Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00051052 ID=TCONS_00051052|Name=TCONS_00051052|organism=Clytia hemisphaerica|type=transcript|length=798bpRun BLAST on NCBI transcript from alignment at scaffold_193:212533..222613+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00051052 ID=TCONS_00051052|Name=TCONS_00051052|organism=Clytia hemisphaerica|type=transcript|length=10081bp|location=Sequence derived from alignment at scaffold_193:212533..222613+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00051052 vs. Swiss-Prot (Human)
Match: STX3 (Syntaxin-3 OS=Homo sapiens GN=STX3 PE=1 SV=3) HSP 1 Score: 56.6102 bits (135), Expect = 9.969e-18 Identity = 32/83 (38.55%), Postives = 53/83 (63.86%), Query Frame = 1 Query: 343 DQTMADISKRSQRTKRLLKEIKEGVEEDQENGDNSSHCRMKRCQFNALSLEFMDNMTRYNAIQELFRAKSKSRIKRQLNITKK 591 +Q +I KR+ + LK +++ +EED+ +S+ R+++ Q + LS +F++ MT+YN Q FR +SK RI+RQL IT K Sbjct: 78 EQLTTEIKKRANNVRNKLKSMEKHIEEDEVR--SSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK 158 HSP 2 Score: 50.8322 bits (120), Expect = 9.969e-18 Identity = 21/49 (42.86%), Postives = 36/49 (73.47%), Query Frame = 3 Query: 651 FYTRLTDTDDAKRRLKEVEDRHNDIIKLEKSVQELHSLFKDISILIDKQ 797 F + + D+ +K+ L E+E RH DI++LE S++ELH +F DI++L++ Q Sbjct: 177 FTSGIIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQ 225 The following BLAST results are available for this feature:
BLAST of TCONS_00051052 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|