Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072054-protein ID=TCONS_00072054-protein|Name=TCONS_00072054-protein|organism=Clytia hemisphaerica|type=polypeptide|length=111bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072054-protein vs. Swiss-Prot (Human)
Match: LORF2 (LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens PE=1 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.174e-19 Identity = 38/104 (36.54%), Postives = 66/104 (63.46%), Query Frame = 0 Query: 5 EIAQREDLDAFMISLDQTKAFDRVSWNFLFKLLHKMKFGSKFIRWIKLLYTNISSNVKINGVTSKSFLLERGVRQGCPLSPLLYVLYSEIIALLVNTDPEIKGI 108 I + +D + +IS+D KAFD++ F+ K L+K+ +++ I+ +Y ++N+ +NG ++F L+ G RQGCPLSPLL+ + E++A + + EIKGI Sbjct: 585 HINRAKDKNHVIISIDAEKAFDKIQQPFMLKTLNKLGIDGMYLKIIRAIYDKPTANIILNGQKLEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKEIKGI 688 The following BLAST results are available for this feature:
BLAST of TCONS_00072054-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|