Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00044865 ID=TCONS_00044865|Name=TCONS_00044865|organism=Clytia hemisphaerica|type=transcript|length=273bpRun BLAST on NCBI transcript from alignment at sc0006351:4..1158- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00044865 ID=TCONS_00044865|Name=TCONS_00044865|organism=Clytia hemisphaerica|type=transcript|length=1155bp|location=Sequence derived from alignment at sc0006351:4..1158- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00044865 vs. Swiss-Prot (Human)
Match: ERI2 (ERI1 exoribonuclease 2 OS=Homo sapiens GN=ERI2 PE=2 SV=2) HSP 1 Score: 85.5001 bits (210), Expect = 3.075e-20 Identity = 38/86 (44.19%), Postives = 53/86 (61.63%), Query Frame = 3 Query: 3 QVDGGISTRQCLKYFEDWVRKWKEEKQFTFDQNLNCK-----KRCALATWTDWDLNVCLKYECKRKGIQYPNYMKSWIDLKKTYKV 245 QVD G+ + CL F W+ K +++K F ++ K CA TW+DWDL VCL+YECKRK + P ++ SWIDL+ TYK+ Sbjct: 103 QVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPSASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKL 188 The following BLAST results are available for this feature:
BLAST of TCONS_00044865 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|