Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00071686 ID=TCONS_00071686|Name=TCONS_00071686|organism=Clytia hemisphaerica|type=transcript|length=891bpRun BLAST on NCBI transcript from alignment at scaffold_63:781679..782569+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00071686 ID=TCONS_00071686|Name=TCONS_00071686|organism=Clytia hemisphaerica|type=transcript|length=891bp|location=Sequence derived from alignment at scaffold_63:781679..782569+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00071686 vs. Swiss-Prot (Human)
Match: MMSA (Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens GN=ALDH6A1 PE=1 SV=2) HSP 1 Score: 117.472 bits (293), Expect = 1.916e-29 Identity = 53/68 (77.94%), Postives = 60/68 (88.24%), Query Frame = 3 Query: 606 QAIEIINNNKYGNGTAIFTNSGSAARKFTQEVDVGQIGVNVPIPVPLPMFSFTGSRGSFRGDLNFYGK 809 +AI+I+NNN YGNGTAIFT +G+ ARK+ VDVGQ+GVNVPIPVPLPMFSFTGSR SFRGD NFYGK Sbjct: 433 EAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGK 500 The following BLAST results are available for this feature:
BLAST of TCONS_00071686 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|