATTTTCTACATAATAAATTTCGATGTT ATGTCATTTCATATCAATGAAAAAATTGTAGAAAAAATACAGAAATAATT ATTTAGCCGCTGGTGTCACGCACAATGTCAGAAACAACTAACAATAATAC AAGGTTAGTTTTTAACGTGGGCGGCCAACGCCACGAGGCATTTTTATCAA CACTAAAAGCTATACCTGGAACTCGTTTATCATGGATTGCTGAAAATTTC ATGCTATTGAAACATTCGCCTGCATATGACCCTATCAAAGAAGAATTTTT TTTTGATCGTAGCCCGACGGCATTTGTTCAGATCCTAAACTATTTTCGAA CCGGCGAATTGCATTATCCTACCAACGTCTGTGGACCCTCATTTGCGACG GAGCTCCGGTTCTGGGGCCTTGATGAAGAGCAAATGCAAAGCTGTTGCTG GGAAGGTTTCACTGCAAATAGAGATAAAGACGCAAAGCTGAAAGGTTTTA AAGGGCCACATTTCGAAATGGATTCATTAGCAGCCGACGAAGACAATTTC GAAGCACTAGGAAAGCGTTACGAGATTCGCTATAAACTGTGGAAGTTCTT TGACGATGCATATTCTTCTAAAGCAGCTAAGGTAAATATATTATAACGGG TTTATGTTTGATACCAAGCATTTTGAGTTGCAGGGTTTCAAATCCTTAGA TTTTGTTCCACGAATGAAAAATGTCTTGCGACGGAGCCCCCCCCCACACT ATTCACTTTGAAAATTGTCTTAAAATCCATTCCTATTTTAATGGGTTAAA AGTAACGTAAAACTACGACATATCGGGAAAATAGGTCGAACTCTCAAACA ATTCAACTTTTTACTATATTACTTGTCACTGACACATGAGATTTAATCAT TGAAAACTTTGAAACCATAAGTGGCTAAAGAAAAGTTCAAGGAGAAAATT GATATTGTTGAGTAAACAGCAATGGTATTTATAAGTGGTACCTCCCAAGT GGTACCTCTCATCAAGTAATAGCTCCAACTTATTTTGCTTTCTTCACGAC CATGAAATTTGCCACAAACTTATTCTACGAGCAAAAAAAGCTCGAACTAG CCCACATGCAAACTACTGAGTCGACCTCATTTCCACAACATAACTATAAA TAACTGGAATGGCTACTCTAAGGTCCCAAATGATAAGGAGGGTTCCGAAT AATTGTACCTCCATAAAACCTTTTTTATTCATATACTAAAACCAGACTAT TTAGAGCAATTCAGCTTGTGATAGTTGAAAATATGACATTAAAGAATACT AACATATAATACTAAAGCGACCGTAGTGCAGTGATAGAGCATCCGGAAAC GGCTTGCAAGCTTGCAAGATTCCCAAAATGGTACTTGATGCCTCTCTGCT TGATGCTCAACAATTAAGAGGGGCCCTAAGAGCAGGATCAAGGGTAAGTG GAGCAATCCAGGGAGAAAGAGTGGCACCCTCCCCTACCTGCGTATATAGC TATCGAAAGAGGAGCCTTCGGGTTGCCTCCGACAACTTACTTACTTAACA TACAATATACTTTAAATTTTTAGATTTATTCTTCAATCCATCACGTATTG TTGCTGATTTACATCATACTCCCCATCATAAACTCCATGTCTTTCATCAA AGACCCTCCAAACGAAAAAGCAAGAAACGCTGGTCTATTCATTAATTACA GTGAAATCGTTTTAAACATCTTCTTTACAATGGAGCTTGTCATACGATTC ATGATATTCCCAAACAAAAAGAAATTCATCCGATCACGATTAAACATTGC TGATTTCATGTCTATCATTCCGATTTATATTGATATATTATTTTGCCAAT ACCCATCGTATAAAAGCTATAAAAACTATATCAATATTCTCGTCGTGTTC CGCATCTTGAAGATTTTCCGCTCGTTTCGTTACAATTACACATTACAAGT ACTTTTTAACACACTGAAGTCATCGTTACCTGAACTTCTTCTGCTGGTTT TCTTGATGATTTTGTTAGCAACCGTTTTTGCGTTCGGTTGTTATTTTACC GAACAGGAAGATCCGAATACTGAGTTCCATTCTGTTCTGCATAGTCTATG GTGGGCTTTCATTACTATGACAACGGTAAAAAAAATTACTTTTTCAAACT TTAACTGGGGAATATAGGCAATATACTTATTGGGGGGCACTTAGGCAAAA TCGGGTAAGGGAACGTGCCACTCGCCAGGGTCCCCTTTTTAGGGGATATC AGATATCTGACATGGTCTAAAATTTACTAATTTTCAAGATGTGTTCTGAC AGGATCGACTTTTGGTAATTTTGGACCATTCTCAGGGTGGAAATTAGAAA AAAGTTCAATTTTTCGTCTACTTTTATTCATTTCGGCCACCTGAAAATAG GAAAACTTTTCGATTTTTCTTTCTGACAGGGTCCAACTCCAGCGGCACGT