Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00056773 ID=TCONS_00056773|Name=TCONS_00056773|organism=Clytia hemisphaerica|type=transcript|length=791bpRun BLAST on NCBI protein sequence of TCONS_00056773-protein >TCONS_00056773-protein ID=TCONS_00056773-protein|Name=TCONS_00056773-protein|organism=Clytia hemisphaerica|type=polypeptide|length=156bp ASSKSVGNLLDQSLANLKQSVEALRQSNQKLTADYQTLKNQVTFLRGLHGRun BLAST on NCBI transcript from alignment at scaffold_282:180043..180833- Legend: exonthree_prime_UTRCDSfive_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00056773 ID=TCONS_00056773|Name=TCONS_00056773|organism=Clytia hemisphaerica|type=transcript|length=791bp|location=Sequence derived from alignment at scaffold_282:180043..180833- (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_282:180043..180833- >TCONS_00056773 ID=TCONS_00056773|Name=TCONS_00056773|organism=Clytia hemisphaerica|type=CDS|length=471bp|location=Sequence derived from alignment at scaffold_282:180043..180833- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00056773 vs. Swiss-Prot (Human)
Match: MFAP4 (Microfibril-associated glycoprotein 4 OS=Homo sapiens GN=MFAP4 PE=1 SV=2) HSP 1 Score: 90.5077 bits (223), Expect = 2.776e-21 Identity = 45/104 (43.27%), Postives = 62/104 (59.62%), Query Frame = -3 Query: 331 KCAPCKSVKDSKYCDCTEIQPRQDCLEFYQAGYKINGIYRLHGHRFSV-LNTYCDQTTDNGGWTTFLRRTNGSVNFTRNWNDYKLGFGKLTGEFWFGNENVHDL 639 CAP S + +Q DC + Y GY+ +G+Y ++ SV + +CD TT+ G WT F +R NGSV+F R WNDYKLGFG+ GE+W G +N+H L Sbjct: 17 PCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLL 120 The following BLAST results are available for this feature:
BLAST of TCONS_00056773 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|