Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00067348 ID=TCONS_00067348|Name=TCONS_00067348|organism=Clytia hemisphaerica|type=transcript|length=1988bpRun BLAST on NCBI transcript from alignment at scaffold_469:411296..415667+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00067348 ID=TCONS_00067348|Name=TCONS_00067348|organism=Clytia hemisphaerica|type=transcript|length=4372bp|location=Sequence derived from alignment at scaffold_469:411296..415667+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00067348 vs. Swiss-Prot (Human)
Match: RNF38 (E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4) HSP 1 Score: 127.872 bits (320), Expect = 3.586e-31 Identity = 52/90 (57.78%), Postives = 71/90 (78.89%), Query Frame = 2 Query: 695 ENYEALLNLADTLGPGKPRGLDKTEIERIPSFRFSSNTAKETNVKCVVCISEYTNREKLRRLPCSHDFHAKCIDKWLKSNKTCPVCRDEV 964 ENYEALLNLA+ LG KPRGL K +IE++PS+RF+ N + CVVC+ ++ +R+ LR LPC+H+FHAKC+DKWLK+N+TCP+CR + Sbjct: 418 ENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 507 The following BLAST results are available for this feature:
BLAST of TCONS_00067348 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|