CCCCATCAGCCGCCAAGCCCCCCCCGGTGTATATTCCCTATATAATTTTC TGGAATCTAAGACCAAGATTTTTCTTTATTTACGTTCTCAACGTTTACGT CAGCCTCATGATCATCTTTTCTACCGCTAGGTTGGATATGGCGACATGTA TCCAAACAGTTGGTTCGGACGAGTTATCGGTATTATGGCTGCTATATGTG GTTTACTCATGGTGGCTCTACCAGTATCAGTTGTCGCTACAAATTTCTCA ATCTATTACAGCTATGCTAAAGCTAGAATATCACTACCTCCAAAAAAGGA AGTCCGATATGCAAAAGACGCTAACAATTTCTTAGGACAACCTACGAGTA ATGACGAGAAAGAAAGACTTAAACGGAATAAAATTCAACCGGGTACACCC TGTGTTACACCAATTAAATTGAGTCCGGTGACTAACAGAAAACCCCGGTC ACAGACATTACCACCAATGAATGATGAACGCTTTTCAAAAATTCACCGGG CCGTTCAAAAGATGAGACAAGACGGTTTGTTAAGTAGTAAAAGAAAGAAA ATGGATTTACCAACTCTTGTTATGGTGCTGTCCAGTAAAGGAGATTGGAC CCAACCAAAGTAGTGAAGAAAAAAAACAGAAAAGTGTGGAAAAATCCACA GCCCTATACACCTTTTCGACCGTAGTCGCACGGGCATTTTTTTGTCCACT TTATCCCACTAAAACCGTCCCAATCCTTTTTTGACGCATTTTTCTATTGT CTAT

Coding sequence (CDS) from alignment at scaffold_89:120537..123740-

>TCONS_00073260 ID=TCONS_00073260|Name=TCONS_00073260|organism=Clytia hemisphaerica|type=CDS|length=4626bp|location=Sequence derived from alignment at scaffold_89:120537..123740- (Clytia hemisphaerica)
GTTGGATATGGCGACATGTATCCAAACAGTTGGTTCGGACGAGTTATCGG
TATTATGGCTGCTATATGTGGTTTACTCATGGTGGCTCTACCAGTATCAG
TTGTCGCTACAAATTTCTCAATCTATTACAGCTATGCTAAAGCTAGAATA
TCACTACCTCCAAAAAAGGAAGTCCGATATGCAAAAGACGCTAACAATTT
CTTAGGACAACCTACGAGTAATGACGAGAAAGAAAGACTTAAACGGAATA
AAATTCAACCGGGTACACCCTGTGTTACACCAATTAAATTGAGTCCGGTG
ACTAACAGAAAACCCCGGTCACAGACATTACCACCAATGAATGATGAACG
CTTTTCAAAAATTCACCGGGCCGTTCAAAAGATGAGACAAGACGGTTTGT
TAAGTAGTAAAAGAAAGAAAATGGATTTACCAACTCTTGTTATGGTGCTG
TCCAGTAAAGGAGATTGGACCCAACCAAAGTAGATTTATTCTTCAATCCA
TCACGTATTGTTGCTGATTTACATCATACTCCCCATCATAAACTCCATGT
CTTTCATCAAAGACCCTCCAAACGAAAAAGCAAGAAACGCTGGTCTATTC
ATTAATTACAGTGAAATCGTTTTAAACATCTTCTTTACAATGGAGCTTGT
CATACGATTCATGATATTCCCAAACAAAAAGAAATTCATCCGATCACGAT
TAAACATTGCTGATTTCATGTCTATCATTCCGATTTATATTGATATATTA
TTTTGCCAATACCCATCGTATAAAAGCTATAAAAACTATATCAATATTCT
CGTCGTGTTCCGCATCTTGAAGATTTTCCGCTCGTTTCGTTACAATTACA
CATTACAAGTACTTTTTAACACACTGAAGTCATCGTTACCTGAACTTCTT
CTGCTGGTTTTCTTGATGATTTTGTTAGCAACCGTTTTTGCGTTCGGTTG
TTATTTTACCGAACAGGAAGATCCGAATACTGAGTTCCATTCTGTTCTGC
ATAGTCTATGGTGGGCTTTCATTACTATGACAACGATGTCAGAAACAACT
AACAATAATACAAGGTTAGTTTTTAACGTGGGCGGCCAACGCCACGAGGC
ATTTTTATCAACACTAAAAGCTATACCTGGAACTCGTTTATCATGGATTG
CTGAAAATTTCATGCTATTGAAACATTCGCCTGCATATGACCCTATCAAA
GAAGAATTTTTTTTTGATCGTAGCCCGACGGCATTTGTTCAGATCCTAAA
CTATTTTCGAACCGGCGAATTGCATTATCCTACCAACGTCTGTGGACCCT
CATTTGCGACGGAGCTCCGGTTCTGGGGCCTTGATGAAGAGCAAATGCAA
AGCTGTTGCTGGGAAGGTTTCACTGCAAATAGAGATAAAGACGCAAAGCT
GAAAGGTTTTAAAGGGCCACATTTCGAAATGGATTCATTAGCAGCCGACG
