Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00063654 ID=TCONS_00063654|Name=TCONS_00063654|organism=Clytia hemisphaerica|type=transcript|length=498bpRun BLAST on NCBI transcript from alignment at scaffold_397:64968..65832- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00063654 ID=TCONS_00063654|Name=TCONS_00063654|organism=Clytia hemisphaerica|type=transcript|length=865bp|location=Sequence derived from alignment at scaffold_397:64968..65832- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00063654 vs. Swiss-Prot (Human)
Match: DJC13 (DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=5) HSP 1 Score: 107.457 bits (267), Expect = 1.394e-26 Identity = 50/70 (71.43%), Postives = 60/70 (85.71%), Query Frame = 2 Query: 2 RFREKVGIKVVKALKRGDDGVTHAAVDMLAALMQPMHENYSLRQEQLNKASLLFSKSFLEDLLGLFNDHV 211 +FRE++G+KVVKALKR ++G+ HAAVDML ALM PMH++Y LRQEQLNKASLL SK FLE+LL FN HV Sbjct: 450 KFRERLGVKVVKALKRSNNGIIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHV 519 The following BLAST results are available for this feature:
BLAST of TCONS_00063654 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|