Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00072054 ID=TCONS_00072054|Name=TCONS_00072054|organism=Clytia hemisphaerica|type=transcript|length=334bpRun BLAST on NCBI protein sequence of TCONS_00072054-protein >TCONS_00072054-protein ID=TCONS_00072054-protein|Name=TCONS_00072054-protein|organism=Clytia hemisphaerica|type=polypeptide|length=111bp RDCVEIAQREDLDAFMISLDQTKAFDRVSWNFLFKLLHKMKFGSKFIRWIRun BLAST on NCBI transcript from alignment at scaffold_7:73684..74017 Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00072054 ID=TCONS_00072054|Name=TCONS_00072054|organism=Clytia hemisphaerica|type=transcript|length=334bp|location=Sequence derived from alignment at scaffold_7:73684..74017 (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_7:73684..74017 >TCONS_00072054 ID=TCONS_00072054|Name=TCONS_00072054|organism=Clytia hemisphaerica|type=CDS|length=333bp|location=Sequence derived from alignment at scaffold_7:73684..74017 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00072054 vs. Swiss-Prot (Human)
Match: LORF2 (LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens PE=1 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.846e-18 Identity = 38/104 (36.54%), Postives = 66/104 (63.46%), Query Frame = -2 Query: 10 EIAQREDLDAFMISLDQTKAFDRVSWNFLFKLLHKMKFGSKFIRWIKLLYTNISSNVKINGVTSKSFLLERGVRQGCPLSPLLYVLYSEIIALLVNTDPEIKGI 321 I + +D + +IS+D KAFD++ F+ K L+K+ +++ I+ +Y ++N+ +NG ++F L+ G RQGCPLSPLL+ + E++A + + EIKGI Sbjct: 585 HINRAKDKNHVIISIDAEKAFDKIQQPFMLKTLNKLGIDGMYLKIIRAIYDKPTANIILNGQKLEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKEIKGI 688 The following BLAST results are available for this feature:
BLAST of TCONS_00072054 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|