AAGACAATTTCGAAGCACTAGGAAAGCGTTACGAGATTCGCTATAAACTG
TGGAAGTTCTTTGACGATGCATATTCTTCTAAAGCAGCTAAGGTTGGATA
TGGCGACATGTATCCAAACAGTTGGTTCGGACGAGTTATCGGTATTATGG
CTGCTATATGTGGTTTACTCATGGTGGCTCTACCAGTATCAGTTGTCGCT
ACAAATTTCTCAATCTATTACAGCTATGCTAAAGCTAGAATATCACTACC
TCCAAAAAAGGAAGTCCGATATGCAAAAGACGCTAACAATTTCTTAGGAC
AACCTACGAGTAATGACGAGAAAGAAAGACTTAAACGGAATAAAATTCAA
CCGGGTACACCCTGTGTTACACCAATTAAATTGAGTCCGGTGACTAACAG
AAAACCCCGGTCACAGACATTACCACCAATGAATGATGAACGCTTTTCAA
AAATTCACCGGGCCGTTCAAAAGATGAGACAAGACGGTTTGTTAAGTAGT
AAAAGAAAGAAAATGGATTTACCAACTCTTGTTATGGTGCTGTCCAGTAA
AGGAGATTGGACCCAACCAAAGTAGATTTATTCTTCAATCCATCACGTAT
TGTTGCTGATTTACATCATACTCCCCATCATAAACTCCATGTCTTTCATC
AAAGACCCTCCAAACGAAAAAGCAAGAAACGCTGGTCTATTCATTAATTA
CAGTGAAATCGTTTTAAACATCTTCTTTACAATGGAGCTTGTCATACGAT
TCATGATATTCCCAAACAAAAAGAAATTCATCCGATCACGATTAAACATT
GCTGATTTCATGTCTATCATTCCGATTTATATTGATATATTATTTTGCCA
ATACCCATCGTATAAAAGCTATAAAAACTATATCAATATTCTCGTCGTGT
TCCGCATCTTGAAGATTTTCCGCTCGTTTCGTTACAATTACACATTACAA
GTACTTTTTAACACACTGAAGTCATCGTTACCTGAACTTCTTCTGCTGGT
TTTCTTGATGATTTTGTTAGCAACCGTTTTTGCGTTCGGTTGTTATTTTA
CCGAACAGGAAGATCCGAATACTGAGTTCCATTCTGTTCTGCATAGTCTA
TGGTGGGCTTTCATTACTATGACAACGATGTCAGAAACAACTAACAATAA
TACAAGGTTAGTTTTTAACGTGGGCGGCCAACGCCACGAGGCATTTTTAT
CAACACTAAAAGCTATACCTGGAACTCGTTTATCATGGATTGCTGAAAAT
TTCATGCTATTGAAACATTCGCCTGCATATGACCCTATCAAAGAAGAATT
TTTTTTTGATCGTAGCCCGACGGCATTTGTTCAGATCCTAAACTATTTTC
GAACCGGCGAATTGCATTATCCTACCAACGTCTGTGGACCCTCATTTGCG
ACGGAGCTCCGGTTCTGGGGCCTTGATGAAGAGCAAATGCAAAGCTGTTG
CTGGGAAGGTTTCACTGCAAATAGAGATAAAGACGCAAAGCTGAAAGGTT
TTAAAGGGCCACATTTCGAAATGGATTCATTAGCAGCCGACGAAGACAAT
TTCGAAGCACTAGGAAAGCGTTACGAGATTCGCTATAAACTGTGGAAGTT
CTTTGACGATGCATATTCTTCTAAAGCAGCTAAGGTTGGATATGGCGACA
TGTATCCAAACAGTTGGTTCGGACGAGTTATCGGTATTATGGCTGCTATA
TGTGGTTTACTCATGGTGGCTCTACCAGTATCAGTTGTCGCTACAAATTT
CTCAATCTATTACAGCTATGCTAAAGCTAGAATATCACTACCTCCAAAAA
AGGAAGTCCGATATGCAAAAGACGCTAACAATTTCTTAGGACAACCTACG
AGTAATGACGAGAAAGAAAGACTTAAACGGAATAAAATTCAACCGGGTAC
ACCCTGTGTTACACCAATTAAATTGAGTCCGGTGACTAACAGAAAACCCC
GGTCACAGACATTACCACCAATGAATGATGAACGCTTTTCAAAAATTCAC
CGGGCCGTTCAAAAGATGAGACAAGACGGTTTGTTAAGTAGTAAAAGAAA
GAAAATGGATTTACCAACTCTTGTTATGGTGCTGTCCAGTAAAGGAGATT
GGACCCAACCAAAGTAGATTTATTCTTCAATCCATCACGTATTGTTGCTG
ATTTACATCATACTCCCCATCATAAACTCCATGTCTTTCATCAAAGACCC
TCCAAACGAAAAAGCAAGAAACGCTGGTCTATTCATTAATTACAGTGAAA
TCGTTTTAAACATCTTCTTTACAATGGAGCTTGTCATACGATTCATGATA
TTCCCAAACAAAAAGAAATTCATCCGATCACGATTAAACATTGCTGATTT
CATGTCTATCATTCCGATTTATATTGATATATTATTTTGCCAATACCCAT
