Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00063265 ID=TCONS_00063265|Name=TCONS_00063265|organism=Clytia hemisphaerica|type=transcript|length=595bpRun BLAST on NCBI transcript from alignment at scaffold_385:587394..588052+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00063265 ID=TCONS_00063265|Name=TCONS_00063265|organism=Clytia hemisphaerica|type=transcript|length=659bp|location=Sequence derived from alignment at scaffold_385:587394..588052+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00063265 vs. Swiss-Prot (Human)
Match: B3GT6 (Beta-1,3-galactosyltransferase 6 OS=Homo sapiens GN=B3GALT6 PE=1 SV=2) HSP 1 Score: 97.8265 bits (242), Expect = 3.551e-24 Identity = 42/84 (50.00%), Postives = 56/84 (66.67%), Query Frame = -1 Query: 167 IGVWLASIKLNRFHDVRFDTWYKSMGCSNLHIVSHKQQPEDMYAKHNQLTNNGKLCKVEKELMLTWDYNWNEFPSNCCSKRVKI 418 +G WLA + + R HD RFDT Y+S GCSN ++V+HKQ EDM KH L G+LCK E +L L++ Y+W+ PS CC +R I Sbjct: 245 LGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGI 328 The following BLAST results are available for this feature:
BLAST of TCONS_00063265 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|