CGTATAAAAGCTATAAAAACTATATCAATATTCTCGTCGTGTTCCGCATC
TTGAAGATTTTCCGCTCGTTTCGTTACAATTACACATTACAAGTACTTTT
TAACACACTGAAGTCATCGTTACCTGAACTTCTTCTGCTGGTTTTCTTGA
TGATTTTGTTAGCAACCGTTTTTGCGTTCGGTTGTTATTTTACCGAACAG
GAAGATCCGAATACTGAGTTCCATTCTGTTCTGCATAGTCTATGGTGGGC
TTTCATTACTATGACAACGATGTCAGAAACAACTAACAATAATACAAGGT
TAGTTTTTAACGTGGGCGGCCAACGCCACGAGGCATTTTTATCAACACTA
AAAGCTATACCTGGAACTCGTTTATCATGGATTGCTGAAAATTTCATGCT
ATTGAAACATTCGCCTGCATATGACCCTATCAAAGAAGAATTTTTTTTTG
ATCGTAGCCCGACGGCATTTGTTCAGATCCTAAACTATTTTCGAACCGGC
GAATTGCATTATCCTACCAACGTCTGTGGACCCTCATTTGCGACGGAGCT
CCGGTTCTGGGGCCTTGATGAAGAGCAAATGCAAAGCTGTTGCTGGGAAG
GTTTCACTGCAAATAGAGATAAAGACGCAAAGCTGAAAGGTTTTAAAGGG
CCACATTTCGAAATGGATTCATTAGCAGCCGACGAAGACAATTTCGAAGC
ACTAGGAAAGCGTTACGAGATTCGCTATAAACTGTGGAAGTTCTTTGACG
ATGCATATTCTTCTAAAGCAGCTAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045450XLOC_045450Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073260-proteinTCONS_00073260-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073260-exon-scaffold_89-1575043694:123110..123740TCONS_00073260-exon-scaffold_89-1575043694:123110..123740Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1575043694:121616..122167TCONS_00073260-exon-scaffold_89-1575043694:121616..122167Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1575043694:120537..121160TCONS_00073260-exon-scaffold_89-1575043694:120537..121160Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1510915933:123110..123740TCONS_00073260-exon-scaffold_89-1510915933:123110..123740Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1510915933:121616..122167TCONS_00073260-exon-scaffold_89-1510915933:121616..122167Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1510915933:120537..121160TCONS_00073260-exon-scaffold_89-1510915933:120537..121160Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1491911889:123110..123740TCONS_00073260-exon-scaffold_89-1491911889:123110..123740Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1491911889:121616..122167TCONS_00073260-exon-scaffold_89-1491911889:121616..122167Clytia hemisphaericaexon
TCONS_00073260-exon-scaffold_89-1491911889:120537..121160TCONS_00073260-exon-scaffold_89-1491911889:120537..121160Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:120537..123740 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.290267 0.176664 0.127793 0.148582 0.0299397 0.11932 0.228347 0.160352 0.131448 0.209604 0.157554 0.0593549 0.478085 0.310786 0.165609 0.27126 0.252348 0.257991 0.525212 0.29834 0.432483 0.445491 0.204527 0.117685 0.408908 0.191462 0.155362 0.0988006 0.0502016 0.201692
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003974K_chnl_volt-dep_Kv3
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR000210BTB/POZ_dom
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ
Vocabulary: Biological Process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
Vocabulary: Molecular Function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: Cellular Component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006811 ion transport
biological_process GO:0006813 potassium ion transport
biological_process GO:0051260 protein homooligomerization
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016020 membrane
cellular_component GO:0008076 voltage-gated potassium channel complex
molecular_function GO:0005216 ion channel activity
molecular_function GO:0005515 protein binding
molecular_function GO:0005249 voltage-gated potassium channel activity
Blast
BLAST of TCONS_00073260 vs. Swiss-Prot (Human)
Match: KCNC1 (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.782e-71
Identity = 161/448 (35.94%), Postives = 241/448 (53.79%), Query Frame = 2
Query:  140 NNNTRLVFNVGGQRHEAFLSTLKAIPGTRLSWIAENFMLLKHSP-AYDPIKEEFFFDRSPTAFVQILNYFRTGELHYPTNVCGPSFATELRFWGLDEEQMQSCCWEGFTANRDKDAKLKGFK--------------GP--------HFEMDSLAADEDNFEALGKRYEIRY--KLWKFFDDXXXXXXXXXXXXXHHVXXXXXXXXXXXNSMS----FIKDPPNEKARNAG-----------LFINYSEIVLNIFFTMELVIRFMIFPNKKKFIRSRLNIADFMSIIPIYIDILFCQYPSYKSYKNYINILVVFR---ILKIFRSFRYNYTLQVLFNTXXXXXXXXXXXXXXXXXXATVFAFGCYFTEQ-----EDP----NTEFHSVLHSLWWAFITMTTVGYGDMYPNSWFGRVIGIMAAICGLLMVALPVSVVATNFSIYYSYAKA 1327
            + + R+V NVGG RH+ + STL+ +PGTRL+W+AE      HS   YDP  +EFFFDR P  F  ILNY+RTG+LH P +VCGP +  EL FWG+DE  ++ CCW  +  +RD +  L  F               GP          EM    A  D+ +     +  R+  ++W  F+D YSS+ A+  +      +L+ I    + +       +     E  RN              F+ Y E V  ++FT E ++R +  PNK +FI++ LNI DF++I+P Y+++      S K+ K+ +  L V R   IL+IF+  R+   L+VL +TL++S  E LLL+  + L   +FA   Y+ E+      DP    +T F ++    WWA +TMTT+GYGDMYP +W G ++G + A+ G+L +A+PV V+  NF +YYS A A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEP---DAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS-KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
The following BLAST results are available for this feature:
BLAST of TCONS_00073260 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCNC11.782e-7135.94Potassium voltage-gated channel subfamily C member... [more]
back to top